CLUSTAL format seed alignment for MF_01210_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CARB_CAMJE      MPKRTDIKSILLIGSGPIVIGQACEFDYSGTQAAKTLKELGYRVVLINSNPATIMTDPEF
CARB_HELPJ      MPKRTDISNILLIGSGPIVIGQACEFDYSGTQSCKTLKSLGYRVILINSNPATVMTDPEF
CARB_CORGL      MPKRSDINHVLVIGSGPIVIGQACEFDYSGTQACRVLKEEGLRVTLINSNPATIMTDPEM
CARB_MYCTU      MPRRTDLHHVLVIGSGPIVIGQACEFDYSGTQACRVLRAEGLQVSLVNSNPATIMTDPEF
CARB_STRCO      MPKRTDIQSVLVIGSGPIVIGQAAEFDYSGTQACRVLKAEGLRVVLVNSNPATIMTDPEI
CARB_DEIRA      MPKRTDLQTILILGSGPIQIGQAAEFDYSGTQALKALKNEGYRVILVNSNPATIMTDPEL
CARB_THET2      MPPRRDLKKILIIGSGPITIGQAAEFDYSGTQAVKALRGAGYRVVLVNSNPATIMTDPEL
CARB_SYNY3      MPRRNDLNKIMILGAGPIVIGQACEFDYSGTQACKALKEEGYEVVLVNSNPASIMTDPEL
CARB_BRUME      MPKRTDIKSILIIGAGPIVIGQACEFDYSGTQACKALKEEGYRIILVNSNPATIMTDPDL
CARB_AGRFC      MPKRQDIKSILIIGAGPIVIGQACEFDYSGTQACKALKEEGYRVILVNSNPATIMTDPGL
CARB_RHIME      MPKRQDIKSILIIGAGPIVIGQACEFDYSGTQACKALKEEGYRVILVNSNPATIMTDPGL
CARB_BUCAI      MPKSTDIKSILILGAGPIVIGQACEFDYSGTQACKALKEEGYRIILLNSNPATIMTDPDM
CARB_XYLFA      MPKRTDLRTILIIGAGPIVIGQACEFDYSGAQACKALRAEGFRVVLVNSNPATIMTDPDM
CARB_HALER      MPKRTDIQSILIIGAGPIVIGQACEFDYSGAQACKALREEGFRVILVNSNPATIMTDPVM
CARB_NEIMB      MPKRTDLKSILIIGAGPIVIGQACEFDYSGAQACKALREEGYKVILVNSNPATIMTDPEM
CARB_PASMU      MPKRTDINTILIIGAGPIVIGQACEFDYSGAQACKALREEGYKVVLVNSNPATIMTDPDM
CARB_RALSO      MPKRTDIKTILIIGAGPIIIGQACEFDYSGAQACKALREEGFKVVLVNSNPATIMTDPST
CARB_ECOLI      MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVILVNSNPATIMTDPEM
CARB_PSEAE      MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVILVNSNPATIMTDPAM
CARB_BACHD      MGKREDIKKILVIGSGPIVIGQAAEFDYAGTQACQALKEEGYEVILVNSNPATIMTDTTM
CARB_BACCL      MPKRRDIETILVIGSGPIVIGQAAEFDYAGTQACLALKEEGYKVILVNSNPATIMTDTEI
CARB_BACSU      MPKRVDINKILVIGSGPIIIGQAAEFDYAGTQACLALKEEGYEVILVNSNPATIMTDTEM
CARB_LISMO      MPKRDDIKTILVIGSGPIVIGQAAEFDYAGTQACLSLKEEGYRVVLVNSNPATIMTDAEM
CARB_STRPN      MPKRTDIQKIMVIGSGPIIIGQAAEFDYAGTQACLSLKEEGYEVVLVNSNPATIMTDKEI
CARB_STRP8      MPKRKDIQKIMVIGSGPIIIGQAAEFDYAGTQACLALKEEGYKVILVNSNPATIMTDKEI
CARB_LACPL      MPKRTDIHKIMVIGSGPIIIGQAAEFDYSGTQACLALKELDYEVVLVNSNPATIMTDKEI
CARB_FUSNN      MPKRKDIKTILVIGSGPIIIGQAAEFDYAGTQACLSLREEGYEVILVNSNPATIMTDKEI
CARB_STAAW      MPKRNDIKTILVIGSGPIIIGQAAEFDYAGTQACLALKEEGYRVILVNSNPATIMTDKEI
CARB_LACLM      MPKRNDIKKIMIIGSGPIIIGQAAEFDYAGTQACLALKEEGYEVVLVNSNPATIMTDREI
CARY_BACHD      MPKRTDIQSVLVIGSGPIVIGQAAEFDYAGAQACLALREEGIQVILVNNNPATVMTDEAC
CARY_GEOSE      MPKDSSLQSILLIGSGRSSSAKAAEFDYSGTQACIAFKEEGYRVILVNNNPATIMTDDVH
CARY_BACSU      MPKDTSISSILVIGSGPIIIGQAAEFDYSGTQGCIALKEEGYRVILVNSNPATIMTDEAF
CARY_LACPL      MPKNNAIHSIAVIGSGPIKIGQAAEFDYAGTQACLSLKAAGYHVILINSNPATIMTDTAT
CARB_CLOAB      MPLDKTIKKVLIIGSGPNNIGQAAEFDYSGTQACKAVKEEGIETVLVNSNPATIMTDSHI
CARB_CLOPE      MPLNKDIKKVLVIGSGPIIIGQAAEFDYSGTQACQALKEEGIEVVLVNSNPATIMTDKEI
CARB_CALS4      MPKYKDISKVLVIGSGPIIIGQAAEFDYSGTQACKSLKEEGVQVVLVNNNPATIMTDTDI
                *     :  : ::*:*    .:*.****:*:*.   .:  . .  *:*.***::***   

CARB_CAMJE      ADATYIEPITKESILSIIKKE-----KIDAILPTMGGQVALNVAMEVYESGLLG--DVKF
CARB_HELPJ      SHQTYIQPITPENIAAIIKKE-----KIDAILPTMGGQTALNAVMQMHQRGMLE--GVEL
CARB_CORGL      ADHTYVEPIEPEYIDKIFAKEIEQGHPIDAVLATLGGQTALNAAIQLDRLGILEKYGVEL
CARB_MYCTU      ADHTYVEPITPAFVERVIAQQAERGNKIDALLATLGGQTALNTAVALYESGVLEKYGVEL
CARB_STRCO      ADATYVEPITPEFVEKIIAKE-----RPDALLPTLGGQTALNTAISLHGNGVLEKYGVEL
CARB_DEIRA      ADATYLEPLTPEFVEKIIEKE-----KPDAILPTLGGQTALNLAMELHERGSLEKYGVEL
CARB_THET2      AERTYIEPLDLEHLEGILARE-----APDALLPTLGGQTGLNLAMALYEEGILQKYGVEL
CARB_SYNY3      ADRTYIEPLIPEIVEKIIEKE-----RPDAVLPTMGGQTALNLAVSLSKSGVLEKYGVEL
CARB_BRUME      ADATYIEPITPEVVAKIIAKE-----RPDAILPTMGGQTALNTALSLRRMGVLERYNVEM
CARB_AGRFC      ADATYVEPITPEVVAKIIAKE-----RPDALLPTMGGQTALNTALSLKRMGVLDRYNVEM
CARB_RHIME      ADATYVEPITPEVVAKIIAKE-----RPDALLPTMGGQTALNTALSLRRMGVLDRYNVEM
CARB_BUCAI      ADATYVEPIHWEIVEKIIQKE-----KPDALLPTMGGQTALNCALELDHKGILKKYGVQI
CARB_XYLFA      ADAVYIEPIHWRTVEKIIAKE-----KPDALLPTMGGQTALNCALDLADHGVLEKYGVEL
CARB_HALER      ADATYIEPITWQAVEKIIEAE-----RPDAVLPTMGGQTALNCALDLDKHGVLEKFGVEM
CARB_NEIMB      ADVTYIEPIMWQTVEKIIAKE-----RPDAILPTMGGQTALNCALDLARNGVLAKYNVEL
CARB_PASMU      ADVTYIEPIEWRTVEKIIEKE-----RPDAILPTMGGQTALNCALDLSKNGVLKKYNVEL
CARB_RALSO      ADVTYIEPITWEVVERIIAKE-----RPDAILPTMGGQTALNCALDLHRHGVLEKYNVEL
CARB_ECOLI      ADATYIEPIHWEVVRKIIEKE-----RPDAVLPTMGGQTALNCALELERQGVLEEFGVTM
CARB_PSEAE      ADATYIEPIKWATVAKIIEKE-----RPDALLPTMGGQTALNCALDLERHGVLEKFGVEM
CARB_BACHD      ADRVYIEPLTLEFVSRIIRME-----RPDGILPTLGGQTGLNMAVELDQAGILKEYNVEL
CARB_BACCL      ADKVYMEPLTLDFVARIIRKE-----RPDAILPTLGGQTGLNLAVELAKAGVLEECGVEI
CARB_BACSU      ADRVYIEPLTPEFLTRIIRKE-----RPDAILPTLGGQTGLNLAVELSERGVLAECGVEV
CARB_LISMO      ADKVYIEPITLDFVSRIIRKE-----RPDAILPTLGGQTGLNMAMELSAAGILDECNVEV
CARB_STRPN      ADKVYIEPITLEFVTRILRKE-----GPDALLPTLGGQTGLNMAMELSKNGILDELGVEL
CARB_STRP8      ADKIYIEPLTLEFVNRIIRKE-----RPDAILPTLGGQTGLNMAMALSKAGILDDLEIEL
CARB_LACPL      ADQVYLEPITLEFVSQILRKE-----HPDAILPTLGGQQGLNMAMELSKSGILDELHIEL
CARB_FUSNN      ADKVYIEPLTVEFLSKIIRKE-----KPDALLPTLGGQVALNLAVSLHESGILDECGVEI
CARB_STAAW      ADKVYIEPLTHDFIARIIRKE-----QPDALLPTLGGQTGLNMAIQLHESGVLQDNNVQL
CARB_LACLM      ADTVYIEPITLEFVSKILRKE-----RPDALLPTLGGQTGLNMAMELSKTGILEELNVEL
CARY_BACHD      ADVVYFEPLTVASVKNIIERE-----RPDGLLATLGGQTGLNLAMKLEEAGILEAYNVEL
CARY_GEOSE      ADAVYFEPLTVEAVEAIIAKE-----TPDGLLATFGGQTGLNLAFQLHEAGVLKKYGVRL
CARY_BACSU      ADEIYFEPLTAESLTAIIKKE-----RPDGLLANLGGQTALNLAVELEETGVLKEHGVKL
CARY_LACPL      ADEVYLEPLTLTSVTKILRAA-----HPDALLPTLGGQTGLNLAMALDQAGVLNELKIQL
CARB_CLOAB      ADKVYIEPLTEEAVEKIIEKE-----RPDGILAGFGGQTALNLAMNLNDAGVLDKYNVRL
CARB_CLOPE      ADKVYLEPLTVEFVEKVIEKE-----RPDSLLAGMGGQTGLNLAVELYEKGILDKYNVKV
CARB_CALS4      ADIVYIENPTVEVVEKIIAKE-----RPDGILATLGGQTGLNLAVKLKEAGILDKYNVKL
                :.  *.:      :  ::          *.:*. :*** .** .. :   * *    : .

CARB_CAMJE      LGANPEAIKKGEDRQ-VFKECMKKIGMDL-----PKSMYA--------------------
CARB_HELPJ      LGAKIEAIKKGEDRQ-AFKEAMLKIGMDL-----PKGRYA--------------------
CARB_CORGL      IGADIDAIERGEDRQ-KFKDIVTTIGGES-----ARSRVC--------------------
CARB_MYCTU      IGADFDAIQRGEDRQ-RFKDIVAKAGGES-----ARSRVC--------------------
CARB_STRCO      IGANVEAINKGEDRD-LFKEVVEEVRKKIGHGESARSYIC--------------------
CARB_DEIRA      IGAGVEAIKKGEDRE-LFQAAMKKIGVET-----ARGKMV--------------------
CARB_THET2      IGAKAEAIRKGEDRE-AFQEAMRRIDLEV-----PRGQLV--------------------
CARB_SYNY3      IGAKLPAIEMGEDRE-LFKEAMARIGVPV-----CPSGIA--------------------
CARB_BRUME      IGAKAEAIDKAEDRA-LFREAMKKIGLDT-----PGSMFANATEIKDEDRKRHEVKRAEV
CARB_AGRFC      IGAKPEAIDMAEDRA-LFREAMARIGLET-----PKSMLANATEIKDADRKTHEAARTEL
CARB_RHIME      IGAKPEAIDKAEDRA-LFREAMAHIGLET-----PKSRLANATDIKDHDRKSHEAERSAL
CARB_BUCAI      IGATVDAIKKAENRK-LFEHSMKKLNLET-----AKCGIA--------------------
CARB_XYLFA      IGAKREAIRMAEDRE-LFRVAMQEIGLEC-----PKAEVA--------------------
CARB_HALER      IGANADAINMAEDRD-LFDQAMKRIGLEC-----PKAKVA--------------------
CARB_NEIMB      IGATEDAIDKAEDRG-RFKEAMEKIGLSC-----PKSFVC--------------------
CARB_PASMU      IGAKEDAIDKAEDRG-RFKEAMEKIGLST-----PKSFVC--------------------
CARB_RALSO      IGASPEAIDKAEDRQ-KFKEAMTKIGLGS-----AKSGIA--------------------
CARB_ECOLI      IGATADAIDKAEDRR-RFDVAMKKIGLET-----ARSGIA--------------------
CARB_PSEAE      IGANADTIDKAEDRS-RFDKAMKDIGLAC-----PRSGIA--------------------
CARB_BACHD      LGTKLDSIQQAEDRD-LFRALMKELNEPV-----PDSEII--------------------
CARB_BACCL      LGTKLEAIEKAEDRE-QFRALMNELGEPV-----PESAII--------------------
CARB_BACSU      LGTKLSAIQQAEDRD-LFRTLMNELNEPV-----PESEII--------------------
CARB_LISMO      LGTDLTAIKKAEDRE-AFRDLMNELGEPV-----PESDII--------------------
CARB_STRPN      LGTKLSAIDQAEDRD-LFKQLMEELEQPI-----PESEIV--------------------
CARB_STRP8      LGTKLSAIDQAEDRD-LFKQLMQELDQPI-----PESTIV--------------------
CARB_LACPL      LGTKLSAIDQAEDRE-QFKALMEELGEPV-----PASGIA--------------------
CARB_FUSNN      LGTKLTSIKQAEDRE-LFRDLMNELNEPV-----PDSAIV--------------------
CARB_STAAW      LGTELTSIQQAEDRE-MFRTLMNDLNVPV-----PESDIV--------------------
CARB_LACLM      LGTKLSAIDQAEDRE-LFKELCESINEPL-----CASDIA--------------------
CARY_BACHD      LGTPMESIKKGEDRE-AFRQLMHELHEPV-----PESEIV--------------------
CARY_GEOSE      LGTPIEAIKRPRGGPRTFRALMHELGEPV-----PESEIV--------------------
CARY_BACSU      LGTSVETIQKGEDRE-KFRSLMNELKQPV-----PESEIV--------------------
CARY_LACPL      LGTSLATINQAEDRA-AFKTLMKRLHQPI-----PASTTV--------------------
CARB_CLOAB      LGINSEAIKKAEDRE-EFKNLMEEIDEPV-----PKSIIA--------------------
CARB_CLOPE      IGTSIESIKEGEDRE-LFRDMMNRINQPV-----IQSEII--------------------
CARB_CALS4      LGTSVESIKTAEDRE-LFKRKMQEIGEPV-----AESVTV--------------------
                :*    :*   ..    *                                          

CARB_CAMJE      ---------------------------------YNYDEALKAVDEI-------D-FPLMI
CARB_HELPJ      ---------------------------------YSELEALEAISEI-------G-FPAII
CARB_CORGL      ---------------------------------HNMEEVHETVAEL-------G-LPVVV
CARB_MYCTU      ---------------------------------FTMAEVRETVAEL-------G-LPVVV
CARB_STRCO      ---------------------------------HSMDDVLKGVDAL-------GGYPVVV
CARB_DEIRA      ---------------------------------HSMEEAVEYQKEI-------G-LPIVI
CARB_THET2      ---------------------------------GSVEEGLHFAREV-------G-FPVVV
CARB_SYNY3      ---------------------------------SSIEEARQVAHEI-------GSYPLII
CARB_BRUME      KAQFSGDELDKALDKLETEWQLGEVERKQRYMSHALAKAAQALDVV-------G-LPAII
CARB_AGRFC      KAKLSGAELDKALDNLENQWNLGETDRKQRYISHAMAIAAQAIDVV-------G-LPAII
CARB_RHIME      KAKLSGDELDKALDELENQWNLGEGDRKQRYVNHAMAIAAQALDDV-------G-LPAII
CARB_BUCAI      ---------------------------------HNIQEAFLVLNNV-------G-FPCII
CARB_XYLFA      ---------------------------------KSLERALEIQAKV-------G-FPTII
CARB_HALER      ---------------------------------HSMDEAWQIQSEL-------G-FPVII
CARB_NEIMB      ---------------------------------HTMNEALAAQEQV-------G-FPTLI
CARB_PASMU      ---------------------------------HTLEEAWAAQSEV-------G-FPTLI
CARB_RALSO      ---------------------------------HSLEEALAVQAQIARETSSGG-YPIVI
CARB_ECOLI      ---------------------------------HTMEEALAVAADV-------G-FPCII
CARB_PSEAE      ---------------------------------HSMEEAYGVLEQV-------G-FPCII
CARB_BACHD      ---------------------------------HTLEEAYTFVERV-------G-YPIIV
CARB_BACCL      ---------------------------------HSLEEAYAFVEQI-------G-YPVIV
CARB_BACSU      ---------------------------------HSLEEAEKFVSQI-------G-FPVIV
CARB_LISMO      ---------------------------------HNLDEAYAFVERI-------G-YPVIV
CARB_STRPN      ---------------------------------NTVEEAVAFAATI-------G-YPVIV
CARB_STRP8      ---------------------------------KTVDEAVTFARDI-------G-YPVIV
CARB_LACPL      ---------------------------------RTVDEALAFAKQA-------G-YPVIV
CARB_FUSNN      ---------------------------------HTLEEAENFVKEI-------D-YPVIV
CARB_STAAW      ---------------------------------NTVEQAFKFKEQV-------G-YPLIV
CARB_LACLM      ---------------------------------TTVEEAINIADKI-------G-YPIIV
CARY_BACHD      ---------------------------------HSVAEAVDFANTV-------G-YPIIV
CARY_GEOSE      ---------------------------------TSVEEAVAFAEQI-------G-FPIII
CARY_BACSU      ---------------------------------DNEADALHFAESI-------G-FPVII
CARY_LACPL      ---------------------------------HHVTSALSFAEKIG--------YPVIV
CARB_CLOAB      ---------------------------------THIDECIDFVNKF-------G-LPVII
CARB_CLOPE      ---------------------------------TDLDAGIAFARKI-------G-YPVIV
CARB_CALS4      ---------------------------------TNVEDALKFAKNY-------G-YPLII
                                                                        * ::

CARB_CAMJE      RASYTLGGAGSGVVYNMDEFKELTNTALALSPIHEILIEESLLGWKEYEMEVIRDRADNC
CARB_HELPJ      RASFTLAGGGSGVAYNIEEFQELAKNALDASPINEILIEESLLGWKEYEMEVIRDGKDNC
CARB_CORGL      RPSFTMGGLGSGLAYNTEDLERIAGGGLAASPEANVLIEESILGWKEFELELMRDTADNV
CARB_MYCTU      RPSFTMGGLGSGIAYSTDEVDRMAGAGLAASPSANVLIEESIYGWKEFELELMRDGHDNV
CARB_STRCO      RPSFTMGGAGSGFAHDEDELRRIAGQGLTLSPTTEVLLEESILGWKEYELELMRDKNDNV
CARB_DEIRA      RPSFTLGGTGGGIAHTYEEFLAITEGGLRDSPVTSVLLEESILGWKEYELEVMRDTADTV
CARB_THET2      RPSFTLGGTGGGIAHDEAELVEVLSRGLTLSPVHTALVEESVLGWKEFELEVMRDHADTV
CARB_SYNY3      RPAFTLAGTGGGIAYNQEEYEEMVQYGLDQSPMSQILVEKSLLGWKEYELEVMRDLADNV
CARB_BRUME      RPSFTLGGTGGGIAYNRQEFFEIIERGLDASPTTEVLIEESVLGWKEYEMEVVRDHADNC
CARB_AGRFC      RPSFTMGGTGGGIAYNRSEFFEIIGGGLDASPTTEVLIEESVLGWKEYEMEVVRDKADNC
CARB_RHIME      RPSFTLGGTGGGIAYNRSEFFEIVGSGLDASPTTEVLIEESVLGWKEYEMEVVRDKADNC
CARB_BUCAI      RPSFTMGGHGGGIAYNHEEFEKICERGLELSPSTELLIDESLIGWKEYEMEVVRDKNDNC
CARB_XYLFA      RPSFTLGGTGGGITYNRQEFEEIIKRGLELSPVHEVLVEESVLGWKEFEMEVVRDASDNC
CARB_HALER      RPSYTMGGSGGGVAYNKEEFEEICTRGFELSNNHELLIDESLLGWKEYEMEVVRDKNDNC
CARB_NEIMB      RPSFTMGGSGGGIAYNKDEFLAICERGFDASPTHELLIEQSVLGWKEYEMEVVRDKNDNC
CARB_PASMU      RPSFTMGGSGGGIAYNKDEFYAICERGFDASPTHELLIEQSVLGWKEYEMEVVRDKADNC
CARB_RALSO      RPSFTLGGTGGGIAYNREEFEDICKRGLDLSPTNELLIEESLLGWKEYEMEVVRDKKDNC
CARB_ECOLI      RPSFTMGGSGGGIAYNREEFEEICARGLDLSPTKELLIDESLIGWKEYEMEVVRDKNDNC
CARB_PSEAE      RPSFTMGGTGGGIAYNREEFEEICARGLDLSPTNELLIDESLIGWKEYEMEVVRDKKDNC
CARB_BACHD      RPAYTLGGTGGGLVYNEEDLVEIVTSGLKYSPVTQCLVEKSIAGFKEIEYEVMRDGKDHA
CARB_BACCL      RPAFTLGGTGGGICTNEEELVEIVSTGLKLSPVHQCLLERSIAGYKEIEYEVMRDANDNA
CARB_BACSU      RPAYTLGGTGGGICSNETELKEIVENGLKLSPVHQCLLEKSIAGYKEIEYEVMRDSQDHA
CARB_LISMO      RPAYTLGGSGGGICHNEQELIETVTSGLKLSPVTQCLLEKSIAGFKEVEYEVMRDANNNA
CARB_STRPN      RPAFTLGGTGGGMCANEKELREITENGLKLSPVTQCLIERSIAGFKEIEYEVMRDSADNA
CARB_STRP8      RPAFTLGGTGGGICSSEEELCEITENGLKLSPVTQCLIERSIAGFKEIEYEVMRDSADNA
CARB_LACPL      RPAFTMGGTGGGIAETPQQLHDITENGLALSPVTQVLIEQSIAGYKEIEFEVMRDAADNA
CARB_FUSNN      RPAFTMGGTGGGICYNEEDLHEIVPNGLNYSPVHQCLLEKSIAGYKEIEYEVMRDSNDTA
CARB_STAAW      RPAFTMGGTGGGICHNDEELHEIVSNGLHYSPATQCLLEKSIAGFKEIEYEVMRDKNDNA
CARB_LACLM      RPAFTMGGTGGGICDTEEELREIVANGLKLSPVTQCLIEESIAGYKEIEYEVMRDSADNA
CARY_BACHD      RPAYTLGGAGGGIAESEEALIRIVKGGLELSPIQQCLIEKSIAGFKEIEYEVMRDSNDTC
CARY_GEOSE      RPAYTLGGTGGGIAENMEQFLALVEKGLNESPIHQCLIERSVAGFKEIEYEVMRDQSNTC
CARY_BACSU      RPAYTLGGKGGGIAPDKEAFTAMIKQALLASPINQCLVEKSIAGFKEIEYEVMRDSNNTC
CARY_LACPL      RPAFTLGGSGGGIANNAAELTQTLQRGLTMSPVTECLIEQSIAGFKEIEFEVMRDNQGTK
CARB_CLOAB      RPAFTLGGTGGGIASTMEELKEICDRGIKMSPIGQILLEQSVAGWKELEYEVMRDAKDNC
CARB_CLOPE      RPAYTLGGTGGGIANNEEELIETLTSGLQLSTIGQVLLEKSVKGWKEIEYEVMRDSFGNC
CARB_CALS4      RPAYTLGGTGGGIAHNDEELISIVDLGLKKSMVGEVLVEKSLYGWKEIEFEVMRDAADNC
                *.::*:.* *.*.             .:  *     *::.*: *:** * *::**  .  

CARB_CAMJE      IIVCSIENIDPMGVHTGDSITIAPALTLTDKEYQVMRNASFAILREIGVDTGGSNVQFAI
CARB_HELPJ      IIVCCIENIDPMGVHTGDSITIAPSLTLTDKEYQRMRDASFAILREIGVDTGGSNVQFAI
CARB_CORGL      VVICSIENVDALGVHTGDSVTVAPALTLTDREFQKMRDQGIAIIREVGVDTGGCNIQFAI
CARB_MYCTU      VVVCSIENVDPMGVHTGDSVTVAPAMTLTDREYQRMRDLGIAILREVGVDTGGCNIQFAV
CARB_STRCO      VVVCSIENFDPMGVHTGDSITVAPAMTLTDREYQTLRDVGIAIIREVGVDTGGCNIQFAV
CARB_DEIRA      IIITSIENFDPMGVHTGDSITVAPAQTLSDVEYQRLRDQSLAIIREIGVATGGSNIQFAV
CARB_THET2      VIITSIENVDPMGVHTGDSITVAPAQTLSDVEYQRMRDAAKAIIREIGVETGGSNIQFAV
CARB_SYNY3      VIICSIENFDPMGVHTGDSITVAPAQTLTDKEYQRLRDYSIAIIREIGVETGGSNIQFSV
CARB_BRUME      IIICSIENLDPMGVHTGDSITVAPALTLTDKEYQIMRNASIAVLREIGVETGGSNVQFAI
CARB_AGRFC      IIICSIENIDPMGVHTGDSITVAPALTLTDKEYQMMRNASIAVLREIGVETGGSNVQFAV
CARB_RHIME      IIICSIENIDPMGVHTGDSITVAPALTLTDKEYQIMRNASIAVLREIGVETGGSNVQFAV
CARB_BUCAI      IIVCSIENLDPMGIHTGDSITVAPAQTLTDKEYQVMRNASMSILREIGVETGGSNVQFAI
CARB_XYLFA      IIVCSIENLDPMGVHTGDSITVAPAQTLSDKEYQRLRDASIAVLRKIGVDTGGSNVQFGI
CARB_HALER      IIVCAIENFDPMGVHTGDSITVAPAQTLTDKEYQNMRDASLAVLREIGVETGGSNVQFGV
CARB_NEIMB      IIICSIENFDPMGVHTGDSITVAPAQTLTDKEYQIMRNASLAVLREIGVDTGGSNVQFAV
CARB_PASMU      IIVCSIENFDPMGVHTGDSITVAPAQTLTDKEYQIMRNASIAVLREIGVDTGGSNVQFAI
CARB_RALSO      IIVCSIENLDPMGIHTGDSITVAPAQTLTDKEYQILRNASLAVLREIGVDTGGSNVQFSI
CARB_ECOLI      IIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGGSNVQFAV
CARB_PSEAE      IIVCSIENFDPMGVHTGDSITVAPAQTLTDKEYQIMRNASLAVLREIGVETGGSNVQFGI
CARB_BACHD      IVVCNMENIDPVGVHTGDSIVVAPSQTLSDREYQMLRNSSLKIIRALGIE-GGCNVQFAL
CARB_BACCL      IVVCNMENIDPVGIHTGDSIVVAPSQTLSDREYQLLRNASLKIIRALGIE-GGCNVQLAL
CARB_BACSU      IVVCNMENIDPVGIHTGDSIVVAPSQTLSDREYQLLRNVSLKLIRALGIE-GGCNVQLAL
CARB_LISMO      MVVCNMENIDPVGIHTGDSIVVAPSQTLSDREYQLLRDVSLKIIRALEIE-GGCNVQLAL
CARB_STRPN      LVVCNMENFDPVGIHTGDSIVFAPAQTMSDYENQMLRDASLSIIRALKIE-GGCNVQLAL
CARB_STRP8      LVVCNMENFDPVGIHTGDSIVFAPTQTLSDIENQMLRDASLKIIRALKIE-GGCNVQLAL
CARB_LACPL      MVVCNMENFDPVGIHTGDSIVYAPVQTLADREVQLLRDAALKIIRALKIE-GGCNVQLAL
CARB_FUSNN      IVVCNMENIDPVGIHTGDSIVVAPSQTLTDREHHMLRDVSLKIIRALKIE-GGCNVQIAL
CARB_STAAW      IVVCNMENIDPVGIHTGDSIVVAPSQTLSDVEYQMLRDVSLKVIRALGIE-GGCNVQLAL
CARB_LACLM      IVVCNMENFDPVGVHTGDSIVFAPSQTLSDNEYQMLRDASLNIIRALKIE-GGCNVQLAL
CARY_BACHD      ITVCNMENIDPVGVHTGDSIVVAPSQTLTDQEYQMLRSASLKIIRTLGIV-GGCNIQFAL
CARY_GEOSE      ITVCNMENVDPVGIHTGDSIVVAPSQTLTDEEYQMLRSSAVKIISALGII-GGCNIQFAL
CARY_BACSU      ITVCNMENIDPVGVHTGDSIVVAPSQTLTDEDYQMLRTASLTIISALDVV-GGCNIQFAL
CARY_LACPL      IIVCSMENFDPVGIHTGDSIVYAPVQTLTDTEYQQLRTAALTIVEALDIR-GGYNVQLAQ
CARB_CLOAB      IIVCNMENLDPVGVHTGDSIVTAPSQTLTDKEYHMLRHSALKIIRNLKIE-GGCNIQFAL
CARB_CLOPE      ITVCNMENIDPVGIHTGDSIVVAPSQTLSDKEYQMLRSASIDIINAVGIE-GGCNVQFAL
CARB_CALS4      ITICSMENFDPVGVHTGDSIVVAPAQTLSDYEYQMLRSASIKIIRALKIE-GGCNIQFAL
                : :  :**.*.:*:*****:. **  *::* : : :*  .  ::  : :  ** *:*:. 

CARB_CAMJE      NPKNGRMIVIEMNPRVSRSSALASKATGYPIAKVATLLAVGFSLDEIKNDITG--TPASF
CARB_HELPJ      HPETLRMVVIEMNPRVSRSSALASKATGFPIAKVATMLAVGFSLDEIKNDITN--TPASF
CARB_CORGL      NPVDGRIITIEMNPRVSRSSALASKATGFPIAKMAAKLAIGYTLDEITNDITG-ETPAAF
CARB_MYCTU      NPRDGRLIVIEMNPRVSRSSALASKATGFPIAKIAAKLAIGYTLDEIVNDITG-ETPACF
CARB_STRCO      NPEDGRVIVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDEIPNDITQ-ETPASF
CARB_DEIRA      NPDNGRVIVIEMNPRVSRSSALASKATGFPIAKIAALLAVGYHLDELPNDITR-VTPASF
CARB_THET2      DPKTGRQVVIEMNPRVSRSSALASKATGFPIAKIAALLAVGYRLDELPNDITR-KTPASF
CARB_SYNY3      NPANGDVIVIEMNPRVSRSSALASKATGFPIAKFAAKLAVGYTLNEISNDITK-KTPASF
CARB_BRUME      NPANGRMIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELDNDITGGATPASF
CARB_AGRFC      NPKDGRLVVIEMNPRVSRSSALASKATGFPIAKVAAKLAIGYTLDELENDITGGATPASF
CARB_RHIME      NPENGRLVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDELENDITGGATPASF
CARB_BUCAI      NPKNGRMIVIEMNPRVSRSSALASKATGFPIAKIAAKLAIGYTLDELANDITGTNTTASF
CARB_XYLFA      DPQTGRVVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDELKNEITGGKMPASF
CARB_HALER      DPDTGRVVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDELSNDITGGRTPASF
CARB_NEIMB      NPANGEMIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGFTLDELRNDITGGKTPASF
CARB_PASMU      NPENGEMIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLNELRNDITGGLIPASF
CARB_RALSO      NPEDGRMIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELKNEITGGATPASF
CARB_ECOLI      NPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDITGGRTPASF
CARB_PSEAE      CPNTGRMVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDELQNDITGGRTPASF
CARB_BACHD      DPDSFQYYIIEVNPRVSRSSALASKATGYPIAKIAAKIAVGYTLDELLNPITQ-TTYASF
CARB_BACCL      DPDSFRYYVIEVNPRVSRSSALASKATGYPIAKLAAKIAVGLTLDEMINPVTG-KTYACF
CARB_BACSU      DPDSFQYYIIEVNPRVSRSSALASKATGYPIAKLAAKIAVGLSLDEMMNPVTG-KTYAAF
CARB_LISMO      DPDSYNYYVIEVNPRVSRSSALASKATGYPIAKLAAKIAVGLTLDEVRNPVTG-TTFAHF
CARB_STRPN      DPNSFKYYVIEVNPRVSRSSALASKATGYPIAKLAAKIAVGLTLDEVINPVTG-STYAMF
CARB_STRP8      DPYSFKYYVIEVNPRVSRSSALASKATGYPIAKLAAKIAVGLTLDEMINPITG-TTYAMF
CARB_LACPL      DPNSFNYYIIEVNPRVSRSSALASKATGYPIAKMAAKIAVGLHLDEIKNPVTG-TTYAEF
CARB_FUSNN      DPNSFKYYIIEVNPRVSRSSALASKATGYPIAKIAAKIAVGMTLDEIINPVTK-SSYACF
CARB_STAAW      DPHSFDYYIIEVNPRVSRSSALASKATGYPIAKLAAKIAVGLTLDEMLNPITG-TSYAAF
CARB_LACLM      DPNSYEYRVIEVNPRVSRSSALASKATGYPIAKMSAKIAIGMTLDEIINPVTN-KTYAMF
CARY_BACHD      DPDSKQYYLIEVNPRVSRSSALASKATGYPIARMAAKLSLGYGLHELKNPVTE-DTYASF
CARY_GEOSE      DPNSKQYYLIEVNPRVSRSSALASKATGYPIAALPAKLAVGYTLAELVNPVTK-TTYASF
CARY_BACSU      DPFSKQYYVIEVNPRVSRSSALASKATGYPIAKMAAKLAVGYTLDELKNPLTG-STYASF
CARY_LACPL      DPNSRQYYVIEVNPRVSRSSALASKATGYPIAKIAADIAIGLNLSEIKNPVTQ-TTYAAF
CARB_CLOAB      NPKSNDYIVIEVNPRVSRSSALASKAAGYPIAKIAAKIAVGYSLDELKNYVTK-NSSACF
CARB_CLOPE      NPHSFEYAVIEINPRVSRSSALASKATGYPIAKVAAKIALGYGLDEIKNAVTG-MTYACF
CARB_CALS4      DPQSHKYYVIEVNPRVSRSSALASKATGYPIAKIAAKIAIGLRLDEIKNPVTG-KTTAFF
                 *       **:**************:*:*** ..: :::*  * *: * :*     * *

CARB_CAMJE      EPVIDYIVTKIPRFTFEKFPGANTTLG-------TAMKSVGEVMAIGRTFKESIQKALCS
CARB_HELPJ      EPSLDYIVVKIPRFAFEKFAGVSSTLG-------TSMKSIGEVMAIGGNFLEALQKALCS
CARB_CORGL      EPTIDYVVVKAPRFAFEKFVGADDTLT-------TTMKSVGEVMSLGRNYIAALNKALRS
CARB_MYCTU      EPTLDYVVVKAPRFAFEKFPGADPTLT-------TTMKSVGEAMSLGRNFVEALGKVMRS
CARB_STRCO      EPTLDYVVVKAPRFAFEKFPSADSTLT-------TTMKSVGEAMAIGRNFTEAFQKALRS
CARB_DEIRA      EPSIDYVVTKIPRFAFEKFPGTPDGLG-------TQMRSVGEVMAIGRTFKESLQKALRS
CARB_THET2      EPTIDYVVVKIPRFAFEKFRPLRNTLGELKDELTTQMKSVGEVMAIGRTFKEALMKALRG
CARB_SYNY3      EPTIDYVVTKIPRFAFEKFPGAEPILN-------TQMKSVGEAMAIGRTFQESFQKALRS
CARB_BRUME      EPSIDYVVTKIPRFAFEKFPGSSPILT-------TAMKSVGEVMAIGRTFQESLQKALRG
CARB_AGRFC      EPSIDYVVTKIPRFAFEKFPGASPILT-------TAMKSVGEVMAIGRTFAESLQKALRG
CARB_RHIME      EPSIDYVVTKIPRFAFEKFPGAEPTLT-------TAMKSVGEVMAIGRTFAESLQKALRG
CARB_BUCAI      EPSIDYIVTKIPRFNFEKFPGCDDRLT-------TQMKSVGEVMAIGRTFQESIQKAIRG
CARB_XYLFA      EPSIDYVVTKIPRFAFEKFPQADARLT-------TQMKSVGEVMAMGRTFAESLQKAVRG
CARB_HALER      EPSIDYVVTKIPRFTFEKFPQANDRLT-------TQMKSVGEVMAIGRTFQESLQKALRG
CARB_NEIMB      EPSIDYVVTKIPRFAFEKFPAADDRLT-------TQMKSVGEVMAMGRTIQESFQKALRG
CARB_PASMU      EPSIDYVVTKVPRFAFEKFPQADDRLT-------TQMKSVGEVMAMGRTFQESLQKALRG
CARB_RALSO      EPSIDYVVTKVPRFAFEKFPQADSHLT-------TQMKSVGEVMAMGRTFQESFQKALRG
CARB_ECOLI      EPSIDYVVTKIPRFNFEKFAGANDRLT-------TQMKSVGEVMAIGRTQQESLQKALRG
CARB_PSEAE      EPAIDYVVTKIPRFAFEKFPKADARLT-------TQMKSVGEVMAIGRTFQESVQKALRG
CARB_BACHD      EPALDYVVSKIPRWPFDKFEAANRSLG-------TQMKATGEVMAIGRNLEESLLKAVRS
CARB_BACCL      EPALDYVVTKIPRFPFDKFESANRRLG-------TQMKATGEVMAIGRTFEESLLKAVRS
CARB_BACSU      EPALDYVVSKIPRWPFDKFESANRKLG-------TQMKATGEVMAIGRTLEESLLKAVRS
CARB_LISMO      EPTLDYVVAKIPRFAFDKFEQADRRLG-------TQMKATGEVMAIGRSWEEALLKAVRS
CARB_STRPN      EPALDYVVAKIPRFPFDKFEKGERRLG-------TQMKATGEVMAIGRNIEESLLKACRS
CARB_STRP8      EPALDYVVAKIPRFPFDKFEHGERQLG-------TQMKATGEVMAIGRNLEESLLKACRS
CARB_LACPL      EPALDYVVCKIPRWPFDKFTHADRRLG-------TQMKATGEVMAIGRNIEEATLKAVRS
CARB_FUSNN      EPAIDYVVTKIPRFPFDKFGDGDRYLG-------TQMKATGEVMAIGRTLEESLLKAIRS
CARB_STAAW      EPTLDYVISKIPRFPFDKFEKGERELG-------TQMKATGEVMAIGRTYEESLLKAIRS
CARB_LACLM      EPALDYVVAKIARFPFDKFENGDRHLG-------TQMKATGEVMAIGRNIEESLLKAVRS
CARY_BACHD      EPSLDYVVVKFPRWPFDKLVHVNRELG-------TQMKATGEVMAIERNLEAGLQKAVRS
CARY_GEOSE      EPALDYVVVKFPRLPFDKFPHADRKLG-------TQMKATGEVMAIDRNMERAFQKAVQS
CARY_BACSU      EPALDYVIVKFPRWPFDKFKNADRKLG-------TKMKATGEVMAIERNLEAAIQKAAAS
CARY_LACPL      EPALDYVVAKIPRFAFDKFPTADAHLG-------TQMKATGEVMAIGSTLEEATLKAIAS
CARB_CLOAB      EPALDYVVVKIPKWPFDKFNTAERHLG-------TQMKATGEVMAIDRDFESALLKAVTS
CARB_CLOPE      EPSLDYVVVKIPKWPFDKFQGADRVLG-------TKMMATGEIMAIGSNFEAAFLKGIRS
CARB_CALS4      EPALDYVVTKIPRWPFDKFYTTDRRIG-------TQMKATGEVMAIERSFEASLLKAVRS
                ** :**:: * .:  *:*:      :        * * : ** *::      .  *   .

CARB_CAMJE      LERSLS-GFDRVKF--------EDRNDLVFKIRNANEKRLLYVAQAFREGFSVEELYELC
CARB_HELPJ      LENNWL-GFESLS---------KDLEAIKKEIRRPNPKRLLYIADAFRLGVSVDEVFELC
CARB_CORGL      LETKQQ-GFWTKPDEFFAGERATDKAAVLEDLKRPTEGRLYDVELAMRLGASVEELYEAS
CARB_MYCTU      LETTRA-GFWTAPDP------DGGIEEALTRLRTPAEGRLYDIELALRLGATVERVAEAS
CARB_STRCO      LEKKGS-QFTFVGEP-------GDKDELLREAVRPTDGRINAVMQAIRAGATPEEVFDAT
CARB_DEIRA      TEGDIR-GVYAEMD-----------EAGLRALLYPNPRRIEAVIELLRRGESVESLFDAT
CARB_THET2      LERDVR-ALAGVRT-----------EE-LEKKLYPNPDRVYAVMELLRRGMPVEELYQAT
CARB_SYNY3      LETGRF-GFGCDRHE-----TLPTLSHLRSQLRTPNPERVFSLHHAFNLGMTVEEIHELT
CARB_BRUME      LETGLT-GFDEIAIPNI-EE-GDEKNAIRAAIGTPTPDRLRMVAQAMRLGLSVEQVHDAS
CARB_AGRFC      METGLT-GLDEIEIPGY-EEGEGSKNAIRAAIGTPTPDRLRMVAQAMRMGMSEEEVHENS
CARB_RHIME      LETGLT-GLDEIEVPDF-DDNGDGRNAIRAALGTPTPDRLRMVAQALRLGMSEAEVHEAC
CARB_BUCAI      LEVGAS-GFDSK-ISSR-D--SEYLIKIRRELKDAGSERIWYIGDAFRYGMSINDVFDLT
CARB_XYLFA      LETGKV-GLEPTGLDLS-S--EDDLVVLKRELKAPGAERLFYVADAFRAGFAVADVYALS
CARB_HALER      LETGND-GLDPK-VTRF-N--DDGMAHIKGELQVAGAERIFYVADAMRAGLSVEELFRLT
CARB_NEIMB      LETGLC-GFNPR---------SEDKAEIRRELANPGPERMLFVADAFRAGFTLEEIHEIC
CARB_PASMU      LETGIC-GFNLM---------SEEPEKIRQELGNPGPIRILYVADAFGAGFTLDEVHHYS
CARB_RALSO      LEVGVD-GLDEK---------SSDRDEIIAEIGEPGPDRIWYLGDAFRLGLSIDEVYAET
CARB_ECOLI      LEVGAT-GFDPK-VSLD-D--PEALTKIRRELKDAGADRIWYIADAFRAGLSVDGVFNLT
CARB_PSEAE      LEVGAT-GFDPK-LDLN-D--PEADSILKRELTVPSAERVWYVADAFRAGKSVEEVFELT
CARB_BACHD      LEAGVY-HLDQPDVN------DLDKESLEKKLTKPDDERLFALGEAIRRGYTIEELWALT
CARB_BACCL      LEIGVH-HLELNEAK------TAADDVMEKRIRKAGDERLFYIAEALRRGVTVETLHEWS
CARB_BACSU      LEADVY-HLELKDAA------DISDELLEKRIKKAGDERLFYLAEAYRRGYTVEDLHEFS
CARB_LISMO      LEIGAD-HLLLEEAE------NADEATLERKICFPEDDRLFFLAAALRRGQTIEQLHEKT
CARB_STRPN      LEIGVH-HNEIPELA------AVSDDALIEKVVKAQDDRLFYVSEAIRRGYTPEEIAELT
CARB_STRP8      LEIGVC-HNEMTSLS------NISDEELVTKVIKAQDDRLFYLSEAIRRGYSIEELESLT
CARB_LACPL      LEIGVH-HVEEPALR------SVDDDVLSDKLIHAQDDRLFYLTEAIRRGYPIDELAELT
CARB_FUSNN      LEYGVH-HLGLPNGE------EFSLEKIIKRIKLAGDERLFFIGEALRRDVSIEEIHEYT
CARB_STAAW      LEYGVH-HLGLPNGE------SFDLDYIKERISHQDDERLFFIGEAIRRGTTLEEIHNMT
CARB_LACLM      LEIGVF-HNEMTEAI------EADDEKLYEKMVKTQDDRLFYVSEAIRRGIPIEEIADLT
CARY_BACHD      LEIKTH-GLSLPSLS------QWEDSELWVIVKKADDRRFFAILELLRRGVTIEAIHEQT
CARY_GEOSE      LEGKNN-GLLLPELS------VKTNDELKQLLVDKDDRRFFAILELLRRGVAVEAIHKWT
CARY_BACSU      LELKNI-GTHLPELS------GLSIDTLWDLAITPDDRRFFVVMELLSRSVSIDDIHEKT
CARY_LACPL      LEIDPKTQASLTPDH------HVTTTEYIDQLTHPTDQRLFYLLAALQAGWPLAKLATLT
CARB_CLOAB      LEGKIS-GLRLEKFE------YTTVRELLEKIKKQDDERIFAIAEAFRRGVDVKQIHEVT
CARB_CLOPE      LEIGKY-SLEHKKFK------DLSMYELRERVVSPDDERIFALAEMLRRGYRIDMVSKIT
CARB_CALS4      LEIKAY-GLRLDSVR------GMGTKEILEDISVPNDMRLFYIAEALRRNIDIDYINDVT
                 *                                    *.  :      .     :    

CARB_CAMJE      KIDPWFLTQIKEIVDFEEQIDMDI---LNNKALLRKAKTMGFSDKMIALLVNLKDNLELS
CARB_HELPJ      QIDRWFLSQIQKLVKAEEGINSSV---LTDAKKLRGLKNLGFSDARIATKIKENENLEVS
CARB_CORGL      SIDPWFLAELEALVQFRQKLVDAP---FLNEDLLREAKFMGLSDLQIAALRPEF----AG
CARB_MYCTU      GVDPWFIAQINELVNLRNELVAAP---VLNAELLRRAKHSGLSDHQIASLRPEL----AG
CARB_STRCO      KIDPWFVDQLFLIKEIADEIAESR---ELTADLLTEAKRHGFSDQQIAEISG------LG
CARB_DEIRA      KIDRWFLSQLKEIMDAEKEILDLGPIAEWKYELWREVKRLGFSDARIGEIVG------LS
CARB_THET2      RIDPWFLHQMKEIVEAEEWLKTHP---PKDREDWRFYKGLGLTDRRIGELLG------KG
CARB_SYNY3      AIDPWFLDKLEDLVKTEKYMKQRS-LKDLTAADLRYIKQQGFGDRQIAFATK------TT
CARB_BRUME      KIDPWFLEQIESIVKTEERIREHG-LPQ-DAENLRMLKAMGFSDARLASLTA------KD
CARB_AGRFC      KIDPWFIAQLKAIVDMEARIREHG-LPQ-DAENLRMLKAMGFSDARLASLTS------KR
CARB_RHIME      KIDPWFIAQFKAIVDMEARIREHG-LPA-DAENLRMLKAMGFSDARLATLTG------KR
CARB_BUCAI      SIDPWFLVQIKEIILLEKKIIKNG-FIGLKYDFFYFLKRKGFSDQRIAILTN------KN
CARB_XYLFA      YIDPWFLDQIEEIVAAEGRLVTDG-LGSIDGARLRQLKRIGFSDARIAQLTG------TN
CARB_HALER      NIDRWFLVQLEDLVRTEAELAKRS-LSELTPRELFALKRKGFSDARLAGLLG------VA
CARB_NEIMB      AIDPWFLAQIEDLMKEEKAVSDGI-LSDLDFAALRRLKRKGFSDKRLAQLLN------VS
CARB_PASMU      KIDPWFLIQIQDLVLEELALEKRT-LDDLDYAELRRLKRKGFSDKRIAQLTK------SA
CARB_RALSO      AVDPWFLAQIEDIVRTEALVKART-LDSLSAAELRLLKQKGFSDRRLATLMK------TT
CARB_ECOLI      NIDRWFLVQIEELVRLEEKVAEVG-ITGLNADFLRQLKRKGFADARLAKLAG------VR
CARB_PSEAE      RIDEWFLVQIEDLVKDEEKVKTLG-LSSIDRELMYKLKRKGFSDARLAKLLG------VT
CARB_BACHD      KIDRFFLRSFARIIQLETQLKENV----GDLELLKEAKERGFSDMIIADLWG------TS
CARB_BACCL      QIDRFFLHKIQNIIEMETVLKNHP----GDLDVLKKAKGLGFSDAAIAALWN------KT
CARB_BACSU      AIDVFFLHKLFGIVQFEKELKANA----GDTDVLRRAKELGFSDQYISREWK------MK
CARB_LISMO      KIDLFFLYKLSKTIELENRIKENP----QNQEILAEAKQAGFSDAFLATCWN------VD
CARB_STRPN      KIDIFYLDKLLHIFEIEQELGAHP----QDLEVLKTAKLNGFSDRKIAELWG------TT
CARB_STRP8      KIDLFFLDKLLHIVEIEQELQMHV----DHLESLKKAKRYGFSDQKIAEIWQ------KD
CARB_LACPL      KINVFFLDKLLHIIEIEQALRTHT----DDIETLTVAKRNGFADQTVADYWH------ET
CARB_FUSNN      KIDLFFLNKMKNIIDLEHLLKDNK----GNIELLRKVKTFGFSDRVIAHRWE------MT
CARB_STAAW      QIDYFFLHKFQNIIDIEHQLKEHQ----GDLEYLKYAKDYGFSDKTIAHRFN------MT
CARB_LACLM      KIDIFFLDKLLYIVEIENQLKVNI----FEPELLKTAKKNGFSDREIAKLWN------VT
CARY_BACHD      KIDRFFLTSFAKLMTLEKEIAGQS-LDDITSDELSTYKKYGFSDEWLASSWG------VG
CARY_GEOSE      KIDRFFLCSFERLVALEKQAAAAT-LDTIEEQTFRFLKEKGCSDAFLAETWG------VT
CARY_BACSU      KIDPFFLHTFDNIIKLENRLMEAG--SDLSFELLKKAKEKGFSDATIASLIS------KT
CARY_LACPL      QITPFFLSKLQHIAQLIRNIKQVP-----TSQHLLSAKKYGVSLATMAHYAQ--------
CARB_CLOAB      EIDNWYLNGINRIIDMEKELQDKN-NKD-KDKSIIKAKKMGFTVAEIARITS------LE
CARB_CLOPE      GIDIFFLEKFRWLVEEEQKLKQST-IDDLNREWLLKLKRRGFSDKAIADMLK------VS
CARB_CALS4      KIDKWFLNKLSNIVNMEKEIEENE----LSKEILKKAKRMGFSDREIATIKG------IK
                 :  :::  :                           *  *     :.            

CARB_CAMJE      QNDIYYVRMKQKIIAEFSEVDTCAGEFEALTPYLYSSINVSEL--TQSKNDAKDKKEKKV
CARB_HELPJ      PFEVELARSNLQIAPHFEEVDTCAAEFLSLTPYLYSTYAPNPL--PPIGN-KQEKQEKKI
CARB_CORGL      EDGVRTLRLSLGIRPVFKTVDTCAAEFEAKTPYHYSAYELDPAA--ESEVAPQT-EREKV
CARB_MYCTU      EAGVRSLRVRLGIHPVYKTVDTCAAEFEAQTPYHYSSYELDPAA--ETEVAPQT-ERPKV
CARB_STRCO      EDVVRQVRHALGVRPVYKTVDTCAAEFAARTPYFYSSYDE------ESEVAPR--EKPAV
CARB_DEIRA      ELEVRDLRKKAKATPVYKTVDTCAAEFEAHTPYHYSTYEW------EDEVAPT--DKPKV
CARB_THET2      EKEVRAERKALGVVPVYKTVDTCAAEFEAYTPYHYSTYEL------EDEVWPS--QKPKV
CARB_SYNY3      EDEVRAYRKSLGITPVYKVVDTCAAEFEAFTPYYYSTYEPE-----ECEVLPS--DKPKV
CARB_BRUME      AEDVAKLRADLDVHPVYKRIDTCAAEFASPTAYMYSTYETPFVGQPRSEAEVS--DRKKV
CARB_AGRFC      PKEVAELRNSLNVRPVFKRIDTCAAEFASPTAYMYSTYETPFVGAARSEAQVS--DRKKV
CARB_RHIME      PKEVAELRNALNVRPVYKRIDTCAAEFASPTAYMYSTYETPFVGAARSEAQVS--DRKKV
CARB_BUCAI      ESEIRQLRYKLNLHPVYKRIDTCSAEFSTETAYMYSTWEDE------CESHPS-KNNKKI
CARB_XYLFA      EVAVRALRRVLKVKPVYKRVDSCAGEFATGTAYLYSTYEEE------CEAAPS--DRRKI
CARB_HALER      EKDFRRTRQAAGIRPVYKRVDTCAAEFATDTAYMYSSYEEE------CEAEVS--DRPKI
CARB_NEIMB      EKEVREHRYALKLHPVYKRVDTCAAEFATETAYLYSTYEEE------CESRPS--DRKKV
CARB_PASMU      ESAVRNKRVSLNLHPVYKRVDTCAGEFTSDTAYLYSTYEEE------CESRPS--DKKKI
CARB_RALSO      AQAVREKRIAEKVRPVYKRVDTCAAEFATNTAYLYSTYEAEH---GECEADPT--ERKKI
CARB_ECOLI      EAEIRKLRDQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEE------CEANPST-DREKI
CARB_PSEAE      EKNLRSHRHKLKVLPVYKRVDTCAAEFATDTAYMYSTYEEE------CEANPS--SREKI
CARB_BACHD      EQEVYELRMNHGLSPVYKMVDTCAAEFASATPYFYGTYEE------ENESERT--DKKSI
CARB_BACCL      ERDIYAVRRQRGIMPVYKMVDTCAAEFTSETPYYYSTYEE------ENESIVT--EKPSV
CARB_BACSU      ESELYSLRKQAGIAPVFKMVDTCAAEFESETPYFYSTYEE------ENESVVT--DKKSV
CARB_LISMO      EQAIYDLRKAQNLFPVYKMVDTCAAEFESTTPYFYSTYEE------ENESTRS--AKESV
CARB_STRPN      DDKVRQLRLENKIVPVYKMVDTCAAEFDSETPYFYSTYGW------ENESIRS--DKESV
CARB_STRP8      ESDIRAMRHSHSLCPVYKMVDTCAAEFDAKTPYFYSTYEL------ENESVQS--NKESI
CARB_LACPL      IDQVRDFRLAHKLAPVYKMVDTCAGEFASETPYYYGTYEF------ENESIVT--KRPSV
CARB_FUSNN      EPEITELRHKHNIRPVYKMVDTCAAEFDSNTPYFYSTYEF------ENESTRS--DKEKI
CARB_STAAW      EEEVYQLRMENDIKPVYKMVDTCAAEFESSTPYYYGTYET------ENESIVT--DKEKI
CARB_LACLM      PEEVRRRRQENKIIPVYKMVDTCAAEFESSTPYFYSTYEW------ENESKRS--DKEKI
CARY_BACHD      LADVRHTRKALGVVPSYKMVDTCAAEFEAKTPYYYSSWTG------ENDLLLPEKAKERV
CARY_GEOSE      ELDVRNKRKELGIVPSYKMVDTCAAEFHSETDYYYSTYFG------EDERKQPS-GKEKV
CARY_BACSU      EEEVRALRKEMGITPSFKIVDTCAAEFDAKTNYFYSTYFG------ETDGDISRKEKKRA
CARY_LACPL      TSVATIAAMTADLPFVYKMVDTCAGEFASVTPYFYSTAFG--------QTNESHPLGHSI
CARB_CLOAB      EGKIKNILNVNNVKPVFKMVDTCSGEFEAETPYYYSSYEN------EDENEVT--DDKKI
CARB_CLOPE      PDEIYRLRDIWHIKPSYKMVDTCGGEFEALSPYYYSTYEQ------YDEVVVS--DNKKV
CARB_CALS4      EEDVRTLRKKYGIYPSYKMVDTCAAEFESITQYIYSTYCE------EDEVETH--DIPKV
                                :. :*:*..** : : * *.:                       

CARB_CAMJE      MIIGGGPNRIGQGIEFDYACVHASFALKDMGIKTIMYNCNPETVSTDYDTSDILYFEPID
CARB_HELPJ      LIIGSGPNRIGQGIEFDYCCVHASFALKDLNIKSVMLNCNPETVSTDYDTSDTLYFEPIH
CARB_CORGL      LILGSGPNRIGQGIEFDYSCVHAALELSRVGYETVMVNCNPETVSTDYDTADRLYFEPLT
CARB_MYCTU      LILGSGPNRIGQGIEFDYSCVHAATTLSQAGFETVMVNCNPETVSTDYDTADRLYFEPLT
CARB_STRCO      IILGSGPNRIGQGIEFDYSCVHASFALSDAGYETVMVNCNPETVSTDYDTSDRLYFEPLT
CARB_DEIRA      VILGSGPNRIGQGVEFDYATVHAVWALQEAGYETIMVNSNPETVSTDYDTADRLYFEPLT
CARB_THET2      VILGSGPIRIGQGVEFDYATVHAVWALKEAGFETIMVNSNPETVSTDYDTADRLYFEPLT
CARB_SYNY3      MILGGGPNRIGQGIEFDYCCCHAAFSLSDAGYETIMVNSNPETVSTDYDTSDRLYFEPLT
CARB_BRUME      VILGGGPNRIGQGIEFDYCCCHAAFALGDADYEAIMVNCNPETVSTDYDTSDRLYFEPLT
CARB_AGRFC      VILGGGPNRIGQGIEFDYCCCHAAFALKDAGFEAIMINCNPETVSTDYDTSDRLYFEPLT
CARB_RHIME      VILGGGPNRIGQGIEFDYCCCHAAFALKDAGYEAIMINCNPETVSTDYDTSDRLYFEPLT
CARB_BUCAI      IILGGGPNRIGQGIEFDYCCVHAAQALREDGFEAIMVNCNPETVSTDYDISDRLYFEPIT
CARB_XYLFA      MILGGGPNRIGQGIEFDYCCVHAALALREDGFETIMVNCNPETVSTDYDTSDRLYFEPLT
CARB_HALER      MVLGGGPNRIGQGIEFDYCCVHAALAMRDDGYETIMVNCNPETVSTDYDTSDRLYFEPVT
CARB_NEIMB      MILGGGPNRIGQGIEFDYCCVHAALALRESGFETIMVNCNPETVSTDFDTSDRLYFEPLT
CARB_PASMU      MILGGGPNRIGQGIEFDYCCVHASLALREAGFETIMVNCNPETVSTDFDTSDRLYFEPLT
CARB_RALSO      MVLGGGPNRIGQGIEFDYCCVHAALALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVT
CARB_ECOLI      MVLGGGPNRIGQGIEFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVT
CARB_PSEAE      MILGGGPNRIGQGIEFDYCCVHAALAMREDGYETIMVNCNPETVSTDYDTSDRLYFEPVT
CARB_BACHD      LVLGSGPIRIGQGIEFDYATVHTVWAIKEAGYEAIIVNNNPETVSTDFSTSDKLYFEPLT
CARB_BACCL      IVLGSGPIRIGQGIEFDYATVHCVWAIKQAGYEAIIINNNPETVSTDFSTSDKLYFEPLT
CARB_BACSU      MVLGSGPIRIGQGVEFDYATVHSVWAIKQAGYEAIIVNNNPETVSTDFSISDKLYFEPLT
CARB_LISMO      IVLGSGPIRIGQGVEFDYATVHSVWAIQQAGYEAIIINNNPETVSTDFSISDKLYFEPLT
CARB_STRPN      LVLGSGPIRIGQGVEFDYATVHSVKAIQAAGYEAIIMNSNPETVSTDFSVSDKLYFEPLT
CARB_STRP8      LVLGSGPIRIGQGVEFDYATVHSVKAIQKAGYEAIIMNSNPETVSTDFSVSDKLYFEPLT
CARB_LACPL      LVLGSGPIRIGQGVEFDYATVHSVKAIQKAGYEAIIMNSNPETVSTDFSVSDKLYFEPLT
CARB_FUSNN      VVLGSGPIRIGQGIEFDYATVHAIMAIKKLGYEAIVINNNPETVSTDFSISDKLYFEPLT
CARB_STAAW      LVLGSGPIRIGQGVEFDYATVHAVWAIQKAGYEAIIVNNNPETVSTDFSISDKLYFEPLT
CARB_LACLM      IVLGSGPIRIGQGVEFDYATVHCVKAIQALGKEAIVINSNPETVSTDFSISDKLYFEPLT
CARY_BACHD      LIIGSGPIRIGQGIEFDYCSVHGAKSLRARNFEAIIINNNPETVSTDYETADRLYFEPLA
CARY_GEOSE      LIIGAGPIRIGQGIEFDYSSVHSVFALQKEGYETVMINNNPETVSTDFAVADRLYFEPLT
CARY_BACSU      LIIGSGPIRIGQGVEFDYSAVHGVLTLQELGFETIMINNNPETVSTDYEIADRLYFEPMT
CARY_LACPL      LVLGSGPIRIGQGIEFDYTTVHCVKAIQQAGYHAIIVNNNPETVSTDFSTSDKLYFEPLT
CARB_CLOAB      VVIGSGPIRIGQGIEFDYCCVHGVWAIKEAGYKSIIINNNPETVSTDFDTADKLYFESLY
CARB_CLOPE      VVIGSGPIRIGQGIEFDYASVHCVMALRKQGIETIVINNNPETVSTDFSISDKLYFEPLT
CARB_CALS4      IVIGSGPIRIGQGIEFDYCSVKALWALKETGIKSIIINNNPETVSTDFDTGDRLYFEPIT
                :::*.** *****:****   :    :   . .::: * ********:  .* ****.: 

CARB_CAMJE      FEHLRAVIEREKP--------DGVIVHFGGQTPLKFAKRLSAF--------GAKIIGTSA
CARB_HELPJ      FECVKSIIQRERV--------DGIIVHFGGQTPLKLAKDLAKM--------QAPIIGTPF
CARB_CORGL      FEDVMEVYHAEAQSGT----VAGVIVQLGGQTPLGLADRLKKA--------GVPVIGTSP
CARB_MYCTU      FEDVLEVYHAEMESGSGGPGVAGVIVQLGGQTPLGLAHRLADA--------GVPIVGTPP
CARB_STRCO      LEDVLEIVHAEQQAG---P-VAGVIVQLGGQTPLGLSQALKDN--------GVPVVGTSP
CARB_DEIRA      FEDVMNIVEHEKP--------VGVIVQLGGQTPLKLAKKLADA--------GAPIIGTSP
CARB_THET2      LEDVLNIVEHEKP--------IGVIATLGGQTPLKLAKGLEEA--------GVRLLGTPF
CARB_SYNY3      KEDVLNIIEAENPV--------GIIIQFGGQTPLKLAVPLQKYLNSPDCPVQTKIWGTSP
CARB_BRUME      AEDVLEILRVEKQKGT----LHGVIVQFGGQTPLKLANALEKA--------GIPILGTSP
CARB_AGRFC      AEDVIEIMRAEQEKGE----LVGVIVQFGGQTPLKLAEALEKN--------GIPILGTAP
CARB_RHIME      AEDVIEIMRAEQENGT----LHGVIVQFGGQTPLKLAEALEKN--------GIPILGTAP
CARB_BUCAI      LENVLEIVRIEKPK--------GVIIQYGGQTPLKLAHEFEKE--------GVPIIGTSP
CARB_XYLFA      LEDVLEIVEVEHPV--------GVIVQYGGQTPLKLAKALEAN--------GVPVIGTSP
CARB_HALER      LEDVLEIADKEKPA--------GVIVQFGGQTPLKLARELEAA--------GVPIIGTTP
CARB_NEIMB      LEDVLEIVRTENPW--------GVIVHYGGQTPLKLANALVEN--------GVNIIGTSA
CARB_PASMU      LEDVLEIIHVEKPH--------GVIVHYGGQTPLKLANDLHAN--------GVNIIGTSA
CARB_RALSO      LEDVLEIVDKEKPV--------GVIVQYGGQTPLKLALDLEAN--------GVPIIGTTP
CARB_ECOLI      LEDVLEIVRIEKPK--------GVIVQYGGQTPLKLARALEAA--------GVPVIGTSP
CARB_PSEAE      LEDVLEIVRVEQPK--------GVIVQYGGQTPLKLCRALEEA--------GVPIIGTSP
CARB_BACHD      VEDVMHIVNLEQPE--------GVIVQFGGQTAINLASELAAR--------GVKIIGTAL
CARB_BACCL      AEDVMHVIDLEQPI--------GVIVQFGGQTAINLAAELEAR--------GVRLLGTTL
CARB_BACSU      IEDVMHIIDLEQPM--------GVVVQFGGQTAINLADELSAR--------GVKILGTSL
CARB_LISMO      LEDVMHVIEIEQPL--------GVVVQFGGQTAINLADGLAKR--------GVKILGTSL
CARB_STRPN      FEDVMNVIDLEQPK--------GVIVQFGGQTAINLAEPLAKA--------GVTILGTQV
CARB_STRP8      FEDVMNVIDLEQPK--------GVIVQFGGQTAINLAQSLSDA--------GVTILGTQV
CARB_LACPL      IEDVLNVIELEKPV--------GVIVQFGGQTAINLAKPLADH--------GIKILGTSV
CARB_FUSNN      QEDVMEILDLEKPL--------GVVVQFGGQTAINLADKLVKN--------GIQILGSSL
CARB_STAAW      EEDVMNIINLEKPK--------GVVVQFGGQTAINLADKLAKH--------GVKILGTSL
CARB_LACLM      FEDVMNVIDLEEPL--------GVIVQFGGQTAINLAEPLSKA--------GVKILGTQV
CARY_BACHD      VEDVLNVIEVENVD--------HVIVQLGGQTAIGLTKGLEEA--------GVSILGTTQ
CARY_GEOSE      LESVLDVIEAEQIK--------HVIVQFGGQTAINLVKGLEEA--------GVPLLGVTY
CARY_BACSU      TEHIVNVAEQENID--------FAIVQFGGQTAINAAEALEKA--------GITLLGTSF
CARY_LACPL      IERLMPIIALEQPA--------GVIVQFGGQTAINLAHQLTKL--------GVTVLGTSV
CARB_CLOAB      IDNVMNIIEKEKPE--------GVIVQFGGQTAINLADKLYKN--------GVKILGTSF
CARB_CLOPE      EEDVLNIIDKEKPD--------GVILQFGGQTAIKLAKFLKEK--------NIPTLGTTS
CARB_CALS4      LEDVLNIYEKEKPL--------GVMVMFGGQTAINLTEELVKN--------EVKILGTSF
                 : :  :   *             :   ****.:     :                *   

CARB_CAMJE      RVIDMAEDRKKFAEFITKLGINQPKNSTATSVEEAVLKASDIGYPVLVRPSYVLGGRAMR
CARB_HELPJ      KVIDIAEDREKFSLFLKELDIKQPENGMAKSVDEAYSIANAIGFPIIVRPSYVLGGQHMQ
CARB_CORGL      EAIDMAEDRGEFGALLNREQLPAPAFGTATSFEEARTVADEISYPVLVRPSYVLGGRGME
CARB_MYCTU      EAIDLAEDRGAFGDLLSAAGLPAPKYGTATTFAQARRIAEEIGYPVLVRPSYVLGGRGME
CARB_STRCO      EAIHAAEDRGAFGRVLAEAGLPAPKHGTATTFGEAKAIADEIGYPVLVRPSYVLGGRGME
CARB_DEIRA      ETIHEAEDRASFNALCERLGLPQPRGKVAQTPAQARELAAELGFPLMARPSYVLGGRAMR
CARB_THET2      SAIHQAEDREAFHALCQRLGIPQPEGRVAQSPEEALRLAPEVGFPLLVRPSYVLGGRAMQ
CARB_SYNY3      DSIDTAEDRERFEKILHELEISQPPNGIARDYEESRVVANRISYPVVVRPSYVLGGRAME
CARB_BRUME      DAIDLAEDRDRFQKLLIKLDLNQPKNGIAYSVEQARLVAADLGFPLVVRPSYVLGGRAMQ
CARB_AGRFC      DMIDLAEDRDRFQKLLMKLDLAQPNNGIAYSVEQARLVASEIGFPLVVRPSYVLGGRAMQ
CARB_RHIME      DAIDLAEDRDRFQKLLMKLDLNQPNNGIAYSVEQARLVAGEIGFPLVVRPSYVLGGRAMQ
CARB_BUCAI      DSIDTAENRYRFQKTVNKLRLQQPLNATVLTLDEAYKKADIIGYPIMVRPSYVLGGRAME
CARB_XYLFA      ESIDLAEDRERFQKLVQQLGLRQPPNCTARTAEEALVLAREIGYPLVVRPSYVLGGRAME
CARB_HALER      DAIDRAEDRERFQHMVDKLGLKQPANATARSXEEAFAKAEAIGYPXVVRPSYVLGGXAME
CARB_NEIMB      DSIDAAEDRERFQKVLNDLGLRQPPNRIAHNEEEALVKAEEIGYPLVVRPSYVLGGRAMQ
CARB_PASMU      DSIDAAEDRERFQQILHKLHLKQPTNRTARNAEEAVKLAEEVGYPLVVRPSYVLGGRAMQ
CARB_RALSO      DMIDAAEDRERFQKLLHDLGLRQPPNRTARAEDEALKLADEIGYPLVVRPSYVLGGRAME
CARB_ECOLI      DAIDRAEDRERFQHAVERLKLKQPANATVTAIEMAVEKAKEIGYPLVVRPSYVLGGRAME
CARB_PSEAE      DAIDRAEDRERFQQMVQRLNLRQPANATARSEDEALAASKAIGYPLVVRPSYVLGGRAME
CARB_BACHD      EDMDRAEDRDKFEQTLVELNIPQPLGDTATSIEEARQIAERIGYPVLVRPSYVLGGRAME
CARB_BACCL      EDLDRAEDRDKFEQALSELGIPKPAGKTAVSVEEAVAIAEEIGYPVLVRPSYVLGGRAME
CARB_BACSU      EDLDRAEDRDKFEQALGELGVPQPLGKTATSVNQAVSIASDIGYPVLVRPSYVLGGRAME
CARB_LISMO      EDTDRAENRDAFEKALEILQIPQPAGKTATSVEEAITVATDIGYPVLVRPSYVLGGRAME
CARB_STRPN      ADLDRAEDRDLFEQALKELDIPQPPGQTATNEEEAALAARKIGFPVLVRPSYVLGGRAME
CARB_STRP8      EDLDRAEDRDLFEKALKELGIPQPQGQTATNEEEALEAAKKIGFPVLVRPSYVLGGRAME
CARB_LACPL      ADVNRAEDRDEFDKVIKALAIPQPAGDTASDEATALAIADKLGYPVLVRPSYVLGGRAME
CARB_FUSNN      DSIDTAEDRDRFEKLLIGLKIPQPLGKTAFDVETALKNANEIGYPVLVRPSYVLGGRAME
CARB_STAAW      ENLNRAEDRKEFEALLRKINVPQPQGKTATSPEEALANAAEIGYPVVVRPSYVLGGRAME
CARB_LACLM      EDLDRAEDRDLFEKALQDLDIPQPPGATATNEEEAVANANKIGYPVLIRPSFVLGGRAME
CARY_BACHD      DVIDQLEDRERFYEFMRSVEVPHIPGKTAETKEELLKAAQSIGYPILLRPSYVIGGQGMF
CARY_GEOSE      DMIDQLEDRDRFYQLLEELDIPHVPGLVANNAEELAAKAAEIGYPVLLRPSYVIGGCGMF
CARY_BACSU      QTLDVLEDRDQFYQLLDELGLKHAKGEIAYTKEEAASKASEIGYPVLIRPSYVIGGMGMI
CARY_LACPL      SATDLTEDRQSFADCLRLLKIAQAAGTTVTELSGARQAAHAIGYPLLVRPSFVLGGRAMA
CARB_CLOAB      ESIDLAEDREKFSELLKELNIPQAKGMAVTSMEEAYEAVKEIGYPVIVRPSYVIGGRAMQ
CARB_CLOPE      DQIDLAEDREQFDDLLERLNIARPKGKGVWSLEEGLEEARRLGFPILVRPSFVLGGQGME
CARB_CALS4      KSIDISEDREKFSKLLKELNINQPKGGYALTVEDAKDIALKLGFPLLVRPSYVIGGQSME
                   .  *:*  *        :       .            :.:* : ***:*:**  * 

CARB_CAMJE      VVNDEAELRLYMQ-----EAV---------------------DVSDKSP-VLIDQFLDNA
CARB_HELPJ      ILENIEELRHYLE--SVTHSL---------------------EISPKNP-LLIDKFLEKA
CARB_CORGL      IVYDEASLEDYIN-----RAT---------------------ELSSDHP-VLVDRFLDNA
CARB_MYCTU      IVYDEETLQGYIT-----RAT---------------------QLSPEHP-VLVDRFLEDA
CARB_STRCO      IVYDETRLEAYIA-----EST---------------------EISPSRP-VLVDRFLDDA
CARB_DEIRA      TVRSMDELTTYLD-----EVY---------------------AAVEGQPSILLDQFLEGA
CARB_THET2      VVRDEGELKRYLE-----EVY---------------------APLEERPSILLDRFLEGA
CARB_SYNY3      IVYSDEELERYMT-----YAV---------------------QIEPDHP-ILIDKFLENA
CARB_BRUME      IIHDERGLQAYLL-----DTVPELVPEDIKAKYPNDKTGQINTLLGKNP-LLFDTYLTEA
CARB_AGRFC      IIHSEGQLQTYLL-----DTVPGLVPEDIKQRYPNDKTGQINTLLGKNP-LLFDSYLTNA
CARB_RHIME      IIHSESMLQSYLL-----DTVPGLVPEDIKQRYPNDKTGQINTLLGKNP-LLFDSYLTNA
CARB_BUCAI      IVYEPYGLENYFK-----TTL---------------------KKNNTTP-ILLDQYLDYA
CARB_XYLFA      IVYGEADLARYVR-----DAV---------------------KVSNDSP-VLLDRFLDNA
CARB_HALER      IVYDASELENYMT-----HAV---------------------KVSNDSP-VLLDHFLNCA
CARB_NEIMB      VVHSAEELQKYMR-----EAV---------------------QVSEDSP-VLLDFFLNNA
CARB_PASMU      IVYNVDELQRYMR-----EAV---------------------SVSNDSP-ILLDHFLNNA
CARB_RALSO      IVHEPRDLERYMR-----EAV---------------------KVSNDSP-VLLDRFLNDA
CARB_ECOLI      IVYDEADLRRYFQ-----TAV---------------------SVSNDAP-VLLDHFLDDA
CARB_PSEAE      IVYQEEELKRYMR-----EAV---------------------QVSNDSP-VLLDHFLNCA
CARB_BACHD      IVYKEEELLNYMA-----HAV---------------------KVNPKHP-VLIDRYLTG-
CARB_BACCL      IVYNRGELLHYME-----HAV---------------------RVNPQHP-VLVDRYITG-
CARB_BACSU      IVYHEEELLHYMK-----NAV---------------------KINPQHP-VLIDRYLTG-
CARB_LISMO      IVESEEALKHYMT-----NAV---------------------KVNPKHP-VLVDRYVSG-
CARB_STRPN      IVENEEDLRSYMR-----TAV---------------------KASPDHP-VLVDSYIVG-
CARB_STRP8      IVENKEDLREYIR-----TAV---------------------KASPEHP-ILVDSYIFG-
CARB_LACPL      IVKKRTDLDYYMH-----NAV---------------------KVSHDHP-VLVDSYLVG-
CARB_FUSNN      IVYNDEDLTKYME-----KAV---------------------HINPDHP-VLIDRYLIG-
CARB_STAAW      IVDNDKELENYMT-----QAV---------------------KASPEHP-VLVDRYLTG-
CARB_LACLM      IINNEKDLRDYMN-----RAV---------------------KASPEHP-VLVDSYLQG-
CARY_BACHD      IASNQEELAAFCE-----DK----------------------NHSVTFP-ILVDAYYPG-
CARY_GEOSE      IVHSEAQLAALIE-----QG------------------------ELTYP-ILIDAYLDG-
CARY_BACSU      IVDSQAQLSQLLN-----DE-----------------------DSMPYP-ILIDQYVSG-
CARY_LACPL      IVHNDHELTPVIKSA--V------------------------AAGHGAP-ILMDQYLAG-
CARB_CLOAB      VVYDKLALQKYMT-----EAV---------------------TLSTEHP-VLIDKYIKG-
CARB_CLOPE      ITHDEEELTYYLT-----NAF---------------------EKDSKNP-ILIDKYLMG-
CARB_CALS4      KVNTLQELIDYVK-----HAT---------------------EVSPGKP-VLIDKYIDG-
                       *                                        * :*.* :    

CARB_CAMJE      TEIDVDAICDGK-DVYVAGIMEHIEEAGIHSGDSACSLPPCNIDEKMQEFIAQKTADIAL
CARB_HELPJ      VELDVDAICDKK-EVYIAGILQHIEEAGIHSGDSACFIPS-TLSPEILDEIERVSAKIAL
CARB_CORGL      IEIDVDALCDGD-EVYLAGVMEHIEEAGIHSGDSACALPPMTLGAQDIEKVREATKKLAL
CARB_MYCTU      VEIDVDALCDGA-EVYIGGIMEHIEEAGIHSGDSACALPPVTLGRSDIAKVRKATEAIAH
CARB_STRCO      IEIDVDALYDGE-ELYLGGVMEHIEEAGIHSGDSACALPPITLGGFDIKRLRASTEGIAK
CARB_DEIRA      LELDVDTLCDGE-RAVVAGIMEHVEAAGVHSGDSACILPPVTLDAGVLERVKADTERLAL
CARB_THET2      IELDVDALSDGQ-EVMVAGIMEHVERAGVHSGDSATLLPPVHVPEEALKKVRDYTRRLAL
CARB_SYNY3      IEVDVDSLTDSTGKVVIGSIMEHIEEAGIHSGDSACSIPYTSLSDNVLTTIRQWTEQLAR
CARB_BRUME      IEVDVDCLCDGK-DSLVAGIMEHIEEAGIHSGDSACLLPVHTLSPEIVAELERQTAALAT
CARB_AGRFC      VEVDVDALCDGE-NVFVSGIMEHIEEAGIHSGDSACSLPSRSLSKETLDELERQTTALAK
CARB_RHIME      IEVDVDCLCDGK-DVFVSGIMEHIEEAGIHSGDSACSLPVHSLGTDMVDELERQTGALAR
CARB_BUCAI      TEVDVDAICDGE-TVLIGGIMEHIEQAGVHSGDSACSLPAYTLTSKVQNEIRRQVKKLAF
CARB_XYLFA      VEVDVDIIADREGQVLIGGVMEHIEEAGVHSGDSSCSLPPYSLSAATQDDLRRQVIRLAQ
CARB_HALER      IEVDIDAVSDGH-QVVIGGIMQHIEQAGVHSGDSACALPPYSLPAEVQDEMRDQVKRMAV
CARB_NEIMB      IEVDVDCVSDGK-DVVIGGIMQHVEQAGIHSGDSGCSLPPYSLSEEIQDEIRRQTKAMAY
CARB_PASMU      IEVDVDCICDGA-EVVIGGIMQHIEQAGIHSGDSACSLPPYSLSQEVQDEIRRQTAEMAF
CARB_RALSO      IECDVDCLSDGK-RVFIGGVMEHIEQAGVHSGDSACSLPPYSLSQATVDELKRQTAAMAR
CARB_ECOLI      VEVDVDAICDGE-MVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQVQKLAF
CARB_PSEAE      IEVDIDAVCDGE-IVVIGAIMQHIEQAGVHSGDSACSLPPYSLPQHIQDEIREQVKKMAL
CARB_BACHD      KELEVDAISDGE-NVYIPGIMEHIERAGVHSGDSIAVYPPQTVPESLKQKLIERTIELAR
CARB_BACCL      KEVEVDAIADGE-TVVIPGIMEHIERAGVHSGDSIAVYPPQTLSAEVIDKIADYTIRLAR
CARB_BACSU      KEIEVDAVSDGE-TVVIPGIMEHIERAGVHSGDSIAVYPPQSLTEDIKKKIEQYTIALAK
CARB_LISMO      QEVEVDAISDGV-NVLIPGIMEHIERAGVHSGDSIAVYPAQRLSIQVKNTIVDYTTRLAT
CARB_STRPN      QECEVDAISDGK-NVLIPGIMEHIERAGVHSGDSMAVYPPQTLSQKVQETIADYTKRLAI
CARB_STRP8      KECEVDAISDGK-SVLIPGIMEHIERAGVHSGDSMAVYPPQQLSKQIQETIAEYTKRLAI
CARB_LACPL      KECEVDAICDGQ-TVLIPGIMEHIERAGVHSGDSMAVYPPQSLSAAVQAQIVDYTEKLAI
CARB_FUSNN      KEIEVDAISDGE-NTFIPGIMEHIERAGVHSGDSISIYPPQSLSEKEIETLIDYTKKLAS
CARB_STAAW      KEIEVDAICDGE-TVIIPGIMEHIERAGVHSGDSIAVYPPQTLTEDELATLEDYTIKLAK
CARB_LACLM      QECEVDAICDGK-EVLLPGIMEHIERAGVHSGDSMAVYPPQNLSQAIIDTIVDYTKRLAI
CARY_BACHD      VEFEVDVLTDGS-DIFIPGMFEHVEKAGVHSGDSMAVTPPPTLEAKWKQQAINYTRQIAK
CARY_GEOSE      KEAEADIVTDGT-DIVLPVIIEHVEKAGVHSGDSYAWLPAQTLTGEEKAKIIDYAGRIAK
CARY_BACSU      KEVEIDLISDGE-EVFIPTYTEHIERAGVHSGDSFAILPGPSITSGLQQGMKDAAQKIAR
CARY_LACPL      TECEVDVLSDGT-SCFIPGIMEHIEGAGVHSGDSITVYPPQHLSPAVQDKIVTIATKLAQ
CARB_CLOAB      TEIEVDTISDGE-NILIPGIMEHIERTGVHSGDSITMYPYHTLPKEVVDKLVKYTKSLAK
CARB_CLOPE      REIEVDAISDGE-DVLVPGIMEHLERAGVHSGDSITMYPAQNISDKIKEDVLDYTKKLAL
CARB_CALS4      REVEVDAVSDGE-CVLIPGIMEHIERTGVHSGDSFSIYPARNLTEREINTIIEYTEKISK
                 * : * : *      :    :*:* :*:*****    *   :              :: 

CARB_CAMJE      NLGVVGLLNIQFALH-----NNELYMIEVNPRASRTIPFVSKATGIPLAKVATRVMWQGN
CARB_HELPJ      HLGVVGLLNIQFAVY-----QNSLYLIEVNPRASRTVPFLSKALGVPLAKVATRVMVLED
CARB_CORGL      GIGVQGLMNVQYALK-----DDILYVIEANPRASRTVPFVSKATGVNLAKAASRIAVGAT
CARB_MYCTU      GIGVVGLLNVQYALK-----DDVLYVLEANPRASRTVPFVSKATAVPLAKACARIMLGAT
CARB_STRCO      GVGVRGLINIQFALA-----GDILYVLEANPRASRTVPFTSKATAVPLAKAAARISLGAT
CARB_DEIRA      ELGVRGLMNVQWAVK-----DGTAYILEANPRASRTVPFVSKAVNHPLAKSAARIAAGQT
CARB_THET2      TLGVRGLLNVQYAVV-----GEEVYVLEANPRASRTVPFVSKAIGVPLAKLAALIAVGKT
CARB_SYNY3      ALNVVGLMNIQYAVQ-----GDQVYILEANPRASRTVPYVSKATGRPLAKIASLVMSGKT
CARB_BRUME      ALHVGGLMNVQFAIK-----DGEIFILEVNPRASRTVPFVAKTVGTPIAKVAARIMAGES
CARB_AGRFC      ALKVGGLMNVQYAIK-----DGTIYVLEVNPRASRTVPFVAKTIGAPIAKIAARVMAGEK
CARB_RHIME      ALNVGGLMNVQFAIK-----DGTIYVLEVNPRASRTVPFVAKTIGAPIAKIAARVMAGEM
CARB_BUCAI      ELSVKGLMNIQFAIK-----NNKIYIIEVNPRAARTVPFVSKAIGLALAKISVRVMCGKT
CARB_XYLFA      ALNVIGLMNTQFAIQSNDDGSDIVYLLEVNPRASRTVPFVSKATGVPLAKIAARCMTGKT
CARB_HALER      ELGVKGLMNVQLAWQ-----DGEIYVIEVNPRASRTVPFVSKCVGTSLAQVAARCMAGIS
CARB_NEIMB      ALGVVGLMNVQFAVQ-----DGVVFVLEVNPRASRTVPFVSKATGVPLAKVGARCMAGIS
CARB_PASMU      ALGVKGLMNVQFAVQ-----DGVIYVLEVNPRASRTVPFVSKATGRPLAKIAARVMAGES
CARB_RALSO      ALNVIGLMNVQFAIQQKG-GEDIVYVLEVNPRASRTVPYVSKATGISLAKVAARCMAGQS
CARB_ECOLI      ELQVRGLMNVQFAVK-----NNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAGKS
CARB_PSEAE      ELGVVGLMNVQMAVQ-----GEDIFVIEVNPRASRTVPFVSKCVGESLAKVAARVMAGKT
CARB_BACHD      GLRIVGLLNIQFVWH-----KDDVYVLEVNPRSSRTVPFLSKVTGVPMANVATKVMLGKT
CARB_BACCL      GLHIVGLLNIQFVVS-----GSDVYVLEVNPRSSRTVPFLSKITGVPMANLATKAILGTK
CARB_BACSU      GLNIVGLLNIQFVLS-----QGEVYVLEVNPRSSRTVPFLSKITGIPMANLATKIILGQK
CARB_LISMO      GLNIIGMLNIQYVVD-----GEEVFVIEVNPRSSRTAPFLSKITEIPMANVATRVILGEN
CARB_STRPN      GLHCLGMMNIQFVIK-----DEKVYVIEVNPRASRTVPFLSKVTNIPMAQVATKLILGQS
CARB_STRP8      GLNCIGMMNVQFVIK-----NEQVYVIEVNPRASRTVPFLSKVTGIPMAQIATKLILGQT
CARB_LACPL      ALNCVGMMNIQFVIH-----DDQVYVIEVNPRASRTVPFLSKVTNIPMAQVATRAILDQS
CARB_FUSNN      GLEVKGLINIQYVVS-----KGEIYVLEVNPRASRTVPFLSKVTGVPVANIAMQCILGKK
CARB_STAAW      GINIIGLINIQFVIA-----HDGVYVLEVNPRSSRTVPFLSKITDIPMAQLAMRAIIGEK
CARB_LACLM      GLNCIGMMNIQFVIY-----EEQVYVIEVNPRASRTVPFLSKVTNIPMAQLATQMILGEN
CARY_BACHD      GMAYKGLFNIQFVLY-----DEELYVIEVNPRASRTVPIFSKATSLPLITYTIDVLFGKT
CARY_GEOSE      KLGFKGIMNIQYVIA-----DGNVYVLEVNPRASRTVPIVSKTTGVPLAQIATKLLLGKS
CARY_BACSU      KLSFKGIMNIQFVID-----NGNILVLEVNPRASRTVPVVSKVMGVPMIPLATRLLAGAS
CARY_LACPL      HLHCVGMMNIQFVVT------DDVYVIDVNPRASRTVPYMSKVTHLPLAQLATRLILGQS
CARB_CLOAB      ALEVKGLMNIQYVYD-----GENVYVIEVNPRASRTVPILSKVTGVPMVKLAVEILTGKN
CARB_CLOPE      SIGIKGMINIQFIEF-----EGKLYVIEVNPRASRTVPYISKVSGVPIVDIATRIMLGEK
CARB_CALS4      ALNVKGLINIQFAVK-----EGTVYVLEVNPRASRTVPIMSKATGVPMVKLAVEVALGKK
                 :   *::* *              :::.***::** *  :*     :            

CARB_CAMJE      LKEALKFYDTFKVVNFDTKI-L-RPKTPKYMSVKEAVFPFAKLS-----GSDLELGPEMR
CARB_HELPJ      LKEALKFYDKKNIVEYSKGV-Y-KPKMPHFVALKEAVFPFNKLY-----GSDLILGPEMK
CARB_CORGL      IKDLQD-EGMIP-TEYDGGS----LPLDAPIAVKEAVLPFNRFRRPDGKTLDTLLSPEMK
CARB_MYCTU      IAQLRA-EGLLA-VTGDGAH----AARNAPIAVKEAVLPFHRFRRADGAAIDSLLGPEMK
CARB_STRCO      IAELRA-EGLLP-ALGDGGT----LPLDAPISVKEAVMPWSRFRDIHGRGVDTVLGPEMR
CARB_DEIRA      LEQIGL-LE---------------TPTPRMYSVKEVHLPFLKFK-----DVLPVLGPEMK
CARB_THET2      LKELGV-RD----------L----DPVPPYYAAKEVVIPWIKFP-----GVIPELGPEMR
CARB_SYNY3      LEELGV-TE---------EF-IP-----QHVAVKEAVLPFSKFP-----GADTLLGPEMR
CARB_BRUME      LEAAFD-AY---------GG-KPQPTARPHIAVKEAVFPFARFP-----GVDTLLGPEMR
CARB_AGRFC      LDAAIA-AY---------GE-KPDPRNLKHIAVKEAVFPFARFP-----GVDILLGPEMR
CARB_RHIME      LDEAIA-AY---------GK-KPNPRNLKHIAVKEAVFPFARFP-----GVDTLLGPEMR
CARB_BUCAI      LLEQGF-IK---------EI-IP-----PYFSVKEAVLPFDKFQ-----GVDPILGPEMR
CARB_XYLFA      LVEQSV-TC---------EV-VP-----AYYAVKEAIFPFAKLQ-----GVDPILGPEMR
CARB_HALER      LAEQGF-VE---------EI-VP-----HFYSVKEAVFPFAKFP-----GVDPILSPEMK
CARB_NEIMB      LKEQGV-EK---------EV-VP-----DFYAVKEAVFPFIKFP-----GVDTILGPEMR
CARB_PASMU      LKAQGI-QG---------EV-IP-----PFYSVKEAVFPFIKFP-----GVDTVLGPEMR
CARB_RALSO      LDEQGI-HD---------EV-VP-----SYYSVKEAVFPFNKFP-----GVDPVLGPEMR
CARB_ECOLI      LAEQGV-TK---------EV-IP-----PYYSVKEVVLPFNKFP-----GVDPLLGPEMR
CARB_PSEAE      LAEVGF-TQ---------EI-IP-----PFFSVKEAVFPFAKFP-----GVDPILGPEMK
CARB_BACHD      LPQLGY-ET---------GY-HP---EAKEVSVKVPVFSFAKLR-----RVDITLGPEMK
CARB_BACCL      LAEMGY-ET---------GV-CP---VRPGVYVKVPVFSFAKLR-----NVDISLGPEMK
CARB_BACSU      LAAFGY-TE---------GL-QP---EQQGVFVKAPVFSFAKLR-----RVDITLGPEMK
CARB_LISMO      LIDLGY-TP---------GL-AP---EKQEIFVKVPVFSFAKLR-----SVDTSLGPEMK
CARB_STRPN      LSELGY-QN---------GL-YP---ESTRVHIKAPVFSFTKLA-----KVDSLLGPEMK
CARB_STRP8      LKDLGY-ED---------GL-YP---QSQLVHIKAPVFSFTKLA-----QVDSLLGPEMK
CARB_LACPL      LAEQGY-QT---------GL-VT---PGPLVHVKAPVFSFSKLN-----RVDSLLGPEMK
CARB_FUSNN      LKDLGF-TK---------DI-AD---IGNFVSVKVPVFSFQKLK-----NVDTTLGPEMK
CARB_STAAW      LTDMGY-QE---------GV-QP---YAEGVFVKAPVFSFNKLK-----NVDITLGPEMK
CARB_LACLM      LKDLGY-EA---------GL-AP---TPDMVHVKAPVFSFTKLA-----KVDSLLGPEMK
CARY_BACHD      IAELGL-SA---------G-YRK---ESPYYTVKAPVFSYQKLA-----GLDPLLEAEMK
CARY_GEOSE      LVDIVD-EK---------ARGLA---VMPYAVLKYPVFSTHKLP-----GVDPMVGPEMK
CARY_BACSU      LKDLNP-AV-------------Q---NHHGVAVKFPVFSSHAIQ-----DVDVKLGPEMK
CARY_LACPL      LATLGLVPG----------LLTP---APQQIAIKAPVFSFNKLP-----QSPVVLSPEMK
CARB_CLOAB      LKELGY-GV---------DL-KK---DNKLYAVKVPVFSNEKLA-----NVDIYLGPEMR
CARB_CLOPE      LKDLGY-GT---------GV-YK---EPELVSVKVPVFSTQKLP-----NVEVSLGPEMR
CARB_CALS4      LKELGY-KG---------GL-WP---QTPYTVVKAPVFSMEKLT-----DVEVSLSPEMK
                :                                *   :.   :           : .**:

CARB_CAMJE      STGEVMGISKDFANSYAKSQIASFNHLPE----QG-VVFISLKDKDKKYTKKIAAEYVKL
CARB_HELPJ      STGEVMGIARSLGLAFFKAQTACFNPIKN----KG-LIFVSIKDKDKEEACVLMKRLVEL
CARB_CORGL      STGEVMGLANNFGAAYAKAEAGAFGALPT----EG-TVFVTVANRDKRTLILPIQRLALM
CARB_MYCTU      STGEVMGIDRDFGSAFAKSQTAAYGSLPA----QG-TVFVSVANRDKRSLVFPVKRLADL
CARB_STRCO      STGEVMGIDSVFGTAYAKSQAGAYGPLPT----KG-RAFISVANRDKRSMIFPARELVAH
CARB_DEIRA      STGESMGIDSDPYLAFYRAQLGAKNYLPL----EG-TALLIGDGLDE-----VAGTLEGA
CARB_THET2      STGESMGIDQDPYLAYYKAELGAGQRLPL----SG-QVRFIGEGLED-----LKALYQEA
CARB_SYNY3      STGEVMGIDSDFGKAFAKAELGAGVILAT----TG-TVFVSMSDRTKEAAVPVVRELIDL
CARB_BRUME      STGEVMGLDYDYALAFAKAQLGAGVELPR----EG-TVFVSVRDEDKERVLGPVRKLASI
CARB_AGRFC      STGEVIGLDTDFALAFAKSQLGAGVDLPR----SG-TVFVSVRDEDKEGVLSAIRILVES
CARB_RHIME      STGEVIGLDTDYALAFAKSQLGAGVDLPR----DG-TVFVSVRDEDKERVLPAIRILSDI
CARB_BUCAI      STGEVMGIGKNFSEAFSKSMLGAHTNMKK----SG-RVLLSVRNNDKNNIINLAVKLKKL
CARB_XYLFA      STGEVMGVGRSFAAAFARAQEAGDIRAPQ----PG-RAFVSVRDPDKKRVLPVVLALVER
CARB_HALER      STGEVMGSGDTFAEAFYKAQLGAGEAIPAL-EGER-KAFLSVRDPDKQGVIDVARSLLGL
CARB_NEIMB      STGEVMGVGASFGEAYYKAQLGAGERLNP----TG-KIFLSVREEDKERVIKTAKNFQVL
CARB_PASMU      STGEVMGVGTTFAEAFLKAQLGANERIPK----TG-KVFLSVNDADKPRLLPIARQLQES
CARB_RALSO      STGEVMGVGRTFGEALFKSQLAAGSRLPE----KG-TVLMTVKDSDKPRAIEVARTLHTL
CARB_ECOLI      STGEVMGVGRTFAEAFAKAQLGSNSTMKK----HG-RALLSVREGDKERVVDLAAKLLKQ
CARB_PSEAE      STGEVMGVGDSFAEAFAKAQLGASEILPT----AG-CAFISVREDDKPFAAQVAGDLVAL
CARB_BACHD      STGEVMGRDKTLEKALYKGLIASGMSIP----THG-SVLFTIADKDKQEAISLAKRFYQI
CARB_BACCL      STGEVIGKDVTFEKALYKGLVASGIHIQ----PHG-AVLLTVADKDKEEAVELARRFADI
CARB_BACSU      STGEVMGKDSTLEKALYKALIASGIQIP----NYG-SVLLTVADKDKEEGLAIAKRFHAI
CARB_LISMO      STGEVMGKDVTLEKALYKGFVASGTTMH----DYG-TVLLTVADRDKEEAVELAKRFNRI
CARB_STRPN      STGEVMGSDATLEKALYKAFEASYLHLP----TFG-NVVFTIADDAKEEALNLARRFQNI
CARB_STRP8      STGEVMGSDTSLEKALYKAFEANNSHLS----EFG-QIVFTIADDSKAEALSLARRFKAI
CARB_LACPL      STGEVMGSDVTMAKALYKAFEAAKLHVP----SHG-NVLLTVRDEDKPETVALAKRFHAL
CARB_FUSNN      STGEVIGTDVNLQKALYKGLTAAGIKIK----DYG-RVLFTIDDKNKEAALNLAKGFSDV
CARB_STAAW      STGEVMGKDTTLEKALFKGLTGSGVEVK----DHG-TVLMTVSDKDKEEVVKLAQRLNEV
CARB_LACLM      STGEAMGSDVTLEKALYKSFEAAKLHMA----DYG-SVLFTVADEDKEETLALAKDFAEI
CARY_BACHD      STGELIAISKDLPSAFRKAFAWGEEQTPALFRKKG-SVFCQVDRAYDTEWQPLLRQLKEK
CARY_GEOSE      STGEGISIAATKEEAAYKAFYPYLQKKA----NAN-EVYVIGNIDAELEAEMTAKQL---
CARY_BACSU      STGEGMCVAYDSNSALKKIYTRVWS-------QKG-SIYLQNVPEDVKELA--ENAG---
CARY_LACPL      STGETLGIGPTFTTAWHAAMADSYHLETWQ------TVDGLITDIATVAQPAVQELFAAN
CARB_CLOAB      STGEVMGIDSDFEVAIYKGFRAAGIEVP----KDGGNLYVSIKDVDKQESVPIIKKYTEF
CARB_CLOPE      STGEVLGVGRNVFEALYKGFVGASMYTG----DKGKTILATIKKHDKKEFMELAKDLDKL
CARB_CALS4      STGEIMGIDLSYEGALYKALEGAGLKIP----KKG-KILLSIAERDFQEAVSLVEKLQSL
                **** :        :                                             

CARB_CAMJE      GFKLMATGGTCKEILESGFE-CELVHKISEG------RPN---VEDKLKNGEIHLVINTS
CARB_HELPJ      GFELCTTEGTHKALEKAGVK-SLKVLKISEG------RPN---IMDLMMNGEISMAINTS
CARB_CORGL      GYKILATEGTAGMLRRNGIE-CEVVLKASD-IREGVEGKS---IVDRIREGEVDLILNTP
CARB_MYCTU      GFRVLATEGTAEMLRRNGIP-CDDVRKHFEPAQPGRPTMS---AVDAIRAGEVNMVINTP
CARB_STRCO      GFELMATSGTAEVLKRNGIN-ATVVRKQSEGTGPN-GEKT---IVQLIHDGEVDLIVNTP
CARB_DEIRA      GLKVIR---------------------------------------EQDGDELPDLLIDV-
CARB_THET2      GFALTE---------------------------------------GQDYD----LLISL-
CARB_SYNY3      GFKVVATSGTQKVLREHGIEGVEVVLKLHEG------RPH---VIDWIKNGQIQFIINTP
CARB_BRUME      GFKVMATGGTQKFLEANGVE-STKINKVIEG------RPH---VEDAIRNRQIHLVFNTT
CARB_AGRFC      GFKVLATGGTQRFLAEQGIN-AEKINKVQEG------RPH---IEDAIRNRQVQLVINTT
CARB_RHIME      GFKVMATGGTARFLGEQGIV-ATKINKVLEG------RPH---VEDAIRNRQVQLVINTT
CARB_BUCAI      GFKIDATKGTSVALKKSGIS-SRLVNKVHEG------RPH---IQDRLKNGEYSYIVNTT
CARB_XYLFA      GFGVVATAGTYAWLQQNGVA-CEVVNKVAEG------RPH---VVDLIKNGEIVYIINTT
CARB_HALER      GFTLCATRGTASALQQAGLP-VDVVNKVYEG------RPH---XVDLLKNDXVAYIVNTT
CARB_NEIMB      GYGICATRGTAQYLTEHGLI-VQTINKVPEG------RPH---IGDALKNGEIALVVNTV
CARB_PASMU      GYGLCATLGTAKFLREHGVA-VQIINKVREG------RPN---IVDAIKNGEIAMVINTV
CARB_RALSO      GYPIVATRGTASAIEAAGIP-VRVVNKVKDG------RPH---IVDMIKNGELALVFTTV
CARB_ECOLI      GFELDATHGTAIVLGEAGIN-PRLVNKVHEG------RPH---IQDRIKNGEYTYIINTT
CARB_PSEAE      GFEVVATAGTARVIEAAGLP-VRRVNKVTEG------RPH---VVDMIKNDEVTLIINTT
CARB_BACHD      GFSILATEGTAHILHEEGIP-VTTVNKISDE------KPH---LLDVIRAGDAQFVINTL
CARB_BACCL      GYQLLATNGTAETLKAAGIP-VTVVNKIHSA------SPN---ILDVIRQGKAQVVINTL
CARB_BACSU      GYNILATEGTAGYLKEASIP-AKVVGKIGQD------GPN---LLDVIRNGEAQFVINTL
CARB_LISMO      GFTIMATKGTASTLEEASIP-VSQVKKIGEN------QET---LIDYIRNGQVTLVVNTL
CARB_STRPN      GYGILATEGTAAFFASHGLQ-AQPVGKIGDD------DKD---IPSFVRKGRIQAIINTV
CARB_STRP8      GYQIMATQGTAAYFAEQGLS-ACLVGKIGDA------AND---IPTLVRHGHVQAIVNTV
CARB_LACPL      GYQLLATRGTATALTTHGLP-VTTVDKIDSG------ERD---LLHRMEAGEIQVVINTV
CARB_FUSNN      GFSILTTEGTGIYFEEYGLK-VKKVGKIDNS------DYS---VLDAIQNGDVDIVINTT
CARB_STAAW      GYKILATSGTANKLAEYDIP-AEVVGKIG-G------END---LLTRIQNGDVQIVINTM
CARB_LACLM      GYSLVATAGTAAFLKENGLY-VREVEKLAGG------EDEEGTLVEDIRQGRVQAVVNTM
CARY_BACHD      GYSVVTEEAMS--------------------------------FSEWLASEDAICLVSVP
CARY_GEOSE      --TIVADVP----------------------------------FSDWVKRDTALAVIDLG
CARY_BACSU      --FTIHEGT----------------------------------FASWMEQEGNSLHINLS
CARY_LACPL      HLTVTTIANTTDWP---------------------------------AKTKAVGFTLND-
CARB_CLOAB      GYKIYASLGTGKFLQKQGID-CEVLRT-----------DD---LMKAIGDGKINLIINSP
CARB_CLOPE      GYNFIATTGTAKELREAGID-AKEVRRIGEE------SPN---IMDLIKNKEIDLVVNTP
CARB_CALS4      GYEIYATYRTGKYFSLMGIH-ANIMSL-----------DH---AIKLLKNGYFDAVVNTP
                                                                        .   

CARB_CAMJE      DSHS----FKGDTKKIRENIIRFKIPYFTNLRSALAGAKSIKAIQSKSCLDVKSLQEWLK
CARB_HELPJ      D-HK----SQDDAKLIRASVLKNHVSYFTTLSAIEVLLLALEESSQED--ELLALQDYLK
CARB_CORGL      AGSA---GARHDGYDIRAAAVTVGVPLITTVQGVTAAVQGIEALR-EGVVSVRALQELDH
CARB_MYCTU      YGNS---GPRIDGYEIRSAAVAGNIPCITTVQGASAAVQGIEAGI-RGDIGVRSLQELHR
CARB_STRCO      YGTS----GRLDGYDIRTAAVARSVPCLTTVQALAAAVQGIDALN-HGDVGVRSLQEHAA
CARB_DEIRA      -----------TGSPLLRTALERGVPIVSTKEGAEWTARAVAEAKKAGMLGVRSLQEWVK
CARB_THET2      -----------VPDPELRRAVERGLPFITTREGAWWSLKAILRAR-ESGLRVQSLQDWHQ
CARB_SYNY3      SG-E---ESQLDGRTIRRAALDYKLPIITTIAGGKATVAALRSLQ-DHPLDVKALQDYLG
CARB_BRUME      DS-A---SAVSDSKSIRRATLMQKLPYYTTMAGAESAAEAIAALK-AGSLEVRPLQDYFR
CARB_AGRFC      DS-N---KAISDSKSLRRATLMQKVPYYTTMAGAEAAALAIKALK-AGNLEVKPLQSYFN
CARB_RHIME      DG-N---KAISDSKSLRRATLMQKVPYYTTMAGAEAAALAIKALK-AGNLEVRPLQSYFE
CARB_BUCAI      SC-Y---QGIKDSKLICRSALQYKVHYDTTVNGAFATVMALNENP-I--KNIETLQKIHK
CARB_XYLFA      EG-R---AAIADSFSIRREALQHCVTYSTTIAGAKALVNSLEFRG-T--GPVWSLQELHK
CARB_HALER      EG-R---QAINDSSVIRRTALARKVPYATTLAGANAVCLALEYGN-A--ITVRRLQELHA
CARB_NEIMB      SSDP---QSVSDSHIIRQSALQQRVPQYTTTAGGEAMSEGAKSRD-H--LGVYSVQELHG
CARB_PASMU      SGLA---ETVTDGHAIRRSALQQKVFLQTTLAGAEALAGSVEYLA-D--SEVYSLQDLHQ
CARB_RALSO      DETR---AAIADSRSIRTAALANRVTYYTTIAGARAAVEGLKHLQ-N--LDVYDLQGLHA
CARB_ECOLI      SG-R---RAIEDSRVIRRSALQYKVHYDTTLNGGFATAMALNADA-T--EKVISVQEMHA
CARB_PSEAE      EG-R---QSIADSYSIRRNALQHKICCTTTIAGGQAICEALKFGP-E--KTVRRLQDLHA
CARB_BACHD      TRGK---QPARDGFRIRRESVENGVVCLTSLDTAEALLRVLESITFSAESM-PVMQ----
CARB_BACCL      TKGK---QPESDGFRIRREAVENGIPCLTSLDTARAMLQVLESMTFSTTAM-TEGLVRS-
CARB_BACSU      TKGK---QPARDGFRIRRESVENGVACLTSLDTAEAILRVLESMTFRADQM-PAVNTNQE
CARB_LISMO      TTGK---RPERDGFQIRRESVENGIPVCTSLDTAEAILRVLESRSFELESM-NASEVKQP
CARB_STRPN      GTKR---TADEDGEQIRRSAIEHGVPLFTALDTANAMLKVLESRSFVTEAI---------
CARB_STRP8      GIKR---TADKDGQMIRSSAIEQGVPLFTALDTAKAMLTVLESRCFNIEAI---------
CARB_LACPL      SDEE---QAENDGTLIRNTSIMHGIPLFTALDTVAAILQVRESQSFVTQAL---------
CARB_FUSNN      TKGK---SSEKDGFRIRRKATEYGVICFTSLDTANALLRVIESMSFRVQTL---------
CARB_STAAW      TKGK---EVERDGFQIRRTTVENGIPCLTSLDTANALTNVIESMTFTMRQM---------
CARB_LACLM      GNTRASLTTATDGFRIRQEAISRGIPLFTSLDTVAAILKVMQSRSFTTKNI---------
CARY_BACHD      A------PGQKTGKQNREEALKQRVTVVSDLATFEKMIECLEVKDGEPFL----LPDVVM
CARY_GEOSE      K--------EEGEANKRMTALSRQLLVFTERETLKLFLQALDVDHLDVQP----IHGWLE
CARY_BACSU      G--------SEEARKERLEAMTHGIPVFTEEETVRAFLQSGSGHPQPVSL----K----D
CARY_LACPL      ----------QPDNPVAIAALNHGQPLITAIDTLKTLLAVTPTPATI-------------
CARB_CLOAB      TRGN---TVGTRGFSIRRKAAEYKVGAFTCIDTAKAFLTAIKVKREEAKVEYRAMKEYFK
CARB_CLOPE      TKAN---DSKRDGFHIRRAAIERNIGVMTSLDTLKALVELQKEGAHNRELEVFNLI----
CARB_CALS4      TKGK---KPDNAGFKLRRTAVEYRIPLFTSIDTIKAALNAVSKVNVNG-LSVLSMNEYQE
                                            :                               

CARB_CAMJE      S----------
CARB_HELPJ      -----------
CARB_CORGL      AVKA-------
CARB_MYCTU      VIGGVER----
CARB_STRCO      FLIAARD----
CARB_DEIRA      -----------
CARB_THET2      KAPRG------
CARB_SYNY3      -----------
CARB_BRUME      S----------
CARB_AGRFC      -----------
CARB_RHIME      T----------
CARB_BUCAI      KIQLFYTKK--
CARB_XYLFA      ELQV-------
CARB_HALER      GVSQ-------
CARB_NEIMB      RLKNRN-----
CARB_PASMU      RLL--------
CARB_RALSO      SL---------
CARB_ECOLI      QIK--------
CARB_PSEAE      GIKA-------
CARB_BACHD      -----------
CARB_BACCL      -----------
CARB_BACSU      ------AAVTI
CARB_LISMO      ------KSRV-
CARB_STRPN      -----------
CARB_STRP8      -----------
CARB_LACPL      -----------
CARB_FUSNN      -----------
CARB_STAAW      -----------
CARB_LACLM      -----------
CARY_BACHD      N----------
CARY_GEOSE      KKKQAEQAVIA
CARY_BACSU      LYKKEVASCTQ
CARY_LACPL      -----------
CARB_CLOAB      -----------
CARB_CLOPE      -----------
CARB_CALS4      IQKDNVKNLVL