CLUSTAL format seed alignment for MF_01211

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PYRK_CLOAB        --MKEKYTVEKVYENIKVEDGIYKLSIKGEFEVRPG----QFYLLRAWDIEPTLSRPISI
PYRK_CLOPE        --MAMEYFKGKVKENIELVEGIYSLVVEHEAKINAG----QFYMIKT--PNTFLGRPISV
Q18CS7_CLOD6      --------MYKILENIYIGEDMYRMKVKGNFEGKMG----QFYMLRAWDTYPVLSRPISI
PYRK_CALS4        ---MRWKMKARVLSNRRIASEVYEMTFEWKGKKPHP----GQFLMIDCQGKTFLKRPFSV
PYRK_BACCL        ---MIGRERMTVASQRLIAERTYELTLSGRLVQEMRQPGQFVHVKVAASADPLLRRPLSL
PYRK_ALKHC        ---MRQTERMTITSHQRIADGIYEMKVTGERVKEMTSPGQFVHVKVDDGSELLLRRPLSI
PYRK_BACSU        ----MKKAYLTVCSNQQIADRVFQMVLKGELVQGFTTPGQFLHLKVSEAVTPLLRRPISI
PYRK_LISIN        ----MLQTEMKVIQQTEIADKVYELILSGECVADMS-PGQFLMLKPSRS-DLLMRRPISI
PYRK_LISMO        ----MLQTEMKVIQQTEIADKVYELILTGECVAGMS-PGQFLMLKPSRS-DLLMRRPISI
PYRK_LACLA        --MPKLQEMMTIVSQREVASNIFEMVLKGELVEEMDLPGQFLHLAVPNA-SMLLRRPISI
PYRK_LACLM        --MSQLQEMMTVVSQREVAYNIFEMVLKGTLVDEMDLPGQFLHLAVPNG-AMLLRRPISI
PYRK_STRPN        ---------MKVVAQEEIAPAIFELVLEGEMVEAMR-AGQFLHLRVPDD-AHLLRRPISI
PYRK_FUSNN        ----MKIEDCTVEENVQIAKDTYKMKIKGNFVKECRTPGQFVNIRIGDGREHVLRRPISI
A1ASB4_PELPD      -----MQFTSMVLSNAEVSPGYHRMRLTAPPEFAAARAGQFVMVRVGGGIDPLLRRPFGI
B1I4M7_DESAP      MDELTYVTDAKVVSHRRVAAGCRRLVLAAPEIARAVRPGQFLHVRCDGTADPLLRRPLSV
PYRK_PYRAB        -----MLRRVMIKETWEVAKNVRAFRF--DEK-LDFIPGQFIMLWLPGINEKPFSLADKD
PYRK_PYRHO        -----MLRRVTLKETWEVAKNIKAFRF--DEK-LDFTPGQFIMVWLPGVNEKPFSLADKD
PYRK_PYRFU        -----MLRRVSIEETWEVAKNIKAFRL--SEK-LEFTPGQFIMLWLPGVEEKPLSLADKN
PYRK_METKA        -MVSVKPIPAEVVENREECERTIVLRLRPERP-IRWEPGQFLMLGISGVDEKPMAFSGGD
PYRK_METAC        ----MLPLNVTITQITEESPLVRTFFFDHRFE--DMDPGQFVMVWVRGVDEVPMGLS---
PYRK_METJA        ---MEKPVICRIKEIIEESPTVKTFVVDKDF---DFKPGQFAMLWLPGVDEKPFGFS---
PYRK_METTH        MDSMNVPEVLEIKRIVEESESVKTFIFSWDFR-REVRPGQFVMVWDFR-DEKPMSVSLID
PYRK_THEAC        ------MNRITVDQVRDEAKNVRTLFFRWDH---DVKPGQFVMVWLPGLGEIPMSLSYVG
PYRK_THEVO        ------MINLKIEENVKESQNVNTLYFNWDQ---DIRPGQFAMIWIPGYGEIPMSFSGLG
PYRK_ARCFU        ------MYYTRITQIERLTDEVATLYFSISL---RSYPGQFVMVYVPGCEEIPLSLSSSN
Q3AC04_CARHZ      ----MQDLKGLVVENIPITKEIYKLQVSVPEEILPEIVPGSFAMVKVEAKGVFLRRPFSF
B5YJH0_THEYD      ---MNKLFKSKVISNEALTEEIYLISLEISDDVETK-PGQFCILRVNQRLDPLLGRPFSI
                             :            : .                :         :  .   

PYRK_CLOAB        -----------YDADDEKISFLYSVV--GKGTEILSKLKSGDEIKITGPLGNGFN--VKR
PYRK_CLOPE        -----------CEVNGNDVRFVYATV--GAGTNEMKKMISGDEIEIIGPLGNGFD--INK
Q18CS7_CLOD6      -----------HDIDEEGITFLYKVV--GEGTQILSNLKVNDNIKLEGPYGNGY----AK
PYRK_CALS4        -----------NDFEEEKMTILYQVR--GEGTKNLSQMKEGDILEITGPHGNGFE--ILE
PYRK_BACCL        ---------CHIDHKQGQCTIIYRQ--EGKGTALLAQKQPGDTVDVLGPLGNGFPLEAAP
PYRK_ALKHC        ---------CHVDEQTSELTLLYRA--EGQGTKRLAQKARGETVDILGPLGQGFPLEAIA
PYRK_BACSU        ---------ADVNFEKNEVTIIYRV--DGEGTRLLSLKQQGELVDVLGPLGNGFPVNEVQ
PYRK_LISIN        ---------CSYDKTAKTCILLYRV--EGDGTKDFSSLSKGDSIDVLGPLGKGFDLNTIP
PYRK_LISMO        ---------CSYDKTAKTCILLYRV--EGDGTRDFSKLSEGDTIDVLGPLGKGFDIDTTP
PYRK_LACLA        ---------SSWDKVAKTCTILYRIGDETSGTYEISKLQSGAKIDVMGPLGNGFPVDEVV
PYRK_LACLM        ---------SSWDKRAKTCTILYRIGDETTGTYKLSKLESGAKVDVMGPLGNGFPVAEVT
PYRK_STRPN        ---------SSIDKANKQCHLIYRI--DGAGTAIFSTLSQGDTLDVMGPQGNGFDLSDLD
PYRK_FUSNN        ---------SEIDRGENLVTIIYRI--VGEGTKFMANIKKGNEIDVMGPLGRGYDVLSLT
A1ASB4_PELPD      FDLSTHTPLHDGAVSQPCFEMLYRV--VGKGTALLSTLHATDRLDVLGPLGTGFDLGTP-
B1I4M7_DESAP      ---------HDADRERGTVTILYRV--VGRGTALLAQKKQGGRVNVLGPLGRGFDPPAE-
PYRK_PYRAB        ---------------------LIVVKKVGPFTSKLFKLEEGDYVWIRGPYGNGFKSV---
PYRK_PYRHO        ---------------------LIVVKRVGPFTSKLFTLEEGDYLWIRGPYGNGFKEV---
PYRK_PYRFU        ---------------------LIMVKKVGRFTNELFKLKEGDYVWIRGPYGHGFSGK---
PYRK_METKA        D-----------------REFELTIEIVGPFTERCADLEPGDVVWVRGPYGKPFEVR---
PYRK_METAC        ------------------RNNSITVQKVGEATSKLFELKEGDSFGLRGPFGKGFTLPSR-
PYRK_METJA        ------------------SKNSFSVARVGEFTKKMHELKEGDIIGVRGPYGTYFEP--I-
PYRK_METTH        PV---------------RSEIGISIRRVGEFTDRVHGLSEGDLLGIRGPYGRGFEL--M-
PYRK_THEAC        ------------------SPKGITVKAYGKVSQAMIDMEPGHEFYIRGPYGNGFQIE---
PYRK_THEVO        ------------------RRKSITVKAYGSASRKLTELKAGDDLFLRGPYGNGFDVR---
PYRK_ARCFU        ---------------------SVTVKAVGETTASLINAKEGQYVGVRGAFGSAFTPS---
Q3AC04_CARHZ      -----------ADVDLKTGLVTFYIKTVGQGTGALRELPPGREISMLLPLGRGFTVMS--
B5YJH0_THEYD      -----------FEHEKGEIKFLYRLK--GKGTNILTKLKKGDSITLTGPFGRWYPFP---
                                                 :           . :  . *  :      

PYRK_CLOAB        ISGKVAIVCGGIGVAPMVYLAKNLKNCN----------VDFYAGFKTVSKTVDNVEKYVK
PYRK_CLOPE        DYGRVALVSGGIGTAPMLELAKSLRKNNK------DIKMDFYGGFRDDIYLVDEIAEYVD
Q18CS7_CLOD6      VDGKVALVGGGIGVAPLYLVAKNIKNCD------------AYLGFREDVILEDEYKQVCN
PYRK_CALS4        GK-RVLIVGGGVGIAPLLYLAKKVKAQK----------LYIALGFKRETFLVEKFEG-LG
PYRK_BACCL        AGSRALLVGGGIGVPPLYELAKQLTKR------GVKVVSVLGFQTKAAVFYEEEFAAFGE
PYRK_ALKHC        SGETALLIGGGIGVPPLYYLAKRLKAK------GCHVINVLGFQSAKDSFYYEQFSQLGT
PYRK_BACSU        PGKTALLVGGGVGVPPLQELSKRLIEK------GVNVIHVLGFQSAKDVFYEEECRQYGD
PYRK_LISIN        APKTALLIGGGIGVPPMYQLGKELADK------GVQVTFVNGFQSEKDSFYEKEMTEYGT
PYRK_LISMO        APKTALLIGGGIGVPPMYQLGKELAEK------GVQVMFVNGFQSAKDSFYAQEMAEYGT
PYRK_LACLA        STDKILIVGGGIGVPPLYELAKQLEEK------NCQMTILLGFASEKVKILEKEFAELKN
PYRK_LACLM        STDKILIIGGGIGVPPLYELAKQLEKT------GCQMTILLGFASENVKILENEFSNLKN
PYRK_STRPN        EQNQVLLVGGGIGVPPLLEVAKELHER------GVKVVTVLGFANKDAVILKTELAQYGQ
PYRK_FUSNN        KEQTALLVGGGIGVPPLYELAKQFNKR------GIKTIIILGFNSKDEVFYEDEFKKFGE
A1ASB4_PELPD      -GAEKLLVGGGVGLAPLYLLARHLVQ-------QSPVRLFAGGRTRDDILCITEFERLGV
B1I4M7_DESAP      -HRRVAVVGGGIGIAPLFFLARELSADPLKRVPRRAVTVFQGARTAAE-LDVADFTTLPV
PYRK_PYRAB        -EGKVALVAGGIGIPPIYALAKYGNLE------EKVL--IYGARSKEELATL-DIENYVD
PYRK_PYRHO        -KGKVALVAGGIGIPPIYALAKHGKLE------EKVL--IYGARGKDELALL-DIENYVD
PYRK_PYRFU        -GKSVALIAGGIGIPPIYALAKYGNFK------RSIL--IYGARTKEEIALPKDIESYVD
PYRK_METKA        -GSRAVVVAGGTGVAPLVPLVERLRRA------RVHVTSVLGGPHADRLPRKDDLEKLSD
PYRK_METAC        -GEKVLLIAGGVGAAPLSPYAEAASAA------GAEVHTILGARSAGDLLFEWRFEALG-
PYRK_METJA        -GDKVLAVAGGIGAAPIITAVEEFSKQ------GIEITTILGARTKEELLFLDRFEKVS-
PYRK_METTH        -GRDILLVGGGIGMAPLAALADEATAR------GMRVDALVAARTADELLFLDRLEAAGV
PYRK_THEAC        -SGRKLIIGGGSGIASLLPIADSDT------------DALISAKTKEELIFTDRFPESR-
PYRK_THEVO        -EGRKLLVGGGSGIVSLYPIADQET------------DALISAKTRDELIFKDRFPESR-
PYRK_ARCFU        --KRALIVAGGIGIAPMKYLYEYLMKC------GSKVSVVYGERTAKNLFWLDKFDRIT-
Q3AC04_CARHZ      --GKSLLVAGGIGIAPLKFLAKEITKN--------GGEVRIIYGVKNAEMFIPEIVNAFE
B5YJH0_THEYD      -EGDFIVIAGGIGLASVYYLIKKFPQR---------AYLFYGVRNEKEILFYEELKRLSK
                         : ** *  .:                                           

PYRK_CLOAB        ELK-LSTEDGSIGHKGYVTDNFK------PEEYDYVLCCGPEIMMYKVVKMCEQKNV--P
PYRK_CLOPE        EVK-ISTNTGKHGHKGFVTEILP------LQEYDTVLCCGPEIMMKKVVEMCKEAKV--N
Q18CS7_CLOD6      KVY-TTVGNT------FVTDIID------VEKYDYILTCGPTPMMEKLVKMVEGTKT--R
PYRK_CALS4        EVV-VTTEEGSTGRKGLVTSVVEE----MIGEVDIVYGCGPKPMLKALQEISMKANV--L
PYRK_BACCL        TH--VATDDGSHGTAGRVTDVIEARSLE----FDVLYACGPKPMLRALAERFPN--R--P
PYRK_ALKHC        TY--VATVDGTAGTKGFVTHVLNQEALS----YNVVYSCGPTPMLKAVSERFIG--E--R
PYRK_BACSU        TY--VATADGSYGETGFVTDVIKRKKLE----FDILLSCGPTPMLKALKQEYAH--K--E
PYRK_LISIN        VH--IATVDGSYGTQGFVTDITKNFPEE----PDVIYSCGPKAMLQAVKASFPE--T--K
PYRK_LISMO        VH--IATVDGSLGTQGFVTDITKNFPEE----PDVIYSCGPKAMLQAVKASFPE--T--K
PYRK_LACLA        VSLKIATDDGSYGTKGHVGMLMEEIDFE----VDALYTCGAPAMLKAVAKKYEQL-E--R
PYRK_LACLM        VTLKIATDDGSYGTKGHVGMLMNEIDFE----VDALYTCGAPAMLKAVAKKYDQL-E--R
PYRK_STRPN        VF--VTTDDGSYGIKGNVSVVINDLDSQ----FDAVYSCGAPGMMKYINQTFDDH-P--R
PYRK_FUSNN        TY--VSTIDGSVGTKGFVTDVIKKLQAENNLVFDKYYSCGPVPMLKALVNAVGE-----D
A1ASB4_PELPD      ECY-VATEDGSLGECGLVTEALVSRLEQL-EGGAELFACGPHPMLKAVAAIAAYHAI--P
B1I4M7_DESAP      NLF-TATDDGSRGHAGSVVELFLDTVCH--EPVDWVSAAGPPGMLRALAGALETLGL--S
PYRK_PYRAB        EVV-ITTDDGSAGIKGFPTDVLAR----RKVEFSQVYACGPEVMLAKVLEIMNYERT---
PYRK_PYRHO        EIV-ITTDDGSYGIKGFPTDVLAK----RKEEFSQVYACGPEIMLAKVLEIMNYERT---
PYRK_PYRFU        EVI-ITTDDGSYGIKGFPTDVLME----RRSEFDYVYACGPEIMLAKILEIMEFENV---
PYRK_METKA        ELY-VTTEDGSEGRKGFPTDVLEEL--VEKECPDVVYACGPEGMLVRVAEIAREHDVP--
PYRK_METAC        DIY-ASTDDGSKGVKGFVTDVLKG---LDVAAYDRIAVCGPEIMMASVFRLLEERKVLEK
PYRK_METJA        RLE-ICTDDGSFGFKGFTTEKMKEV--LKEEKFDLIITCGPEIMMKKVVEIANEYNI--P
PYRK_METTH        NIS-TCTDDGSCGFKGFAHERLLT----LEENHDMAAVCGPEPMMFQVMRILDERDV--P
PYRK_THEAC        -LF-IATDDGSEGFHGFPHEFLDR---LDISVYRKIYVCGPEPMLYRVMQKLASMNA--R
PYRK_THEVO        -RF-IATDDGSDGFHGFAHELLQR---INIDSYEAIYVCGPEQMMYKVLQVLKGRKV--F
PYRK_ARCFU        ----VTTEDGSFGLKGTVLDALKL---EKLDEYEKIYVCGSEGMLRATYDFLKERDALDK
Q3AC04_CARHZ      DVE-VYAEVSGLGKRGLVLDGLKST---DLSTYNQIYLCGPEAMLKAAKPVLQNYSG--L
B5YJH0_THEYD      QLYISTEKETSYAYKGVITELFREK---SIQLPFPIYACGPMMMLKELKKIVNENRP---
                                                        .*.  *:               

PYRK_CLOAB        VYISMEKKMACGIGACLVCTCKTKGGR------RRACKEGPVFLGSELILND--------
PYRK_CLOPE        VYISMEKHMACGVGACLVCICKTKSGN------KRTCKDGPVFNGLEVEF----------
Q18CS7_CLOD6      IMVSLENHMACGVGACLVCTCKTNGGN------KKTCKDGPVFWGEDVIFNG--------
PYRK_CALS4        CQISLEEKMACGIGACLGCACKVREDKG--FSYKRVCRDGPVFWAEEVLF----------
PYRK_BACCL        VYLSLEERMGCGVGACFACVCH-VPGSE--TAYKKVCSDGPVFRAGEVVL----------
PYRK_ALKHC        AFISMEERMGCGIGACFACVCH-VTGDEAGTAYRKICTDGPVFPVGEVVL----------
PYRK_BACSU        VYLSMEERMGCGIGACFACVCH-TNESE--TSYVKVCLDGPVFKAQEVAL----------
PYRK_LISIN        TYLSLEERMACGIGACYACVCP-KAGDT--KKQFKVCEDGPVFRADEVSL----------
PYRK_LISMO        TYLSLEERMACGIGACYACVCP-KADDT--NKQFKVCEDGPVFRADEVKL----------
PYRK_LACLA        LYISMESRMACGIGACYACVEH-DKEDE--NHALKVCEDGPVFLGKQLLL----------
PYRK_LACLM        LYISMESRMACGIGACYACVEH-DKEDE--SHALKVCEDGPVFLGKQLSL----------
PYRK_STRPN        AYLSLESRMACGMGACYACVLK-VPENE--TVSQRVCEDGPVFRTGTVVL----------
PYRK_FUSNN        GYISLENRMACGIGACYACVCK-KKKKD---DYTRVCYDGPVYLASDVEIE---------
A1ASB4_PELPD      CQVSLEGYMACGVGACLGCVTPGHGHTAETPDYRCVCKEGPVFPAHELGWEE--------
B1I4M7_DESAP      GEFSLEERMGCGIGACVCCSC--RIGAPDRWEYRRVCADGPVFGAREVVWE---------
PYRK_PYRAB        -QISAERYMKCGIGICGSCALGP----------YLVCRDGPVFTGEQL-KGTEIGKFSRL
PYRK_PYRHO        -QISAERYMKCGIGICGSCALGP----------YLVCRDGPVFTGEQL-KDTEFGKFTRL
PYRK_PYRFU        -EVSAERYMKCGIGVCGSCALGP----------YLVCRDGPVFSGKQL-INTEFGKYSRT
PYRK_METKA        CQVSVVRYVKCGEGICGSCALGKG---------LLVCRDGPVFWTEEL-EGTEFGGVRRD
PYRK_METAC        AEFSLHRYFKCGIGVCGACCIDL--------SGLRVCKDGPVFSGIQL-LGSELGKYSRD
PYRK_METJA        VQVSMERYMKCGIGICGQCCVDD--------EGLCVCKDGPVFWGDKLKFIREFGKYKRD
PYRK_METTH        AQLSLERYMKCAVGICGQCCLDD--------TGFRVCAEGPVFWSQELSRVREFGRYRRD
PYRK_THEAC        AEFSLERTMKCGIGICDSCSVG----------GLQVCRQGPVFDIEQLRNNPEFGISRTT
PYRK_THEVO        VQFSLERTMKCGIGICDSCSLG----------GKQVCKEGPVFNIEELIGNPEFGVYRTT
PYRK_ARCFU        AEFSLERYMRCGIGVCGSCVIEN---------GLRVCADGPVFNASELPW----------
Q3AC04_CARHZ      IEVSLESFMACGFGACLGCAVKVFSNNE--FVYKKVCQDGPVFNFKEVVL----------
B5YJH0_THEYD      CYVATEERMACGVGACLGCVIKTRED------FKRVCTEGPVFELKELVL----------
                    .:    . *. * *  *                 * :***:    :            

PYRK_CLOAB        -----------
PYRK_CLOPE        -----------
Q18CS7_CLOD6      -----------
PYRK_CALS4        -----------
PYRK_BACCL        -----------
PYRK_ALKHC        -----------
PYRK_BACSU        -----------
PYRK_LISIN        -----------
PYRK_LISMO        -----------
PYRK_LACLA        -----------
PYRK_LACLM        -----------
PYRK_STRPN        -----------
PYRK_FUSNN        -----------
A1ASB4_PELPD      -----------
B1I4M7_DESAP      -----------
PYRK_PYRAB        PDGRIKSLR--
PYRK_PYRHO        PDGRIKGLR--
PYRK_PYRFU        PDGRIKPL---
PYRK_METKA        VTGKPE-----
PYRK_METAC        ASGRRIKI---
PYRK_METJA        ASGKKIYY---
PYRK_METTH        PAGRRVPW---
PYRK_THEAC        YSGKRVYLNMK
PYRK_THEVO        YSGRRIRLNVK
PYRK_ARCFU        -----------
Q3AC04_CARHZ      -----------
B5YJH0_THEYD      -----------