CLUSTAL format seed alignment for MF_01212

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DGTL1_BRASO      ----------MS-------------VGMA-APRAPYSCDPDRSRGRLFAE---PPSRTRS
DGTL1_BRASB      ----------MS-------------VGMA-APRAPYSCDPDRSRGRLVAE---PPSRTRS
DGTL1_BRADU      ----------MS-------------VGMA-APHAPYACDPDRSRGRLVAE---PPSRTRS
DGTL1_NITHX      ----------MA-------------VGMA-APHATYASDPARSRGRLFDE---PPSKTRS
DGTL1_RHOPB      ----------MS-------------VGMA-APRAAFACDPDASRGRLFDE---LPSKTRS
DGTL1_RHOP2      ----------MS-------------VGMA-APRAAFSCDPDRSRGRQFAE---PPSSNRS
DGTL1_RHOPS      ----------MS-------------VGMA-APRAAYGCDPDRSRGRQFAE---PPSNNRS
DGTL1_AZOC5      ----------MA-------------VSGA-RPRMTWACDPVWTRGRLVPE---QEG-TRS
DGTL1_PARL1      ----------MP-------------IANP-AATAPYATRAEETRGRLFQE---PESATRT
DGTL1_CAUVC      ---------MSQ-------------APYF-VPRAPYAEDPSKSKGRRFKE---DESRTRT
DGTL1_RHIEC      -----MTVDRRA-------------LGFGGSERAVYAADPWTTRGRLYPE---DGSPTRS
DGTL1_RHIL3      -----MTIDTRA-------------LGFGSSERAVYAADPWTTRGRLYQE---DGSPTRS
DGTL1_AGRFC      -----MIIDQRA-------------LGFGSGERAVFASDPWTTRGRLFPE---AGSLTRS
DGTL1_SINMW      -----MTVDRQA-------------LGFGYGEHAAYASNPWASRGRLYPE---ASSPTRS
DGTL1_RHIME      -----MTVDRQA-------------LGFGYGEHAAYASNPWASRGRLYPE---ASSPTRS
DGTL1_BRUME      -------MSLEG-------------IGFGYRERAPYASNPAFSRGRLVPE---PESPTRT
DGTL1_BRUC2      -------MSLEG-------------IGFGYRERAPYASNPAFSRGRLVPE---PESPTRT
DGTL1_BRUSU      -------MSLEG-------------IGFGYRERAPYASNPAFSRGRLVPE---PESPTRT
DGTL1_BRUO2      -------MSLEG-------------IGFGYRERAPYASNPAFSRGRLVPE---PESPTRT
DGTL1_BRUAB      -------MSLEG-------------IGFGYRERAPYASNPAFSRGRLVPE---PESPTRT
DGTL1_BRUA2      -------MSLEG-------------IGFGYRERAPYASNPAFSRGRLVPE---PESPTRT
DGTL1_BRUSI      -------MSLEG-------------IGFGYRERAPYASNPAFSRGRLVPE---AESPTRT
DGTL1_OCHA4      -------MSLEG-------------IGFGYRERAPYACDPARSRGRLVPE---PESPTRT
DGT1A_RHILO      -----MTNELGD-------------IGFGYRPRAAYATDPALSRGRLFDE---VESPTRT
DGTL1_BARHE      -------MDKSK-------------INFNYQSRAVYSANPQTSRGRLFHE---TMNTLRS
DGTL1_BARQU      -------MHISK-------------INFNYQARAIYSANPQTSRGRLFYE---TMSTIRS
DGTL1_BART1      -------MDIGT-------------INFNYQSRAVYSAHPQTSRGRLFHE---KMNTART
DGTL1_ZYMMO      ----------------------------MKTEFASYAADPELSRGRLHDEGKGAVRGPRN
DGTL1_RICRS      -------------------------------MLASYASDPLKSRGRLYKE---IPTSYRN
DGTL1_RICRO      -------------------------------MLASYASDPLKSRGRLYKE---IPTSYRN
DGTL1_RICCN      -------------------------------MLASYASDPLKSRGRLYKE---IPTSYRN
DGTL1_RICFE      -------------------------------MLASYASDPLKSRGRLYKE---LPTSYRN
DGTL1_RICAH      -------------------------------MLASYASDPLKSRGRLYKE---IPTSYRN
DGTL1_RICCK      -------------------------------MLASYASDPLKSRGRLYKE---IPNTYRN
DGTL1_RICB8      -------------------------------MLASYASDPLKSRGRLYRE---IPTSYRN
DGTL1_RICBR      -------------------------------MLASYASDPLKSRGRLYRE---IPTSYRN
DGTL1_RICPR      -------------------------------MLASYASDPLKSRGRLYKE---IPTYYRN
DGTL1_RICTY      -------------------------------MLASYASDPLKSRGRLYKE---IPTYYRN
DGTL1_CLOPE      -----MKIRENI-------------ENFERIKLNKVAKFSDESVGRERL---EEPDEIRT
DGTL1_CLOTE      MSIDKMSLRKRV-------------ENIERISIIPEGTKSEDTKGRIIK---ENQDDIRT
DGTL1_CALS4      -----MKVREIT-------------EELEYKLLSPYAAKSRESRGRARE---EEKCDIRT
DGTL1_SYNAS      -----MTAREFL-------------EATEKEKLAPYATRSADSAGRTLHG--DEPDDYRT
DGTL1_LEPBL      ----MYFSRNDL-------------IQKEIAGLAPYAISSTNNGGRFYE---EEEHSYRL
DGTL1_LEPBJ      ----MYFSRNDL-------------IQKEIAGLAPYAISSTNNGGRFYE---EEEHSYRL
DGTL1_LEPIC      ----MYFSRDDL-------------LQKETETLAPYAISNANNGGRIYE---EEEHSYRL
DGTL1_LEPIN      ----MYFSRDDL-------------LQKETETLAPYAISNANNGGRIYE---EEEHSYRL
DGT1A_DEIRA      -----MFTRADL-------------EAREAALLPPFARRSSEAR-RAVP---EAPSETRT
DGTL1_DEIGD      -----MLTRADL-------------EAREAATLAPYATLSAQSRGREYP---EAESATRT
DGTL1_RALSO      --MNDRLDLLPA-------------PFDLEGHLAPYAAHAAQSRGRVHA---EPPSTSRT
DGTL1_THIDA      ----------------------------MEPSFAPYAAHSSQTRGRVHR---EAPAAPRS
DGTL1_BORPE      -------MNKDG-------------TVVLMNELASYASDPSKTRGRRHS---EPPPENRT
DGTL1_BORBR      -------MNKDG-------------TVVLMNELASYASDPSKTRGRRHS---EPPPENRT
DGTL1_BORPA      -------MNKDG-------------TVVLMNELASYASDPSKTRGRRHS---EPPPENRT
DGTL1_AZOSB      -----------M-------------RVKDAVELASYAVSEAVSRGRVHP---EAAPRERG
DGTL1_NITEC      ----------------------------MRNNLPPYAVSDTNSRGRRIH---EDPPIGRS
DGTL1_NITEU      ----------------------------MRSNLAPYAVSDTNSRGRRIH---EELPAGRS
DGTL1_GEOSL      ------------------MVEEEGMRSLERADLAGYAARSCRSRGRMHP---EEFRDDRP
DGTL1_WOLSU      -----------------------------------------MRPHERFH---DFLDDFRN
DGTL1_STRCO      ---MEGTAPPTP--------------------YDPASVARYAPEPDKRPG--------RT
DGTL1_STRAW      ---MEGTTPGTPQAYEDYEETVSYEDAVTRVGYDESAVERWAVEPDKRPG--------RT
DGTL1_MYCA1      ----MTRNQHDP--------------------YDDFDRQRRVAEAPKTAGLPGTEGQHRT
DGTL1_MYCPA      ----MTRNQHDP--------------------YDDFDRQRRVAEAPKTAGLPGTEGQHRT
DGTL1_MYCTA      ----MSASEHDP--------------------YDDFDRQRRVAEAPKTAGLPGTEGQYRS
DGTL1_MYCTU      ----MSASEHDP--------------------YDDFDRQRRVAEAPKTAGLPGTEGQYRS
DGTL1_MYCBO      ----MSASEHDP--------------------YDDFDRQRRVAEAPKTAGLPGTEGQYRS
DGTL1_MYCBP      ----MSASEHDP--------------------YDDFDRQRRVAEAPKTAGLPGTEGQYRS
DGTL1_MYCUA      ----MSTKQQEP--------------------YGDFDRQRRVVEAPKTAGLPGTEGQHRT
DGTL1_MYCLE      MTTKANTNQHDP--------------------YDDFDRQRRAHEAPKTAVLPGSEGQHRT
DGTL1_MYCSK      ----MNPRLQDS--------------------YDEFDRQRRVDEPAKSAVLPGTGTEHRT
DGTL1_MYCSS      ----MNPRLQDS--------------------YDEFDRQRRVDEPAKSAVLPGTGTEHRT
DGTL1_MYCSJ      ----MNPRLQDS--------------------YDEFDRQRRVDEPAKSAVLPGTGTEHRT
DGTL1_MYCVP      ----MSPRLQDS--------------------YDEFDRQRLVAEPAKSAGLPGTDTEHRS
DGTL1_MYCS2      ----MNATQYDH--------------------YDDFDRERLVPEPAKSAALPGTDTEHRT
DGTL1_COREF      ---------MYP--------------------YSESDAQRLHQEAPKASQLAHSEVDLRS
DGTL1_CORGL      ---------MYP--------------------YSDADAFRRQPERAKSSQLRTSAVDTRS
DGTL1_VIBPA      ----------------------------------MSFELHSLWQERHDDEHKIRRDDHRS
DGTL1_VIBCB      ------------------------------MERKVSFELDALWQERHDDEHKIRRDDHRS
DGTL1_VIBVU      ------------------------------MESTLSLTIRSQWLERHDDEHKIRRDDHRS
DGTL1_VIBVY      ------------------------------MESTLSLTIRSQWLERHDDEHKIRRDDHRS
DGT1A_VIBCH      ----------------------------------MQVSLNPEWLARNNDEHKIRRNDHRS
DGTL1_ALIF1      ------------------------------MNKTNEITLSPHWEDRISNEQKLRRNDQRS
DGTL1_SHEON      -------------------------------------MTSSVWQERRHGEDKQRRNDHRS
DGTL1_HAEIE      -----------------------MQKNEIKQSDMKPLIIDSSWTERFLPD-PPREKDNRP
DGTL1_HAEIG      -----------------------MQKNEIKQIDMKPLIIDSSWTERFLPD-PPREKDNRP
DGTL1_HAEI8      -----------------------MQKNEIKQSDMKPLIIDSSWTERFLPD-PPREKDNRP
DGTL1_PASMU      -----------------------MNNQ-----------VDPIWQSRFIAD-KPREKDHRP
DGT1B_DEIRA      ----------------------------------MTAIVEPTWEERRTPE-AAHEDDARS
DGT1B_VIBCH      ------------------------MYDSEVIEYAKEQENIISKLEYRVYKHDDGRSVNRQ
DGT1B_RHILO      ------------------------------------MYTDADRSREVVPEKDGHDKKWRD
                                                                           * 

DGTL1_BRASO      PFRRDCDRVIHSTAFRRLKHKTQVFVFHE-----GDHYRTRLTHSLEVAQIARALARQLG
DGTL1_BRASB      PFRRDCDRVIHSTAFRRLKHKTQVFVFHE-----GDHYRTRLTHSLEVAQIARALARQLG
DGTL1_BRADU      PFRRDCDRVIHSTAFRRLKYKTQVFVFHE-----GDHYRTRLTHSLEVAQIARALARQLG
DGTL1_NITHX      AFRRDCDRVIHSTAFRRLKHKTQVFVYHE-----GDHYRTRLTHTLEVAQIARALARQLG
DGTL1_RHOPB      PFRRDCDRVIHSTGFRRLKHKTQVFVYHE-----GDHYRTRLTHSLEVAQIARAIARQLG
DGTL1_RHOP2      AFRRDCDRVIHSNAFRRLKHKTQVFVFHE-----GDHYRTRLTHSLEVAQIARAIARQLG
DGTL1_RHOPS      AFRRDCDRVIHSNAFRRLKHKTQVFVFHE-----GDHYRTRLTHSLEVAQIARAIARQLG
DGTL1_AZOC5      AFRRDCDRIIHSTAFRRLKHKTQVFVFHE-----GDHYRTRLTHTLEVAQIARSIARALG
DGTL1_PARL1      AFQRDRDRIIHSGAFRRLKYKTQVFVYHE-----GDNYRTRLSHSLEVSQIARSVARVFG
DGTL1_CAUVC      PFARDRDRIIHTSAFRRLKEKTQVFVAHE-----GDNFRTRLTHTLEVAQVARSLATALG
DGTL1_RHIEC      DFQRDRDRIVHTTAFRRLKHKTQVFIAQD-----GDHYRTRLTHTIEVAQIARALARALK
DGTL1_RHIL3      DFQRDRDRIVHTTAFRRLKHKTQVFIAQD-----GDHYRTRLTHTIEVAQIARALARALK
DGTL1_AGRFC      EFQRDRDRIVHTTAFRRLKHKTQVFISPD-----GDHYRTRLTHTIEVAQIARALARALK
DGTL1_SINMW      DFQRDRDRIVHTTAFRRLKHKTQVFIAAD-----GDHYRTRLTHTIEVAQIARALARALN
DGTL1_RHIME      DFQRDRDRIVHTTAFRRLKHKTQVFIAAD-----GDHYRTRLTHTIEVAQIARALARALK
DGTL1_BRUME      PFQRDRDRIIHSTAFRRLKHKTQVFIAHE-----GDHYRTRLTHTIEVAQIARALARALR
DGTL1_BRUC2      PFQRDRDRIIHSTAFRRLKHKTQVFIAHE-----GDHYRTRLTHTIEVAQIARALARALR
DGTL1_BRUSU      PFQRDRDRIIHSTAFRRLKHKTQVFIAHE-----GDHYRTRLTHTIEVAQIARALARALR
DGTL1_BRUO2      PFQRDRDRIIHSTAFRRLKHKTQVFIAHE-----GDHYRTRLTHTIEVAQIARALARALR
DGTL1_BRUAB      PFQRDRDRIIHSTAFRRLKHKTQVFIAHE-----GDHYRTRLTHTIEVAQIARALARALR
DGTL1_BRUA2      PFQRDRDRIIHSTAFRRLKHKTQVFIAHE-----GDHYRTRLTHTIEVAQIARALARALR
DGTL1_BRUSI      PFQRDRDRIIHSTAFRRLKHKTQVFIAHE-----GDHYRTRLTHTIEVAQIARALARALR
DGTL1_OCHA4      PFQRDRDRIIHSTAFRRLKHKTQVFIAHE-----GDHYRTRLTHTIEVAQIARALARALR
DGT1A_RHILO      PFQRDRDRIIHSTAFRRLKHKTQVFIAHE-----GDHYRTRLTHSIEVAQIARAVARALR
DGTL1_BARHE      PFQRDRDRIIHSNAFRRLKHKTQVFIADE-----SDHYRTRLTHSIEVSQIARTLARALY
DGTL1_BARQU      PFQRDRDRIIHSNAFRRLKHKTQVFIADE-----SDHYRTRLTHSIEVSQIARTLARALC
DGTL1_BART1      PFQRDRDRIIHSNAFRRLKHKTQVFIADE-----SDHYRTRLTHSIEVSQIARTLARALY
DGTL1_ZYMMO      AFQRDRDRIIHSMAFRRLRYKTQVFIAPE-----SDHFRVRLTHSLEVAQIGRTIARVLR
DGTL1_RICRS      EFERDRDRIIHTNAFRRLQYKTQVFINHE-----GDHYRNRLTHSLEVSTVARSVASTLN
DGTL1_RICRO      EFERDRDRIIHTNAFRRLQYKTQVFINHE-----GDHYRNRLTHSLEVSTVARSVASTLN
DGTL1_RICCN      EFERDRDRIIHTNAFRRLQYKTQVFINHE-----GDHYRNRLTHSLEVSTVARSVASTLN
DGTL1_RICFE      EFERDRDRIIHTNAFRRLQYKTQVFINHE-----GDHYRNRLTHSLEVSTVARSVANTLN
DGTL1_RICAH      EFECDRDRIINTNAFRRLQYKTQVFINHE-----GDHYRNRLTHSLEVSTVARSVANTLN
DGTL1_RICCK      EFERDRDRIIHTNAFRRLQYKTQVFINHE-----GDHYRNRLTHSLEVSAVARSVANTLN
DGTL1_RICB8      EFERDRDRIIHTNAFRRLQYKTQVFINHE-----GDHYRNRLTHSLEVSTVARSIANTLN
DGTL1_RICBR      EFERDRDRIIHTNAFRRLQYKTQVFINHE-----GDHYRNRLTHSLEVSTVARSIANTLN
DGTL1_RICPR      EFERDRDRIIHTNAFRRLQYKTQVFINHE-----GDHYRNRLTHSLEVSTVARSVANTLN
DGTL1_RICTY      EFERDRDRIIHTNAFRRLQYKTQVFINHEE----GDHYRNRLTHSLEVATVARSVANTLN
DGTL1_CLOPE      CFMVDRDRIIHSKSFRRLKRKTQVFIRTY-----GDHYRTRLVHTLEVSQVARTIGVALS
DGTL1_CLOTE      VFMVDRDRIIHSKSFRRLKHKTQVYIKTW-----GDHYRTRLTHTLEVAQIGKTIGKSIG
DGTL1_CALS4      DFQRDRDRIIHSKAFRRLSHKTQVFISPE-----GDHYRTRLTHTLEVAQIARTIARALR
DGTL1_SYNAS      CFQRDRDRILYSKVFKDLQHKTQVFLINE-----GDFYRTRLTHTLEVAQHARTFARALR
DGTL1_LEPBL      PFQRDRDRVLHSSAFKRLQYKTQVFIFSV-----GENYRNRMTHTLEVAGLSRTIASALG
DGTL1_LEPBJ      PFQRDRDRVLHSSAFKRLQYKTQVFIFSV-----GENYRNRMTHTLEVAGLSRTIASALG
DGTL1_LEPIC      PFQRDRDRILHSSAFKRLQYKTQVFIFSV-----GENYRNRMTHTLEVAGLSRTIASALG
DGTL1_LEPIN      PFQRDRDRILHSSAFKRLQYKTQVFIFSV-----GENYRNRMTHTLEVAGLSRTIASALG
DGT1A_DEIRA      AYQKDRDRVLHTKAFRRLEAKTQVFLNAPAL---GDHYRTRLTHTLEVQQVARTAALSLG
DGTL1_DEIGD      AFQKDRDRILHTTAFRRLEYKTQVFVNAQ-----GDHYRTRLTHTLEVGQVARSVALTLG
DGTL1_RALSO      EFQRDRDRIIHCTAFRRLEYKTQVFVNHE-----GDLFRTRLTHSLEVAQIARSIARSLR
DGTL1_THIDA      EFQRDRDRIIHSTAFRRLEYKTQVFVNHE-----GDLFRTRLTHSIEVAQIGRTIARLLN
DGTL1_BORPE      EFQRDRDRIIHSNAFRRLEYKTQVFVNHE-----GDLFRTRLTHSLEVAQIARTLARSLR
DGTL1_BORBR      EFQRDRDRIIHSNAFRRLEYKTQVFVNHE-----GDLFRTRLTHSLEVAQIARTLARSLR
DGTL1_BORPA      EFQRDRDRIIHSNAFRRLEYKTQVFVNHE-----GDLFRTRLTHSLEVAQIARTLARSLR
DGTL1_AZOSB      EFQRDRDRIVHSTAFRRLEYKTQVFVNHE-----GDLFRTRLTHTIEVAQLTRSLARALG
DGTL1_NITEC      QFQRDRDRVIHSTAFRRLEYKTQVFVNHE-----GDLFRTRLTHSLEVAQIGRSIARNLQ
DGTL1_NITEU      QFQRDRDRVIHSTAFRRLEYKTQVFVNHE-----GDLFRTRLTHSLEVAQIGRSIARNLN
DGTL1_GEOSL      AFERDRDRIIHCAAFRRLEYKTQVFVNHE-----GDYYRTRLTHSLEVAQIGKAIARRLA
DGTL1_WOLSU      PYSRDRDRIIHCSSFRRLEYKTQVFLNSS-----GDYFRTRLTHSIEVSQIARSIASHLG
DGTL1_STRCO      AFQRDRARILHSGALRRLAGKTQVVAPGEGSPVWDASPRTRLTHSLECAQVGRELGAALG
DGTL1_STRAW      AFQRDRARVLHSSALRRLAGKTQVVTPGTRSRAWDASPRTRLTHSLECAQVGRELGAALG
DGTL1_MYCA1      DFARDRARVLHSAALRRLADKTQVVGPREGD-----TPRTRLTHSLEVAQIGRGMAVGLG
DGTL1_MYCPA      DFARDRARVLHSAALRRLADKTQVVGPREGD-----TPRTRLTHSLEVAQIGRGMAVGLG
DGTL1_MYCTA      DFARDRARVLHSAALRRLADKTQVVGPREGD-----TPRTRLTHSLEVAQIGRGMAIGLG
DGTL1_MYCTU      DFARDRARVLHSAALRRLADKTQVVGPREGD-----TPRTRLTHSLEVAQIGRGMAIGLG
DGTL1_MYCBO      DFARDRARVLHSAALRRLADKTQVVGPREGD-----TPRTRLTHSLEVAQIGRGMAIGLG
DGTL1_MYCBP      DFARDRARVLHSAALRRLADKTQVVGPREGD-----TPRTRLTHSLEVAQIGRGMAIGLG
DGTL1_MYCUA      DFARDRARVLHCAALRRLADKTQVVGPREGD-----TPRTRLTHSLEVAQIGRGMAIGLG
DGTL1_MYCLE      EFARDRARVLHSAALRRLSDKTQVVGPHEGD-----TPRTRLTHSLEVAQIGRSMAVGLG
DGTL1_MYCSK      DFARDRARVLHCAALRRLADKTQVVGPREGD-----TPRTRLTHSLEVAQIGRGMAVGLG
DGTL1_MYCSS      DFARDRARVLHCAALRRLADKTQVVGPREGD-----TPRTRLTHSLEVAQIGRGMAVGLG
DGTL1_MYCSJ      DFARDRARVLHCAALRRLADKTQVVGPREGD-----TPRTRLTHSLEVAQIGRGMAVGLG
DGTL1_MYCVP      DFARDRARVLHCAALRRLADKTQVVGPRDGE-----TPRTRLTHSLEVAQIGRGMAIGLG
DGTL1_MYCS2      DFARDRARVLHCAALRRLADKTQVVGPRHGD-----NPRTRLTHSLEVAQIGRGMAIGLG
DGTL1_COREF      DFSRDRARVLHSAALRRLADKTQVVGPRDGD-----TPRTRLTHSLEVAQIARGMGSGLG
DGTL1_CORGL      AFARDRARVLHSAALRRLADKTQVVGPNDGD-----TPRTRLTHSLEVAQIARGIGAGLD
DGTL1_VIBPA      PYQRDRARILHSAAFRRLQAKTQVHG-NSLE----DFHRSRLTHSLEAAQLGTGIVAQLK
DGTL1_VIBCB      PYQRDRARILHSAAFRRLQAKTQVHG-NSLE----DFHRTRLTHSLEAAQLGTGIVAQLK
DGTL1_VIBVU      PFQRDRARILHSAAFRRLQAKTQVHG-NSLE----DFHRTRLTHSLEAAQLGTGIVAQIK
DGTL1_VIBVY      PFQRDRARILHSAAFRRLQAKTQVHG-NSLE----DFHRTRLTHSLEAAQLGTGIVAQIK
DGT1A_VIBCH      PFQRDRARILHSAAFRRLQAKTQVHG-TSLN----DFHRTRLTHSLEAAQIGTGIVAQIK
DGTL1_ALIF1      VFQRDRARILHSAAFRRLQAKTQVHGPGSAN----DFYRTRLTHSLEVSQIGTGVVAQLK
DGTL1_SHEON      PYQRDRARILHSAAFRRLQAKTQVLG-VGMN----DFYRTRLTHSLEVSQIGTGIAAQLS
DGTL1_HAEIE      PFRRDRGRILHSAAFRCLQAKTQIHA-IGEN----DFYRTRLTHSLEVAQIGSSLVAQLK
DGTL1_HAEIG      PFRRDRGRILHSAAFRCLQAKTQIHS-IGEN----DFYRTRLTHSLEVAQIGSSLVAQLK
DGTL1_HAEI8      PFRRDRGRILHSAAFRCLQAKTQIHA-IGEN----DFYRTRLTHSLEVAQIGSSLVAQLK
DGTL1_PASMU      PFRRDRGRILHSAAFRCLQAKTQIHA-VGEN----DFYRTRLTHSLEVAQIGSSLVAQMR
DGT1B_DEIRA      QYRKDYSRIIHSAALRRLQTKTQVLG-LGDS----DFYRTRLTHSLEVAQIGVGILLEIQ
DGT1B_VIBCH      DLMRDYARVLYSSSFRRLQGKMQLLGVDA-----SKFNRNRLTHSLEVAQIARSIAYDLE
DGT1B_RHILO      EFGRDYGRIIHSASFRRQQGKTQVFPSRE-----SDFFRNRLTHSLEVAQIAQGIAERIN
                     *  *::    ::    * *:              * *: *::*           : 

DGTL1_BRASO      ---------------------------LDEDLTETLALAHDLGHPPFGHAGERALNRCMA
DGTL1_BRASB      ---------------------------LDEDLTETLALAHDLGHPPFGHAGERALNRCME
DGTL1_BRADU      ---------------------------LDEDLTETLALAHDLGHPPFGHAGERALDACLK
DGTL1_NITHX      ---------------------------LDEDLTEALALAHDLGHPPFGHAGERALDACLD
DGTL1_RHOPB      ---------------------------LDEDLTEALALAHDLGHPPFGHAGERALDACLQ
DGTL1_RHOP2      ---------------------------LDEDLTETLALAHDLGHPPFGHAGERALDACLR
DGTL1_RHOPS      ---------------------------LDEDLTETLALAHDLGHPPFGHAGERALDACLR
DGTL1_AZOC5      ---------------------------LDEDLAEALALAHDLGHPPFAHAGERALDACMA
DGTL1_PARL1      ---------------------------LDEDLSETLALAHDLGHTPFGHAGETALDSCMR
DGTL1_CAUVC      ---------------------------LDADLAETIALAHDLGHPPFGHAGEDELEIQMR
DGTL1_RHIEC      ---------------------------LDEDLAEGVALVHDFGHTPFGHTGEDALHEVLL
DGTL1_RHIL3      ---------------------------LDEDLAEGVALVHDFGHTPFGHTGEDALHEVLL
DGTL1_AGRFC      ---------------------------LDEDLAEGVALVHDFGHTPFGHTGEDALDAVLL
DGTL1_SINMW      ---------------------------LDEDLAEGVALVHDFGHTPFGHTGEDALDEVLK
DGTL1_RHIME      ---------------------------LDEDLAEGVALVHDFGHTPFGHTGEDALHEVLE
DGTL1_BRUME      ---------------------------LDEDLAEAVALVHDFGHTPFGHTGEDALNERMK
DGTL1_BRUC2      ---------------------------LDEDLAEAVALVHDFGHTPFGHTGEDALNERMK
DGTL1_BRUSU      ---------------------------LDEDLAEAVALVHDFGHTPFGHTGEDALNERMK
DGTL1_BRUO2      ---------------------------LDEDLAEAVALVHDFGHTPFGHTGEDALNERME
DGTL1_BRUAB      ---------------------------LDEDLAEAVALVHDFGHTPFGHTGEDALNERMK
DGTL1_BRUA2      ---------------------------LDEDLAEAVALVHDFGHTPFGHTGEDALNERMK
DGTL1_BRUSI      ---------------------------LDEDLAEAVALVHDFGHTPFGHTGEDALNERMK
DGTL1_OCHA4      ---------------------------LDEDLAEAVALVHDFGHTPFGHTGEEALNDRMK
DGT1A_RHILO      ---------------------------GDEDLAEAVALVHDFGHTPFGHTGEDALNDKMA
DGTL1_BARHE      ---------------------------LDEDLAESIALVHDFGHTPFGHAGEDALNEAMA
DGTL1_BARQU      ---------------------------LDEDLAEAIALAHDFGHTPFGHAGEDALNEAMA
DGTL1_BART1      ---------------------------LDEDLTEAIALVHDFGHTPFGHAGEEALNEAMM
DGTL1_ZYMMO      ---------------------------LNEDLTEALCLAHDLGHPPFGHIGENILKQALK
DGTL1_RICRS      ---------------------------LSNDLAETIALAHDLGHTPFGHAGERALNECMR
DGTL1_RICRO      ---------------------------LSNDLAETIALAHDLGHTPFGHAGERALNECMR
DGTL1_RICCN      ---------------------------LSNDLAETIALAHDLGHTPFGHAGERALNECMR
DGTL1_RICFE      ---------------------------LSSDLAETIALAHDLGHTPFGHAGERALNECMK
DGTL1_RICAH      ---------------------------LSSDLAETIALAHDLGHTPFGHAGERALNECMK
DGTL1_RICCK      ---------------------------LSSDLAETIALAHDLGHTPFGHAGERALNACMR
DGTL1_RICB8      ---------------------------LSSDLAETIALAHDLGHTPFGHAGERALNECMK
DGTL1_RICBR      ---------------------------LSSDLAETIALAHDLGHTPFGHAGERSLNECMK
DGTL1_RICPR      ---------------------------LSSDLAETIALAHDLGHTPFGHAGERALNECMK
DGTL1_RICTY      ---------------------------LSSDLAETIALAHDLGHTPFGHVGEKALNECMK
DGTL1_CLOPE      ---------------------------LNEYLIEAIALGHDLGHAAFAHIGEDVLNDFLP
DGTL1_CLOTE      ---------------------------LNEDLIEAIALGHDIGHVAFAHSGEEVLNELLP
DGTL1_CALS4      ---------------------------LNEDLTEAIALGHDLGHTPFGHSGEEVLNKLLK
DGTL1_SYNAS      ---------------------------LNEDLCEAIAYAHDLGHPPFGHSGEETLNDLLK
DGTL1_LEPBL      ---------------------------LNSHLSESIALAHDLGHTPFGHAGQEILSSLMK
DGTL1_LEPBJ      ---------------------------LNSHLSESIALAHDLGHTPFGHAGQEILSSLMK
DGTL1_LEPIC      ---------------------------LNSLLSESIALAHDLGHTPFGHAGQEILSGLMK
DGTL1_LEPIN      ---------------------------LNSLLSESIALAHDLGHTPFGHAGQEILSGLMK
DGT1A_DEIRA      ---------------------------LNETLAETVALAHDLGHPPFGHAGERLLDSLMR
DGTL1_DEIGD      ---------------------------LNETLAEAIALAHDLGHPPFGHAGERVLDTLMA
DGTL1_RALSO      ---------------------------LNEDLVEAISLAHDLGHTPFGHAGQDALNDCMK
DGTL1_THIDA      ---------------------------LNEDLVEAVALAHDLGHTPFGHAGQDALNACMR
DGTL1_BORPE      ---------------------------VSEDLTEAIALAHDLGHTPFGHAGQDELNACMR
DGTL1_BORBR      ---------------------------VSEDLTEAIALAHDLGHTPFGHAGQDELNACMR
DGTL1_BORPA      ---------------------------VSEDLTEAIALAHDLGHTPFGHAGQDELNACMR
DGTL1_AZOSB      ---------------------------LNEDLAEAIALAHDLGHTPFGHAGQDALHACMK
DGTL1_NITEC      ---------------------------LNEELVEAISLAHDLGHTPFGHAGQDALDNCMK
DGTL1_NITEU      ---------------------------LNEELVEAITLSHDLGHTPFGHAGQDALNDCMK
DGTL1_GEOSL      ---------------------------LNEELTEALALAHDLGHTPFGHTGEEVLNRLME
DGTL1_WOLSU      ---------------------------LNETLAEAIALSHDLGHTPFGHAGGDELDRLLK
DGTL1_STRCO      ---------------------------CDPDLVEAACLAHDLGHPPFGHNGEQALNAFAE
DGTL1_STRAW      ---------------------------CDPDLVEAACLSHDLGHPPFGHNGEQALNEFAE
DGTL1_MYCA1      ---------------------------CDLDLVELAGLAHDIGHPPYGHNGERALDEVAA
DGTL1_MYCPA      ---------------------------CDLDLVELAGLAHDIGHPPYGHNGERALDEVAA
DGTL1_MYCTA      ---------------------------CDLDLVELAGLAHDIGHPPYGHNGERALDEVAA
DGTL1_MYCTU      ---------------------------CDLDLVELAGLAHDIGHPPYGHNGERALDEVAA
DGTL1_MYCBO      ---------------------------CDLDLVELAGLAHDIGHPPYGHNGERALDEVAA
DGTL1_MYCBP      ---------------------------CDLDLVELAGLAHDIGHPPYGHNGERALDEVAA
DGTL1_MYCUA      ---------------------------CDLDLVELAGLAHDIGHPPYGHNGERALDEVAI
DGTL1_MYCLE      ---------------------------CDLDLVELAGLAHDIGHPPYGHNGERALDEVAV
DGTL1_MYCSK      ---------------------------CDPDLVDLAGLAHDIGHPPYGHNGERALNEIAK
DGTL1_MYCSS      ---------------------------CDPDLVDLAGLAHDIGHPPYGHNGERALNEIAK
DGTL1_MYCSJ      ---------------------------CDPDLVDLAGLAHDIGHPPYGHNGERALNEIAK
DGTL1_MYCVP      ---------------------------CDPDLVDLAGLAHDIGHPPYGHNGERALDEIIK
DGTL1_MYCS2      ---------------------------CDPDLVDLAGLAHDIGHPPYGHNGERALNEIAK
DGTL1_COREF      ---------------------------LDPELSELAGLCHDIGHPPYGHNGEKALNEVAA
DGTL1_CORGL      ---------------------------LDPDLCDLAGLCHDIGHPPYGHNGENALNEVAA
DGTL1_VIBPA      -----------------KKQSEFKELLPSDSLIDSLCLAHDIGHPPYGHGGEVALNYMMR
DGTL1_VIBCB      -----------------KKQPEFRDLLPSDSLIDSLCLAHDIGHPPYGHGGEVALNYMMR
DGTL1_VIBVU      -----------------KKQPEYRDLLPTDSLIDALCLAHDIGHPPYGHGGEVALNYMMR
DGTL1_VIBVY      -----------------KKQPEYRDLLPTDSLIDALCLAHDIGHPPYGHGGEVALNYMMR
DGT1A_VIBCH      -----------------LKQPEFRELLPSDSLIDSLCLAHDIGHPPYGHGGEIALNYMMR
DGTL1_ALIF1      -----------------LRQPEFRALLTSTSLMESICLAHDIGHPPFGHGGEIALNYMMR
DGTL1_SHEON      -----------------RKYPEHKPLLDSMSLLESLCLAHDIGHPPFGHGGEVALNYMMR
DGTL1_HAEIE      FLETFESLSQTLNIDKNELQKQLKPLLPSNDLIESLCFAHDIGHPPFGHGGETALNYMMA
DGTL1_HAEIG      FLETFESLSQTLNIDKNELQKQLKPLLPSNDLIESLCFAHDIGHPPFGHGGETALNYMMA
DGTL1_HAEI8      FLETFESLSQTLNIDKNELQKQLKPLLPSNDLIESLCFAHDIGHPPFGHGGETALNYMMA
DGTL1_PASMU      FSEAFTALAQQMQQDKTELQKTLKGLLPSNDLIESLCFAHDIGHPPFGHGGEVALNYMMR
DGT1B_DEIRA      ---------------RRFAGSNIEKYLPDERLLEAICLSHDYGHPPFGHGGERALNFAMR
DGT1B_VIBCH      --------------------------LNHTVVAETASLAHDIGNPPFGHYGEVVLNDLSL
DGT1B_RHILO      -----------------YDYDKDLGGKIDPRLCATAGLVHDIGHPPFGHNGESALDKAMQ
                                                :       ** *: .:.* *   *     

DGTL1_BRASO      DHGG-----FDHNAQTLRIVTAFEQRYPDF---------DGLNLTWESLEGIVKHNGPLQ
DGTL1_BRASB      AHGG-----FDHNAQTLRIVTTFEQRYPDF---------DGLNLTWESLEGIVKHNGPLH
DGTL1_BRADU      EFGG-----FDHNAQALRVVAALEHRYPEF---------DGLNLTWESLEGIVKHNGPLT
DGTL1_NITHX      GYGG-----FDHNAQTLRIVTLLEHRYPDF---------DGLNLTWETLEGVVKHNGPLA
DGTL1_RHOPB      RYGG-----FDHNAQSLRVVTALEHRYPEF---------NGLNLTWETLEGIVKHNGPLT
DGTL1_RHOP2      DHGG-----FDHNAQTLRVLTALEHRYPGF---------DGLNLTWETLEGVVKHNGPLT
DGTL1_RHOPS      AHGG-----FDHNAQTLRVLTALEHRYPEF---------DGLNLTWETLEGVVKHNGPLT
DGTL1_AZOC5      DYGG-----FDHNAQSLRVVTRLERRYAGF---------DGLNLTWETLEGIAKHNGPLT
DGTL1_PARL1      DFGG-----FDHNAQTLRIVTKLEHRYARF---------DGLNLTWETLEGLVKHNGPVV
DGTL1_CAUVC      EYGG-----FDHNVQTFRVVTELEHRYPDF---------IGLNLTWETLEGVIKHNGPVT
DGTL1_RHIEC      PYGG-----FDHNAQSLRIVTKLERRYAEF---------DGINLTWESLEGLVKHNGPLL
DGTL1_RHIL3      PYGG-----FDHNAQSLRIVTKLERRYAEF---------DGINLTWESLEGLVKHNGPLL
DGTL1_AGRFC      PYGG-----FDHNAQSLRIVTKLERRYAEY---------DGINLTWETLEGLVKHNGPLV
DGTL1_SINMW      PYGG-----FDHNAQSLRIVTKLERRYAEF---------DGLNLTWESLEGLVKHNGPLT
DGTL1_RHIME      PYGG-----FDHNAQSLRIVTKLERRYAEF---------DGLNLTWESLEGLVKHNGPLM
DGTL1_BRUME      NFGG-----FDHNAQSLRIVTKLEHRYADF---------DGLNLSWETLEGLVKHNGPLL
DGTL1_BRUC2      NFGG-----FDHNAQSLRIVTKLEHRYADF---------DGLNLSWETLEGLVKHNGPLL
DGTL1_BRUSU      NFGG-----FDHNAQSLRIVTKLEHRYADF---------DGLNLSWETLEGLVKHNGPLL
DGTL1_BRUO2      NFGG-----FDHNAQSLRIVTKLEHRYADF---------DGLNLSWETLEGLVKHNGPLL
DGTL1_BRUAB      KFGG-----FDHNAQSLRIVTKLEHRYADF---------DGLNLSWETLEGLVKHNGPLL
DGTL1_BRUA2      KFGG-----FDHNAQSLRIVTKLEHRYADF---------DGLNLSWETLEGLVKHNGPLL
DGTL1_BRUSI      NFGG-----FDHNAQSLRIVTKLEHRYADF---------DGLNLSWETLEGLVKHNGPLL
DGTL1_OCHA4      AFGG-----FDHNAQSLRIVTKLEHRYADF---------DGLNLSWETLEGLVKHNGPLL
DGT1A_RHILO      AWGG-----FDHNAQSLRIVTRLEARYAEF---------DGLNLTWETLEGLVKHNGPLT
DGTL1_BARHE      PYGG-----FDHNAQALRIVTKLEQRYANF---------DGLNLTWETLEGLVKHNGPLL
DGTL1_BARQU      HYGG-----FDHNAQALRIVTKLEQRYANF---------DGLNLTWETLEGLVKHNGPLL
DGTL1_BART1      QYGG-----FDHNAQALRIVTKLEQRYANF---------DGLNLTWETLEGLVKHNGPLL
DGTL1_ZYMMO      DAGG-----FDHNAHSLRILTHLESPYPRW---------SGLNLTWEMQEGLAKHNGPIR
DGTL1_RICRS      EYNG-----FSHNAQSLKILTLLEKRYAAY---------NGVNLTWEVLEGIVKHNGPIL
DGTL1_RICRO      EYNG-----FSHNAQSLKILTLLEKRYAAY---------NGVNLTWEVLEGIVKHNGPIL
DGTL1_RICCN      EYNG-----FSHNAQSLKILTLLEKRYAAY---------NGVNLTWEVLEGIVKHNGPIL
DGTL1_RICFE      EYNG-----FSHNAQSLKILTLLEKRYAAY---------NGVNLTWEVLEGIVKHNGPIT
DGTL1_RICAH      EYSG-----FSHNAQSLKILTLLEKRYAAY---------NGVNLTWEVLEGIIKHNGPIT
DGTL1_RICCK      DYNG-----FSHNAQSLKILTLLEKRYAAY---------NGVNLTWEVLEGIVKHNGPIT
DGTL1_RICB8      EHNG-----FSHNAQSLKILTLLEKRYAAY---------RGVNLTWEVLEGIVKHNGPIS
DGTL1_RICBR      EHNG-----FSHNAQSLKILTLLEKRYAAY---------RGVNLTWEVLEGIVKHNGPIS
DGTL1_RICPR      EYHG-----FSHNSQSLKILTLLEKRYAAY---------NGVNLTWEVLEGIVKHNGPIL
DGTL1_RICTY      EYNG-----FSHNSQSLKILTLLEKRYAAY---------NGVNLTWEVLEGIVKHNGPIL
DGTL1_CLOPE      --GG-----FKHNEQSVRVAKKIEKNGL------------GLNLTKEVLDGILNHSGFSN
DGTL1_CLOTE      --NG-----FKHNINSIRVLTKIEKQGK------------GLNLTKEVLDGILHHSGFSN
DGTL1_CALS4      --GG-----FRHSEQSIRVVEVLENDGK------------GLNLTWEVKDGILNHSTGGK
DGTL1_SYNAS      DDGG-----FEHNIQSLRVVDFLEKRYQRY---------DGLNLCFETREGIARHNTTHD
DGTL1_LEPBL      DHGG-----FEHNKQSLRIVTSIEKKYPNF---------PGLNLCRETLKGLMKHGTEYD
DGTL1_LEPBJ      DHGG-----FEHNKQSLRIVTSIEKKYPNF---------PGLNLCRETLKGLMKHGTEYD
DGTL1_LEPIC      DYGG-----FEHNKQSLRIVTSIEKKYPNF---------PGLNLCRETLKGLMKHGADYD
DGTL1_LEPIN      DYGG-----FEHNKQSLRIVTSIEKKYPNF---------PGLNLCRETLKGLMKHGADYD
DGT1A_DEIRA      GHGE----TFDHNSQARRIVTLLEERSGEQ---------PGLNLTLDTLDGLNKHGRAAL
DGTL1_DEIGD      EYGVPPENTFDHNTQARRIVTRLEDRYPDF---------PGLNLTLETLDGLNKHDRAGL
DGTL1_RALSO      PY-----GGFEHNLQSLLVVDRLEERYGGF---------DGLNLTFETREGILKHCSRNN
DGTL1_THIDA      EH-----GGFEHNLQSLRVVDLLEERYAEF---------DGLNLTFEAREGILKHCALSN
DGTL1_BORPE      ELAPQA-GGFEHNLQSLRVVDELEERYAEF---------NGLNLCFETREGILKHCSATH
DGTL1_BORBR      ELAPQA-GGFEHNLQSLRVVDELEERYAEF---------NGLNLCFETREGILKHCSATH
DGTL1_BORPA      ELAPQA-GGFEHNLQSLRVVDELEERYAEF---------NGLNLCFETREGILKHCSATH
DGTL1_AZOSB      DY-----GGFEHNLQSLRTVELLEDRYAAF---------DGLNLLFETREGILKHCSRPN
DGTL1_NITEC      AH-----GGFEHNLQSLRVVDVLEERYARF---------DGLNLCFETREGILKRATKSK
DGTL1_NITEU      TY-----GGFEHNLQSLRVVDVLEERYATF---------NGLNLCFETREGILKRVPKSK
DGTL1_GEOSL      GF-----GGFEHNLQSFRVVDQLEERYPGF---------NGLNLSWEVLEGIIKHSSPY-
DGTL1_WOLSU      KHGFE--AGFDHNFQSFRVVSKLEKRYPNF---------EGLNLTFATLEGILKHSYPYQ
DGTL1_STRCO      DCGG-----FEGNAQSLRLLTRIEPKRFTE-DGS-----VGLNLTRATLDAATKYPWPRG
DGTL1_STRAW      DCGG-----FEGNAQSLRLLARIEPKRFVRSEGSGELVSVGLNLTRAALDAATKYPWPRR
DGTL1_MYCA1      AYGG-----FEGNAQNFRILTSLEPKVLDAQGNS-----AGLNLTRASLDAVIKYPWRRG
DGTL1_MYCPA      AYGG-----FEGNAQNFRILTSLEPKVLDAQGNS-----AGLNLTRASLDAVIKYPWRRG
DGTL1_MYCTA      SHGG-----FEGNAQNFRILTSLEPKVVDAQGLS-----AGLNLTRASLDAVTKYPWMRG
DGTL1_MYCTU      SHGG-----FEGNAQNFRILTSLEPKVVDAQGLS-----AGLNLTRASLDAVTKYPWMRG
DGTL1_MYCBO      SHGG-----FEGNAQNFRILTSLEPKVVDAQGLS-----AGLNLTRASLDAVTKYPWMRG
DGTL1_MYCBP      SHGG-----FEGNAQNFRILTSLEPKVVDAQGLS-----AGLNLTRASLDAVTKYPWMRG
DGTL1_MYCUA      GCGG-----FEGNAQNFRILTSLEPKVLDEHGLS-----VGLNLTRAALDAVTKYPWPRG
DGTL1_MYCLE      GYGG-----FEGNAQNFRILTSLEPKVIDEQGCS-----VGLNLTRASLDAVTKYPWTRV
DGTL1_MYCSK      AFGG-----FEGNAQNFRILTRLEPKVLDATGRS-----AGLNLTRAALDAVTKYPWQRG
DGTL1_MYCSS      AFGG-----FEGNAQNFRILTRLEPKVLDATGRS-----AGLNLTRAALDAVTKYPWQRG
DGTL1_MYCSJ      AFGG-----FEGNAQNFRILTRLEPKVLDATGRS-----AGLNLTRAALDAVTKYPWQRG
DGTL1_MYCVP      GFGG-----FEGNAQNFRILTRLEPKVLDEHGRS-----AGLNLTRASLDAVAKYPWPRQ
DGTL1_MYCS2      AFGG-----FEGNAQNFRILTRLEPKVLDADGRS-----AGLNLTRASLDAVTKYPWRRT
DGTL1_COREF      ACGG-----FEGNAQTLRILTRLEPKVVSADGTS-----FGLNLTRAALDAACKYPWTKT
DGTL1_CORGL      ACGG-----FEGNAQTLRILTRLEPKIVSDEGES-----FGLNLSRAALDAACKYPWAKT
DGTL1_VIBPA      DHGG-----FEGNAQTFRIVTKLEPYTEHF----------GMNLSRRTLLGLIKYPALI-
DGTL1_VIBCB      EHGG-----FEGNAQTFRIVTKLEPYTEHF----------GMNLSRRALLGLIKYPALL-
DGTL1_VIBVU      DHGG-----FEGNAQTFRIVTQLEPYTEHF----------GMNLSRRTLLGLIKYPAFI-
DGTL1_VIBVY      DHGG-----FEGNAQTFRIVTQLEPYTEHF----------GMNLSRRTLLGLIKYPAFI-
DGT1A_VIBCH      DHGG-----FEGNAQTFRIVTSLEPYTEHH----------GMNLSRRTLLGLLKYPALL-
DGTL1_ALIF1      DHGG-----FEGNGQTLRILSKLEPYTEHF----------GMNLARRTLLGVLKYPAFL-
DGTL1_SHEON      HHGG-----FEGNGQTFRILSKLEPYTLDF----------GMNLCRRTMLGILKYPAPQ-
DGTL1_HAEIE      EQGG-----FEGNAQTFRILTKLEPYTENA----------GMNLTRRTLLGVVKYPALLD
DGTL1_HAEIG      EQGG-----FEGNAQTFRILTKLEPYTENA----------GMNLTRRTLLGVVKYPALLD
DGTL1_HAEI8      EQGG-----FEGNAQTFRILTKLEPYTENA----------GMNLTRRTLLGVVKYPALLG
DGTL1_PASMU      EHGG-----FEGNAQTFRLLTKLEPYTPNA----------GMNLTRRTLLGIVKYPTILD
DGT1B_DEIRA      EYGG-----FEGNAQTFRILSKLEKYSQNS----------GLNPTRRTLLGVLKYPTTY-
DGT1B_VIBCH      ACGG-----YEGNAQAFRILRTLEKKHYAY---------PGLNLNVRTLMAITKYFFNKH
DGT1B_RHILO      RYGG-----FEGNAQTLRILTRLEKKLRYAEPLAGDDR-AGLNLCHRTIAATLKYDNEIP
                          :  . :       :*                *:*       .  .      

DGTL1_BRASO      G------------P----VPAGIAEFNARFDLELWS------------------------
DGTL1_BRASB      E------------A----VPSGIADFNARFDLELWS------------------------
DGTL1_BRADU      DRSGAPVGHYREHG----IPVGIADYIKVYDLELWS------------------------
DGTL1_NITHX      DRACNAIGRYQRRG----IPVGIADFNRRHDLELWS------------------------
DGTL1_RHOPB      DRSGAPLGRYQAHG----VPTGIVEFNRCFDLELWS------------------------
DGTL1_RHOP2      DRTGAPLPRHAERG----VPIGIAEFSQRFDLEIWS------------------------
DGTL1_RHOPS      DRAGRPLPRYAERG----VPIGIVEFSQRFDLELWS------------------------
DGTL1_AZOC5      DRSGKPLGA-AGDV----LPHAIVAHSAVQDLELWT------------------------
DGTL1_PARL1      TPGRS------IAD----LPRAIAEYAETQDLELAT------------------------
DGTL1_CAUVC      NKLGKP------------SWKAISKYDNEYELGLGT------------------------
DGTL1_RHIEC      TPEGAGT----RGP----VPQPILDYCELHDLELAT------------------------
DGTL1_RHIL3      TADGVGT----RGP----VPQPILDYCELHDLELAT------------------------
DGTL1_AGRFC      NAKGEGI----KGP----VPLPILEYCVLQDLEIGS------------------------
DGTL1_SINMW      TADGQGL----RGP----VSQPILDYCALHDLELAS------------------------
DGTL1_RHIME      TADGQGL----RGP----VPQPILDYCALHDLELAS------------------------
DGTL1_BRUME      GPYAAHP----DIP----VPQPILDFNARYDLELSR------------------------
DGTL1_BRUC2      GPYAAHP----DIP----VPQPILDFNARYDLELSR------------------------
DGTL1_BRUSU      GPYAAHP----DIP----VPQPILDFNARYDLELSR------------------------
DGTL1_BRUO2      GPYAAHP----DIP----VPQPILDFNARYDLELSR------------------------
DGTL1_BRUAB      GPYAAHP----DIP----VPQPILDFNARYDLELSR------------------------
DGTL1_BRUA2      GPYAAHP----DIP----VPQPILDFNARYDLELSR------------------------
DGTL1_BRUSI      GPYAAHP----DIP----VPQPILDFNARYDLELSR------------------------
DGTL1_OCHA4      GAHAAHP----DAA----VPLPILDFNERYDLELTR------------------------
DGT1A_RHILO      DASGKGL----KGP----VPQAIRDYSQMQDLELDR------------------------
DGTL1_BARHE      GPYAK------NKD----IPIDILQYNAKQDLQLNC------------------------
DGTL1_BARQU      GPYAN------NKD----VPIDILQYNTKQDLKLNC------------------------
DGTL1_BART1      GPYAK------NKE----VPSDILQYNAKQDLALDC------------------------
DGTL1_ZYMMO      HPN-----------------WALSAVDDAFPLELTS------------------------
DGTL1_RICRS      GE----------------INEYIAEYNKQNDLELST------------------------
DGTL1_RICRO      GE----------------INEYIAEYNKQNDLELST------------------------
DGTL1_RICCN      GE----------------INEYIAEYNKQNDLELST------------------------
DGTL1_RICFE      DE----------------INEYIAEYNKQNDLELST------------------------
DGTL1_RICAH      GE----------------INEYIAEYNKQNDLELST------------------------
DGTL1_RICCK      CE----------------INEYIAEYNKQNDLELDT------------------------
DGTL1_RICB8      GE----------------VNEYIEEYNSQNDLELNT------------------------
DGTL1_RICBR      GE----------------VNEYIEEYNSQNDLELNT------------------------
DGTL1_RICPR      GA----------------INEYVAEYNKQNDLELST------------------------
DGTL1_RICTY      GA----------------INEYVAEYNKQNDLELNT------------------------
DGTL1_CLOPE      VSKVAG------------------------TF----------------------------
DGTL1_CLOTE      KKDITK------------------------AF----------------------------
DGTL1_CALS4      PS----------------------------------------------------------
DGTL1_SYNAS      HPDTPP------------------------EFQNYS------------------------
DGTL1_LEPBL      PSMMLL------------------------ERKE-S------------------------
DGTL1_LEPBJ      PSMMLL------------------------ERKE-S------------------------
DGTL1_LEPIC      SSVILL------------------------ERKE-N------------------------
DGTL1_LEPIN      SSVILL------------------------ERKE-N------------------------
DGT1A_DEIRA      PPTQRQ------------------------------------------------------
DGTL1_DEIGD      GP----------------------------------------------------------
DGTL1_RALSO      AATLGD---------------------LGRRFLEGQ------------------------
DGTL1_THIDA      AEKLGE---------------------VGRRFIDKK------------------------
DGTL1_BORPE      ARQLGA---------------------VGERFLDRT------------------------
DGTL1_BORBR      ARQLGA---------------------VGERFLDRT------------------------
DGTL1_BORPA      ARQLGA---------------------VGERFLDRT------------------------
DGTL1_AZOSB      AEKLGE---------------------LGARFLNGT------------------------
DGTL1_NITEC      AQALGE---------------------LGERFLHGR------------------------
DGTL1_NITEU      AAALDE---------------------LGTRFLHGH------------------------
DGTL1_GEOSL      -DRPTG---------------------LIEGFLPGV------------------------
DGTL1_WOLSU      KSFLDAA--------------------MNEIFALDY------------------------
DGTL1_STRCO      AHPAVPASPKFGVY-----DDDRPVFAWLREDAPGA------------------------
DGTL1_STRAW      AHPTDPTSPKFGVY-----EDDRPVFDWIRKGAPGH------------------------
DGTL1_MYCA1      EGPG---TSKFGFY-----DDDREAAAWVRAGAPAG------------------------
DGTL1_MYCPA      EGPG---TSKFGFY-----DDDREAAAWVRAGAPAG------------------------
DGTL1_MYCTA      DGLGS-QRRKFGFY-----DDDRESAVWVRQGAPPE------------------------
DGTL1_MYCTU      DGLGS-QRRKFGFY-----DDDRESAVWVRQGAPPE------------------------
DGTL1_MYCBO      DGLGS-QRRKFGFY-----DDDRESAVWVRQGAPPE------------------------
DGTL1_MYCBP      DGLGS-QRRKFGFY-----DDDRESAVWVRQGAPPE------------------------
DGTL1_MYCUA      ----R-ARRKFGFY-----DQDLQPALWVRQGAPQR------------------------
DGTL1_MYCLE      GGLGH-GRSKYGFY-----EEDRDPADWVRVYAPAN------------------------
DGTL1_MYCSK      D------RTKFGFY-----GDDMAAAWWVRDGAPAE------------------------
DGTL1_MYCSS      D------RTKFGFY-----GDDMAAAWWVRDGAPAE------------------------
DGTL1_MYCSJ      D------RTKFGFY-----GDDMAAARWVRDGAPAE------------------------
DGTL1_MYCVP      EG-----RRKFGFY-----GDDMAAAQWVRHGAPAA------------------------
DGTL1_MYCS2      EE-----RRKFGFYV-GFPDDDGPAADWVRDGAPVD------------------------
DGTL1_COREF      SPDGT-INRKYGAY-----DEDAHILEWVRRGHTDL------------------------
DGTL1_CORGL      NADGS-VNKKYSAY-----DEDAEILAWIRQGHEDL------------------------
DGTL1_VIBPA      --SQTRSVKLPNPAE-HQRRLKAKEWSPAKGIYDCDKDLFDWVIAPLSENDKSLLSQMRY
DGTL1_VIBCB      --SQTRAVCLPKPVE-HQRKLKAKDWSPAKGIYDCDKDLFDWVIAPLTDNDKALLSQMRC
DGTL1_VIBVU      --SQTRAASQPAPVS-HQRQIKAKQWSPAKGIYDCDKALFDWVLAPLSETDKQQLNAMRD
DGTL1_VIBVY      --SQTRAASQPAPVS-HQRQIKAKQWSPAKGIYDCDKALFDWVLAPLSETDKQQLNAMRD
DGT1A_VIBCH      --SATRAAIPPPAVA-HQRQLKAKDWSPAKGIYDCDLASLDWVLEPLCESDRELLGQMRA
DGTL1_ALIF1      --DQVHSTERPQEVT-NVRHLKSIDWHPPKGVYRDDADILNWILKPLSDVDKALFSTFRF
DGTL1_SHEON      --SSLFIAGNHHEIT-NHRQLKPSQWPPVKGIFDDDNDIFDWVLEPLSAADRTRFTSAQP
DGTL1_HAEIE      VASPQYAELNFSRNI-DPRFVRIHDWIPGKGIFRDDLKMFNWLLENLSENDRTLFGKFKK
DGTL1_HAEIG      VASPQYAELNFSRNI-DARFVRIHDWIPGKGIFRDDLKMFNWLLENLSENDRTLFCQFKK
DGTL1_HAEI8      VASPQYAELNFSRNI-DPRFVRIHDWIPGKGIFRDDLKMFNWLLENLSENDRTLFCQFKK
DGTL1_PASMU      ISSAQYAKLAPELNA-DSRYVKMNGWRPGKGLFRDDLPMFEWLLEPLSVKDRDLFGQFKQ
DGT1B_DEIRA      ---SNSMTNDFRRGT-DIDKYPDAELKPPKCIYDCDLDVLDWVLKIFCSEDVTEFKKLDY
DGT1B_VIBCH      QNNKK--------------FLYDADYEFLKTELDSKG-----------------------
DGT1B_RHILO      AIRKAADGFVKGYYGSEKIIVDRVKASVLNGYVLGAEE----------------------
                                                                             

DGTL1_BRASO      ------------YASLEAQVAALADDIAYDAHDIDDGLRAGLFTVDDLKEV--PLLAAII
DGTL1_BRASB      ------------YASLEAQIAALSDDIAYDAHDIDDGLRAGLFTVDDLREV--PLLEAMI
DGTL1_BRADU      ------------FASLEAQVAAIADDIAYDAHDIDDGLRAGLFDLDDLKAM--PLTAAII
DGTL1_NITHX      ------------FASLEAQVAAIADDIAYDAHDIDDGLRAGLFAVDDLKAM--PLTAAMI
DGTL1_RHOPB      ------------HASLEAQVAGIADDIAYDAHDIDDGLRAGLFGVDDLGEM--PLTAQMT
DGTL1_RHOP2      ------------FASLEAQVAALADDIAYDAHDIDDGLRAGLFRVDDLRAV--PLTAALI
DGTL1_RHOPS      ------------FASLEAQVAAIADDIAYDAHDIDDGLRAGLFRVDDLRAV--PLTASII
DGTL1_AZOC5      ------------HAGPEAQVAAISDDIAYDVHDLDDGLRAGLFHLDELEAL--PLVGAVL
DGTL1_PARL1      ------------YAGPEAQVAALADDIAYNNHDIDDGLRAGLFDIEDLMAL--PLVGDVF
DGTL1_CAUVC      ------------WASAEAQVAALADDIAYNNHDVDDGVTAGLFTLDDLMDV--PLIGPIL
DGTL1_RHIEC      ------------YASLEAQVAAIADDIAYNTHDIDDGLRSGYLTFDMLEEI--PFLAGLM
DGTL1_RHIL3      ------------YASLEAQVAAIADDIAYNTHDIDDGLRSGYLTFDMLEEI--PFLAGLM
DGTL1_AGRFC      ------------YASLEAQVAAIADDIAYNTHDIDDGLRAGYLTFEMLEEV--PFLSKLM
DGTL1_SINMW      ------------FASLEAQVAAIADDIAYNTHDIDDGLRAGYLTFEMLEEI--PFLARLM
DGTL1_RHIME      ------------FASLEAQVAAIADDIAYNTHDIDDGLRAGYLTFEMLEEI--PFLARLM
DGTL1_BRUME      ------------FASLEAQCAAIADDIAYNAHDIDDGLRAGLLTLESLDEV--PLAKRLL
DGTL1_BRUC2      ------------FASLEAQCAAIADDIAYNAHDIDDGLRAGLLTLESLDEV--PLAKRLL
DGTL1_BRUSU      ------------FASLEAQCAAIADDIAYNAHDIDDGLRAGLLTLESLDEV--PLAKRLL
DGTL1_BRUO2      ------------FASLEAQCAAIADDIAYNAHDIDDGLRAGLLTLESLDEV--PLAKRLL
DGTL1_BRUAB      ------------FASLEAQCAAIADDIAYNAHDIDDGLRAGLLTLESLDEV--PLAKRLL
DGTL1_BRUA2      ------------FASLEAQCAAIADDIAYNAHDIDDGLRAGLLTLESLDEV--PLAKRLL
DGTL1_BRUSI      ------------FASLEAQCAAIADDIAYNAHDIDDGLRAGLLTLESLDEV--PLAKRLL
DGTL1_OCHA4      ------------FASLEAQCAAIADDIAYNAHDIDDGLRAGLLSLDALDEV--PLTKRLL
DGT1A_RHILO      ------------FAGIEAQCAAIADDIAYNTHDIDDGLRAGLLTLDMLKTV--SLPGKIL
DGTL1_BARHE      ------------FAGLEAQCAAIADDIAYNAHDVDDGLRSQFLTLDQFEQV--SLTAALL
DGTL1_BARQU      ------------FAGLEAQCAAIADDIAYNAHDIDDGLRSQFLTLGQFEQV--SLTAVLL
DGTL1_BART1      ------------FAGLEAQCAAIADDIAYNAHDIDDGLRSQFLTLDQFEHV--PLTAAIL
DGTL1_ZYMMO      ------------WPSLEAQVAALSDDIAYDNHDLDDGLRAGLIDLEEVVAQ--PLIAPTW
DGTL1_RICRS      ------------YASAEAQIAALADDISYISHDLEDSIGAKIIDFNSLAEL--KYIDQHV
DGTL1_RICRO      ------------YASAEAQIAALADDISYISHDLEDSIGAKIIDFNSLAEL--KYIDQHV
DGTL1_RICCN      ------------YASAEAQIAALADDISYISHDLEDSIGAKIIDFHSLAEL--KYIDQHV
DGTL1_RICFE      ------------YASAEAQIAALADDISYISHDLEDSIGAKIIDFNSLAEL--KYIDQHV
DGTL1_RICAH      ------------YASAEAQIASLADDISYISHDLEDSIGAKIIDFNSLAEL--KYIDQHV
DGTL1_RICCK      ------------YASAEAQIAALADDISYISHDLEDSIGAKIIDFNSLAEL--KYIDQYV
DGTL1_RICB8      ------------YASAEAQIAALADDISYISHDLEDSIGAKIIDFNNLAEL--KYIDQHV
DGTL1_RICBR      ------------YASAEAQIAALADDISYISHDLEDSIGAKIIDFNNLAEL--KYIDQHV
DGTL1_RICPR      ------------YASAEAQVASLADDISYISHDLEDSIGAKIIDFDSLAEL--QYIDNYV
DGTL1_RICTY      ------------YASAEAQIASLADDISYISHDLEDSIIAKIIDFNNLAEL--QYIDNYV
DGTL1_CLOPE      ----------------EGQVVRFADKIAYVNHDIDDSIRAGILKEDDLPKNIIEILGASG
DGTL1_CLOTE      --------------TLEGQVVKYSDKIAYVNHDIDDSIRAGLLHESDLPKDLINVLGRNH
DGTL1_CALS4      --------------TLEGQVVQISDKIAYINHDIDDAIRGRVLKPEDLPKDLIAILGDKH
DGTL1_SYNAS      ------------QASLEAQVVNIADPLAYCAHDLEDALNAGYLRMKDLRNMENPLVRRVF
DGTL1_LEPBL      ------------GPSLEGMIADLSDEIAYTSHDIEDGWEMGYLHLGDLSEN--PFWKEVY
DGTL1_LEPBJ      ------------GPSLEGMIADLSDEIAYTSHDIEDGWEMGYLHLGDLSEN--PFWKEVY
DGTL1_LEPIC      ------------GPSLEGMIADLSDEIAYTNHDIEDGWEMGYLHLGDLLEN--PFWKEVY
DGTL1_LEPIN      ------------GPSLEGMIADLSDEIAYTNHDIEDGWEMGYLHLGDLLEN--PFWKEVY
DGT1A_DEIRA      -------------PSLEAQVVDAADALAYTAHDLDDGLRSGLLHPEDLLEL--PLWRELQ
DGTL1_DEIGD      -------------PSLEAQLVDAADALAYTAHDLDDGLRSGLLTPQQLETL--PLWRELL
DGTL1_RALSO      ------------QPSLEAQLANLADEVAYNNHDIDDGLRSGLITLEQLEGV--PLWARHR
DGTL1_THIDA      ------------QPSLEAQVANLADEIAYNNHDVDDGLRSGLITLEQLSEV--TIFGRHL
DGTL1_BORPE      ------------QPSLEAQLANLADEVAYNNHDVDDGLRSGLITLEQLQEV--GIFARHY
DGTL1_BORBR      ------------QPSLEAQLANLADEVAYNNHDVDDGLRSGLITLEQLQEV--GIFARHY
DGTL1_BORPA      ------------QPSLEAQLANLADEVAYNNHDVDDGLRSGLITLEQLQEV--GIFARHY
DGTL1_AZOSB      ------------QPSLEAQLANLADEIAYSNHDVDDGLRSGLITLEQLDSI--DVFAEHR
DGTL1_NITEC      ------------SASLEAQLANLADEIAYNNHDVDDGVRSGLITQAQLEEI--EIFARHL
DGTL1_NITEU      ------------SASLEAQLANLADEIAYNNHDVDDGLRSGLITLAQLEEI--EIFARHL
DGTL1_GEOSL      ------------VPTIEAQIINFADEIAYNNHDIDDGLKSGYITIEQLNGV--DLWREVW
DGTL1_WOLSU      ------------HPSLEAIVVDHADEIAYVSHDIDDGIKYGLIRLEDLEES--ELVGEMI
DGTL1_STRCO      ------------RTCFEAQVMDWADDVAYSVHDVEDGLHAGHIDPNCLLAD--PEREAVF
DGTL1_STRAW      ------------RTCFEAQVMDWADDVAYSVHDVEDGLHAGHIDPNCLHAE--PERQAVF
DGTL1_MYCA1      ------------RMCLEAQVMDWADDVAYSVHDVEDGVVSQRIDLRVLADD--DEAAALA
DGTL1_MYCPA      ------------RMCLEAQVMDWADDVAYSVHDVEDGVVSQRIDLRVLADD--DEAAALA
DGTL1_MYCTA      ------------RACLEAQVMDWADDVAYSVHDVEDGVVSERIDLRVLAAE--EDAAALA
DGTL1_MYCTU      ------------RACLEAQVMDWADDVAYSVHDVEDGVVSERIDLRVLAAE--EDAAALA
DGTL1_MYCBO      ------------RACLEAQVMDWADDVAYSVHDVEDGVVSERIDLRVLAAE--EDAAALA
DGTL1_MYCBP      ------------RACLEAQVMDWADDVAYSVHDVEDGVVSERIDLRVLAAE--EDAAALA
DGTL1_MYCUA      ------------RPCLEAQVMDWADDVAYSVHDVEDGVVSERIDLRVLADH--DEAAALA
DGTL1_MYCLE      ------------RACLEAQVMDWADDVAYSVHDVEDGVVSQRIDLRVLADE--YETAALA
DGTL1_MYCSK      ------------RPCLEAQVMDWADDVAYSVHDVEDGVVSGRIDLRVLADD--DAAASLA
DGTL1_MYCSS      ------------RPCLEAQVMDWADDVAYSVHDVEDGVVSGRIDLRVLADD--DAAASLA
DGTL1_MYCSJ      ------------RPCLEAQVMDWADDVAYSVHDVEDGVVSGRIDLRVLADD--DAAASLA
DGTL1_MYCVP      ------------RPCLEAQVMDWADDVAYSVHDVEDGVISGRIDLRVLADA--DAAASLA
DGTL1_MYCS2      ------------RPCLEAQVMDWADDVAYSVHDVEDGVISGRIDLRVLADA--DAAESLA
DGTL1_COREF      ------------RPSLEAQTMDFSDDIAYSVHDVEDGIVAGRIDLKVLWDL--VELAALA
DGTL1_CORGL      ------------RPPIEAQVMDFSDDIAYSVHDVEDGIVSGRIDLKVLWDL--VELAALA
DGTL1_VIBPA      RPDSDLEHSKTRFKSLDCSIMELADDIAYGVHDLEDAIVLGMVTRQQWQEGAASQLADCG
DGTL1_VIBCB      RPESDFEHCKTRFKSLDCSIMELADDIAYGVHDLEDAIVLGMVTRQQWQEGAASQLADCG
DGTL1_VIBVU      CPHDALSHRKTRYKSLDCSIMELADDIAYGVHDLEDAIVLGLVTRSQWQEGAASQLADCG
DGTL1_VIBVY      CPHDALSHRKTRYKSLDCSIMELADDIAYGVHDLEDAIVLGLVTRSQWQEGAASQLADCG
DGT1A_VIBCH      EPSSPKEHRKTRFKSLDCSIMELADDIAYGVHDLEDAIVLGMVTRAQWQEAAAAQLAECG
DGTL1_ALIF1      QQDSQNTHRKTRFKSIDCSIMELADDIAYGVHDLEDAIVMGIVTRNQWQESVASKLAECG
DGTL1_SHEON      SIQPNYPHLRTQFKSFDCSIMELADDIAYAVHDLEDAIVMGIVTASQWQQDVAPTFEHSN
DGTL1_HAEIE      VRENPAESLHTRFKSLDCSIMELADDIAYGVHDLEDAIVTGVVNPHQWQ-AAHSALKQIP
DGTL1_HAEIG      VRENPAESLHTRFKSLDCSIMELADDIAYGVHDLEDAIVTGMVNPHQWQ-AAHSALKQIP
DGTL1_HAEI8      VRENPAESLHTRFKSLDCSIMELADDIAYGVHDLEDAIVTGVVNPHQWQ-AAHVALKQIP
DGTL1_PASMU      VRSDPSQILKTKFKSLDCSLMELADDIAYGVHDLEDAIVVGMVNLHQWQ-SALTALKNCP
DGT1B_DEIRA      -------KCKPLHKSLDCSLMETADDIAYTVHDLEDCIKLKLINREMWDAYIKSADYSEA
DGT1B_VIBCH      ---------VTVTKSIDAEIMDLADEIAYAAHDLEDALSFGMISLGEIVHE-----FSIS
DGT1B_RHILO      -----------KFCTIECSIMDLADDIAYSVYDLEDCFKVGFLSPAEMLASDDALLSAVA
                                 :      :* ::*  :*::*      .                 

DGTL1_BRASO      AEIDRHYPSLDDIRRGAELVRELISYLIAAVAG---EAERRIEQAKPVSPHDVRRHAGPL
DGTL1_BRASB      GDIDRHYPGLVDLRRGAELVRELISYLIAAVAA---ESQRRIERAQPMSPHDVRRHAGPL
DGTL1_BRADU      AETSAHYPDLEDVRRGAELVRELISHLIGAVFA---EAQKNLAATKPQSAQDVRQQSRAL
DGTL1_NITHX      ADIARRHPLLDDHRRGAALVRGLISHLITAVVS---EAERRLADARPQSVDEVRRHGQAL
DGTL1_RHOPB      AAIDVRYPGLDPARRGAELVRELISFLIGAAVA---EAERRLIAAQPASVQAVREAGQDL
DGTL1_RHOP2      DGISRRYPALGESRRGAELVRELISHLIGAVTA---ETMRRLGEAAPRSVEDVRHASTAM
DGTL1_RHOPS      DGIARRYPALDESRRGAELVRELISHLIGAVTA---ETMRRLGEAAPRSAEEVRHASSAM
DGTL1_AZOC5      AEVRASWPSLETGRVIHEVMRRLITRFVEDVVR---ETETRARAAKVRSSFDVRMAGAPL
DGTL1_PARL1      QRVMDRYPGLETTRVIHEAVRELIGTMIEDLLS---ETRSRLAEARPRSAADVRAMSRPL
DGTL1_CAUVC      AAVKSERPDLDARLTHLEAVRRMIGAMVDDVMG---ETLHRAAASGVQSADDVRALDHAL
DGTL1_RHIEC      AEVRARYPHLEPSRFTHEIMRRQITRMVEDVIG---VAQQRLSILRPESAADIRAADRVI
DGTL1_RHIL3      AEVRARYPHLEPSRFTHEIMRRQITRMVEDVIG---VAQQRLSLLRPESAADIRAADRVI
DGTL1_AGRFC      AEVRGKYPVLDKERFANEIMRRQITHMVEDVIG---VAQQNLARLKPQSAADIRAADFTV
DGTL1_SINMW      YEVRDRYPGLESSRFTHEIMRRQITAMVEDVIG---VSQRGLADVRPASARDVRCAGRVI
DGTL1_RHIME      REVHDRYPGLESSRFTHEIMRRQITAMVEDVIA---VAQKRLGEVRPESAKDVRCAGRVM
DGTL1_BRUME      DIVRTRYPNLDPVRTGHELVRRQITIMVEDVIE---EAQRRLASARPGTMEDVHNQPRAL
DGTL1_BRUC2      DIVRTRYPNLDPVRTGHELVRRQITIMVEDVIE---EAQRRLASARPGTMEDVHNQPRAL
DGTL1_BRUSU      DIVRTRYPNLDPVRTGHELVRRQITIMVEDVIE---EAQRRLASARPGTMEDVHNQPRAL
DGTL1_BRUO2      DIVRTRYPNLDPVRTGHELVRRQITIMVEDVIE---EAQRRLASARPGTMEDVHNQPRAL
DGTL1_BRUAB      DIVRTRYPNLDPVRTGHELVRRQITIMVEDVIE---EAQRRLASARPGTMEDVHNQPRAL
DGTL1_BRUA2      DIVRTRYPNLDPVRTGHELVRRQITIMVEDVIE---EAQRRLASARPGTMEDVHNQPRAL
DGTL1_BRUSI      DIVRTRYPNLDPVRTGHELVRRQITIMVEDLIE---EAQRRLASARPGTMEDVHNQPRAL
DGTL1_OCHA4      DLVRTRYPDLDPVRTGHELVRRQITIMVEDVIE---EAQRRLAAAKPQSVEDVHGQSHAL
DGT1A_RHILO      EGVRQRYPRLDDVRTGHELMRRQITAMVEDVIV---SATANLERVGPRSADAVRAAGETM
DGTL1_BARHE      NDIKKEHPQLDQTRRGYTLVRRQIKTMVEDVIK---QSQENLARVKPKSISDVHQAEQTI
DGTL1_BARQU      KDIEKEHPQLDKTRRGYELVRRQITTMVEDVIK---QSQENLAHIKPTSISDVQQAEQTI
DGTL1_BART1      KEITDEHPQLDQARCGYTLVRRQITTMIEDVLK---QSHENLARIKPTSINDIYQAKQTI
DGTL1_ZYMMO      QAVKTRYPDLTGKKLIAELIREQIGRMVNDSLD---ETRRRIAFFKPEYLPDIRQMPQAM
DGTL1_RICRS      VELKSKFKNISSSCLIYEVVRKLIHELITDLLW---QTKENLNKEKITNIDEIRNLNYQI
DGTL1_RICRO      VELKSKFKNISSSCLIYEVVRKLIHELITDLLW---QTKENLNKEKITNIDEIRNLNYQI
DGTL1_RICCN      VELKSKFKNISSSCLIYEVVRKLIHELITDLLW---QTKENLNKEKITNIDEIRNLNYQI
DGTL1_RICFE      FEIKTKFKNISSSCLIYEVVRKLIHELITDLLW---QTKENLNKEKITNIDEIRNLNYQI
DGTL1_RICAH      FELKSKFKNISSSCLIYEVVRKLMHELITDLLW---QTKENLNKEKIINIYEIRHLNYQI
DGTL1_RICCK      FALKSKFKNISSSCLIYEVVRKLMHELITDLLW---QTKENLNKEKITDIDEIRNLNYQL
DGTL1_RICB8      FELKSKYKNISSSCLIYEVVRKLMHELITDLLW---QTKTNINKEKITHIDEIRNLNYQI
DGTL1_RICBR      FELKSKYKNISSSCLIYEVVRKLMHELITDLLW---QTKTNINKEKITHIDEIRNLNYQI
DGTL1_RICPR      FELKAKFKDISPSCLIYEVVRKLIHELITDLLW---QTKENLNKEKITNIDEIRNLHYPI
DGTL1_RICTY      FKLKSKFKDISPSCLIYEIVRKLIHELITDLLL---QTKENLKKEKITNINEIRNLHYQI
DGTL1_CLOPE      S-----------------------------------ERIDTLVKDCVFNTIDNIDKGEPR
DGTL1_CLOTE      S-----------------------------------DRIDTLVKDCINKTLENIKLGTIE
DGTL1_CALS4      G-----------------------------------KRIDTMVRDVIYNSM-----GKPE
DGTL1_SYNAS      ERCSSRYPDFLKADTVLQSRILVRTLIEEANIAVIRQTSRNIELYGISSVEEARSLPEDV
DGTL1_LEPBL      EECKEQYKDVGEKILVRTAIRTLTNSMVSDLIQNISLQLETNQVKSTEDLIRLWKQGIRI
DGTL1_LEPBJ      EECKEQYKDVGEKILVRTAIRTLTNSMVSDLIQNISLQLETNQVKSTEDLIRLWKQGIRI
DGTL1_LEPIC      EECKDQYKEVGEKILIRTSIRTLTNFLVSDLIQNIAHRLEKKQIKSTEDLALLWKQDFRI
DGTL1_LEPIN      EECKDQYKEVGEKILIRTSIRTLTNFLVSDLIQNIAHRLEKKQIKSTEDLALLWKQDFRI
DGT1A_DEIRA      ERSGVTSQRPSSADLRTLQRELLGWLIGDLTR----SSDAAIAASGVASPDAVQAHAHRL
DGTL1_DEIGD      ARVPVQSPQLTERDRRTLHRELLGWLIEDLTT----ASEAAIRARGVTSAAEVRALPERL
DGTL1_RALSO      REAEAAFPGVGGRRMINETIRRIINALIVDLIA---GTRAAITGAAPQSIDDVRAA-PPL
DGTL1_THIDA      AEVRRKHPTLQGRRVVTETVRRIINALILDLVD---TTRTNVVNSGVETLDDVRNA-PPL
DGTL1_BORPE      AEVARRYPQLAPRRATSETIRRMINTLIVDLTA---TSLARIRDHAPASADDVRRA-PPL
DGTL1_BORBR      AEVARRYPQLAPRRATSETIRRMINTLIVDLTA---TSLARIRDHAPASADDVRRA-PPL
DGTL1_BORPA      AEVARRYPQLAPRRATSETIRRMINTLIVDLTA---TSLARIRDHAPASADDVRRA-PPL
DGTL1_AZOSB      RAVQSRWPGLAGRKLISETVRSMVNAMALDLIA---QTRANIADAGVRTVDDVRAG-PRL
DGTL1_NITEC      HQVKQHYPDIAGRRLVHETVRGMINTLATDLTT---QSKVHIEAANPNSPDNVREM-PTL
DGTL1_NITEU      HQVKQHYPDITGRRLIHETVRGMINTLVVDLTV---QSGTRIRDASPDSPDSVREK-PVL
DGTL1_GEOSL      ERIDTAHPGLDRERKKFQTISALIGLLIRDLIT---ATEANLRAYGVSTLDDVRRVNRPL
DGTL1_WOLSU      DKAEQEGVKRSEKVFRYRFVSNLINHLVYGFLE---GSQEARLHQGEVRSAMIPSGERLP
DGTL1_STRCO      DAAVGRFVPAGTDHAELAAALDRLLAQDWWPHGYDGSAPAQARLKDATSQLIGRFCLAAE
DGTL1_STRAW      AVAIGRYVPADTDPAELAEALDRLLDQEWWPHGYDGSAVAQARLKDATSQLIGRFCLAAE
DGTL1_MYCA1      KLGESEFSRVGADDFMAAARRLSALPVVAAVGKYDATLASSVALKRLTSELVGRFASAAI
DGTL1_MYCPA      KLGESEFSRVGADDFMAAARRLSALPVVAAVGKYDATLASSVALKRLTSELVGRFASAAI
DGTL1_MYCTA      RLGEREFSRVSADELMAAARRLSRLPVVAAVGKYDATLSASVALKRLTSELVGRFASAAI
DGTL1_MYCTU      RLGEREFSRVSADELMAAARRLSRLPVVAAVGKYDATLSASVALKRLTSELVGRFASAAI
DGTL1_MYCBO      RLGEREFSRVSADELMAAARRLSRLPVVAAVGKYDATLSASVALKRLTSELVGRFASAAI
DGTL1_MYCBP      RLGEREFSRVSADELMAAARRLSRLPVVAAVGKYDATLSASVALKRLTSELVGRFASAAI
DGTL1_MYCUA      KLGESEFSRVSADELMEAAGRLSGLPVVAAVGKYDATLAASVALKQLTSELVGRFASAAI
DGTL1_MYCLE      KLGEGEFSWVTADELMAAAHRLSELPVVAAVGKYDATLASSVALKRLTSELVGRFASVAI
DGTL1_MYCSK      RLGAEAFPTLAPDDLLAAAERLSQMPVVSQVGKYDGTLGASVALKRMTSELVGRFANAAI
DGTL1_MYCSS      RLGAEAFPTLAPDDLLAAAERLSQMPVVSQVGKYDGTLGASVALKRMTSELVGRFANAAI
DGTL1_MYCSJ      RLGAEAFPTLAPDDLLAAAERLSQMPVVSQVGKYDGTLGASVALKRMTSELVGRFANAAI
DGTL1_MYCVP      HVGAQSFPTLTPDDLVAAAERLSQVPVVAAVGKFDGTLSASVALKTLTSELVGRFANAAL
DGTL1_MYCS2      QLGAAAFPSLAHDDLLAAAQRLSEMPVVAAVGKYDGTLAASVALKRLTSELVGRFANAAI
DGTL1_COREF      QKGARAFGG-DPEELIEGAATLRELPVVAAAADFDASLSSYAALKAMTSELVGRYVGSTI
DGTL1_CORGL      DKGAAAFGG-SPAELIEGAASLRELPVVAAAADFDFSLRSYAALKAMTSELVGRYVGSTI
DGTL1_VIBPA      DPWFEEHIGSIGQMLFSGKHHQRKDAIGGMVNALLTSISIKVV----DEPFQNPLLAWNA
DGTL1_VIBCB      DAWFEEHIGSIGQMLFSGKHHERKDAIGGMVNALLTSISIKVV----DEPFSNPLLAWNA
DGTL1_VIBVU      DPWFEKHISSIGEMLFSGQHHQRKDAIGGMVNALLTSIDVKPV----DGEFESPLLAFNA
DGTL1_VIBVY      DPWFEKHISSIGEMLFSGQHHQRKDAIGGMVNALLTSIDVKPV----DGEFESPLLAFNA
DGT1A_VIBCH      DPWFEEHIAELSEMLFSGKHYVRKDAIGGIVNALLTSISVKPV----EAPFHNELLAFNA
DGTL1_ALIF1      DEWFEANIETISDKLFSGLQYQRKDGIGSIVNALLTSITIKPTTFNDEAEFESELLRWNA
DGTL1_SHEON      DPWIRQELADIGTKLFSHEHHLRKDAIGTLVNGFVTAIIITDD-----GVFEEPLLRFNA
DGTL1_HAEIE      SAWLQENIDSISQRLFSDKHFERKQAIGALVNFFITNVRWKLT-----ANFDEPLLRYNA
DGTL1_HAEIG      SAWLHENIDSISQRLFSDKHFERKQAIGALVNFFITNVRWKLT-----ANFDEPLLRYNA
DGTL1_HAEI8      SAWLHENIDSISQRLFSDKHFERKQAIGALVNFFITNVRWKLT-----ANFDEPLLRYNA
DGTL1_PASMU      SEWIQKHIDAITEKLFSDQHYLRKNAIGALVNYFITSVRWTLT-----DDFNEPLLRYNA
DGT1B_DEIRA      T---RLEIEKWNQRIFSKEGNLVKQGISNMVYFFIHSVIQYEH-----EELSHPILKYGF
DGT1B_VIBCH      DKFKDAYPTMTDIAKEAQNVAMKASRSGTSEEYAIVLKKELTSMIVNILCSDIGLVDGCL
DGT1B_RHILO      KRASKPMKRTVTINEIQAVFMEIFSEIIEQPAEDADSPLDGIVIEDDIAQQAKRDESLLT
                                                                             

DGTL1_BRASO      VAFPADVA----------------------------------------------EHEATI
DGTL1_BRASB      VAFPADVA----------------------------------------------EHEATI
DGTL1_BRADU      IAFPADVA----------------------------------------------EEEAAI
DGTL1_NITHX      IAFPPAAA----------------------------------------------EAEALI
DGTL1_RHOPB      IMFAPDAA----------------------------------------------EAEALI
DGTL1_RHOP2      VAFPSETA----------------------------------------------VAEAEI
DGTL1_RHOPS      VAFPIETA----------------------------------------------AAEAEI
DGTL1_AZOC5      VAFSAGMR----------------------------------------------TAEAAV
DGTL1_PARL1      VGFTAEMT----------------------------------------------EHNAAL
DGTL1_CAUVC      VAFSSDMA----------------------------------------------EDLARL
DGTL1_RHIEC      ATFSDAMA----------------------------------------------ETDRQI
DGTL1_RHIL3      ATFSEGMA----------------------------------------------ETDRQI
DGTL1_AGRFC      ATFSPEMA----------------------------------------------ETDRQI
DGTL1_SINMW      ATFSDEMS----------------------------------------------ETDRQI
DGTL1_RHIME      ATFSDEMS----------------------------------------------ETDRQI
DGTL1_BRUME      VGFSDAMR----------------------------------------------AEEKVL
DGTL1_BRUC2      VGFSDAMR----------------------------------------------AEEKVL
DGTL1_BRUSU      VGFSDAMR----------------------------------------------AEEKVL
DGTL1_BRUO2      VGFSDAMR----------------------------------------------AEEKVL
DGTL1_BRUAB      VGFSDAMR----------------------------------------------AEEKVL
DGTL1_BRUA2      VGFSDAMR----------------------------------------------AEEKVL
DGTL1_BRUSI      VGFSDAMR----------------------------------------------AEEKVL
DGTL1_OCHA4      VAFSDTMR----------------------------------------------TDEKVL
DGT1A_RHILO      VTFSAEMA----------------------------------------------AAEKEL
DGTL1_BARHE      VTFSPTMA----------------------------------------------VYEREL
DGTL1_BARQU      VTFSPTMA----------------------------------------------VYEKEL
DGTL1_BART1      VTFSPSMT----------------------------------------------VYEKEL
DGTL1_ZYMMO      VGFSDEMT----------------------------------------------KNERLF
DGTL1_RICRS      VDFTEKTN----------------------------------------------KNIKET
DGTL1_RICRO      VDFTEKTN----------------------------------------------KNIKET
DGTL1_RICCN      VDFTEKTN----------------------------------------------KNIKET
DGTL1_RICFE      VDFTEKTN----------------------------------------------ERIKET
DGTL1_RICAH      VDFTEKTN----------------------------------------------DRIKET
DGTL1_RICCK      VDFTANTN----------------------------------------------ERIKET
DGTL1_RICB8      VDFTEKTN----------------------------------------------ERIKEI
DGTL1_RICBR      VDFTEKTN----------------------------------------------ERIKEI
DGTL1_RICPR      VDFTEKTN----------------------------------------------ERINEI
DGTL1_RICTY      VDFTEKTN----------------------------------------------ERINET
DGTL1_CLOPE      VSLSKEIG----------------------------------------------DAFVQL
DGTL1_CLOTE      VGMSEKIE----------------------------------------------IALKEL
DGTL1_CALS4      VSMSKEIY----------------------------------------------EATYQL
DGTL1_SYNAS      VAAPAGVW----------------------------------------------KNFDAL
DGTL1_LEPBL      ASFSERVD----------------------------------------------SKFREL
DGTL1_LEPBJ      ASFSERVD----------------------------------------------SKFREL
DGTL1_LEPIC      ASFSKEVD----------------------------------------------LKFREL
DGTL1_LEPIN      ASFSKEVD----------------------------------------------LKFREL
DGT1A_DEIRA      VTYSPALR----------------------------------------------GHLRGA
DGTL1_DEIGD      ITYSAPMR----------------------------------------------ELLHET
DGTL1_RALSO      VAFSEPMR----------------------------------------------DEARVL
DGTL1_THIDA      AAFSPAIL----------------------------------------------EQHREL
DGTL1_BORPE      AGFSAAVR----------------------------------------------READEL
DGTL1_BORBR      AGFSAAVR----------------------------------------------READEL
DGTL1_BORPA      AGFSAAVR----------------------------------------------READEL
DGTL1_AZOSB      VAYSSSLQ----------------------------------------------PRLRAL
DGTL1_NITEC      VGFSDTIR----------------------------------------------QQQQEL
DGTL1_NITEU      IGFSDTIK----------------------------------------------RQQQEL
DGTL1_GEOSL      VTFSSAME----------------------------------------------ERNRSL
DGTL1_WOLSU      LGFSPEMG----------------------------------------------RKLKKL
DGTL1_STRCO      AATRAAY--GDGR--------------------------LTRYAAELVVPRETRMECAVL
DGTL1_STRAW      GATRAAY--GSGR--------------------------LTRYAAELVVPRAARLECAVL
DGTL1_MYCA1      ATTRAAA--GPGP--------------------------LVRYRAELAVPDLVRAEVALL
DGTL1_MYCPA      ATTRAAA--GPGP--------------------------LVRYRAELAVPDLVRAEVALL
DGTL1_MYCTA      ATTRAAA--GPGP--------------------------LVRFRADLQVPDLVRAEVAVL
DGTL1_MYCTU      ATTRAAA--GPGP--------------------------LVRFRADLQVPDLVRAEVAVL
DGTL1_MYCBO      ATTRAAA--GPGP--------------------------LVRFRADLQVPDLVRAEVAVL
DGTL1_MYCBP      ATTRAAA--GPGP--------------------------LVRFRADLQVPDLVRAEVAVL
DGTL1_MYCUA      ATTRAAA--GPGP--------------------------LVRYQADLHVPELVRAEVAVL
DGTL1_MYCLE      ATTRAVA--GPGP--------------------------LVRYQADLQVPDLVRAEVAVL
DGTL1_MYCSK      TETRSVA--GGGA--------------------------LHRFVTELAVPTLVRAEVAVL
DGTL1_MYCSS      TETRSVA--GGGA--------------------------LHRFVTELAVPTLVRAEVAVL
DGTL1_MYCSJ      TETRSVA--GGGA--------------------------LHRFDTELAVPTLVRAEVAVL
DGTL1_MYCVP      TATRDVA--GPGP--------------------------LRRFDAELTVPSLVRAEVVLL
DGTL1_MYCS2      TETRAVA--GDRP--------------------------LKRFDSDLVVPDLVRAEVAVL
DGTL1_COREF      AATRAAARLGEYE--------------------------FGRMHGELVIRPEADREVRLL
DGTL1_CORGL      ESTKKTH--AGID--------------------------VGRMHGDLIIPETAASEVKLL
DGTL1_VIBPA      CLEPHMAK-----------------------------------------------ALDVL
DGTL1_VIBCB      CLEPQMAK-----------------------------------------------ALEVL
DGTL1_VIBVU      YLDIGMEK-----------------------------------------------ALSIL
DGTL1_VIBVY      YLDIGMEK-----------------------------------------------ALSIL
DGT1A_VIBCH      YIEPHMGN-----------------------------------------------ALEVL
DGTL1_ALIF1      FLSPSMSY-----------------------------------------------ALEVL
DGTL1_SHEON      SLEVEFAH-----------------------------------------------ALNVL
DGTL1_HAEIE      ELSPEVIV-----------------------------------------------ALGVF
DGTL1_HAEIG      ELSPEVIV-----------------------------------------------ALGVF
DGTL1_HAEI8      ELPPEVIA-----------------------------------------------ALGVF
DGTL1_PASMU      QLPAEVEA-----------------------------------------------VLQIF
DGT1B_DEIRA      KLGEEAAR-----------------------------------------------LRSAI
DGT1B_VIBCH      GYKRHAKL------------------------------------------------AEGL
DGT1B_RHILO      FAEAYRTSKVMSEDGYKRTEFSSELVHQFISGVELKAHKECPSLSQIYLPEKLMLRKEVL
                                                                             

DGTL1_BRASO      KAFLWQRMYRHERVMRVMRDAERIVADLFGRYQQDGATLPAGWL--DGCGG--E-GERAR
DGTL1_BRASB      KRFLWQRMYRHERVMRVMRDAERIVADLFGRYQADPASLPAGWL--EGCDS--E-GDRAR
DGTL1_BRADU      KRFLYQHMYRHKRVMRVMGEAKQILFDLFAKYLKSPAELPPEWL--TGAEADNE-GDRAR
DGTL1_NITHX      KAFLKQRMYRHPRVMRVMGEAETIVRDLFARYRDDPAALPAEWLPEDGESRELD-AERAR
DGTL1_RHOPB      KAFLKRHMYRHPRVMRVMDDAETVVFELFARYRDHPADLPAEWLPANAGQGETE-ADRLR
DGTL1_RHOP2      KAFLWTHMYRAERVMAVMRDAEAIVADLFRRYCEHPADLPPDWLPADGPVAECE-ADRFR
DGTL1_RHOPS      KAFLWTHMYRANRVMAVMRDAEAIVADLFQRYCDHPADLPPDWLPTDGPVAECE-ADRLR
DGTL1_AZOC5      KGFLFPHMYRHARVNRIMDEAQGVVRDLFALFMARPQEMPADWQLEGAPPE-----RMAR
DGTL1_PARL1      KAFLFERMYRHYRVNRSMSKAQRIVRDLFSLLHGEPDQLAPEWQ--AGCDGPGG-IKTAR
DGTL1_CAUVC      RGFLYERMYRHWRVNRTRSQARRILGEMFALFLREPEVLPTVWFAKSQNRD--E-AGRAR
DGTL1_RHIEC      KALLFKRIYRNPDIMRIRAGAAQIVTDLFAAYMASPKEMQSHYWVDHIAGLA-D-APKAR
DGTL1_RHIL3      KAMLFKRIYRNPDIMRIRAGAAQIVTDLFAAYMANPKEMQSHYWVDHIAGLS-D-APKAR
DGTL1_AGRFC      KKLLFGHIYRHPEIMRIRAGATQIVTDLFHRYMETPAEMQSHYWVDSISGMS-V-AAKAR
DGTL1_SINMW      KNLLMTRIYRHPEVMRVREGAASIVTDLYRAFMDDPSLMKEHYWIDQIAGME-E-PARAR
DGTL1_RHIME      KNLLMTRIYRHPEVMRVRQGAASIVTDLYRAFMDDPSLMKEHYWIDQIAGMA-E-PARAR
DGTL1_BRUME      KRFLFKNLYFHESVVVRRHAADRIVQDLFDACFTDPSLMPDE-WRLGCEALD-K-AALAR
DGTL1_BRUC2      KRFLFKNLYFHESVVVRRHAADRIVQDLFDACFTDPSLMPDE-WRLGCEALD-K-AALAR
DGTL1_BRUSU      KRFLFKNLYFHESVVVRRHAADRIVQDLFDACFTDPSLMPDE-WRLGCEALD-K-AALAR
DGTL1_BRUO2      KRFLFKNLYFHESVVVRRHAADRIVQDLFDACFTDPSLMPDE-WRLGCEALD-K-AALAR
DGTL1_BRUAB      KRFLFKNLYFHESVVVRRHAADRIVQDLFDACFTDPSLMPDE-WRLGCEALD-K-AALAR
DGTL1_BRUA2      KRFLFKNLYFHESVVVRRHAADRIVQDLFDACFTDPSLMPDE-WRLGCEALD-K-AALAR
DGTL1_BRUSI      KRFLFKNLYFHESVVVRRHAADRIVQDLFDACFTDPSLMPDE-WRLGCEALD-K-AALAR
DGTL1_OCHA4      KRFLFKNLYFHDSVVVRRHAADKILQDLFDTCFANPSIMPSE-WQSGCETLD-E-AARAR
DGT1A_RHILO      KAFLYKHLYRHEEVMRVRAGAEQIVRDLFDVYFADPRAMPDG-WREGLDRAE-D-RIKAR
DGTL1_BARHE      KDFLFKNLYYHDQVLNRRNAAKRIVQKLFECYYENPDVMPEN-WHNKTAHLT-N-QELAR
DGTL1_BARQU      KNFLFKNLYYHDQVLSRRNAAKCIVQKLFDCYYKNPNVMPES-WHSKTAHLT-N-QELAR
DGTL1_BART1      KNFLFENLYYHEQILSRRNAAKCIVQKLFNCYYENPDTMPES-WCQKAVHLK-N-QELAR
DGTL1_ZYMMO      KKFMYQKLYHHPRLLPIAERASYVISRLVALYKDNPRLLPED-WQENWPDNE---VDRQR
DGTL1_RICRS      KKFLHERVYKSNKITAISLKCTKIVQGLFKVYMDDINLLPVNWKMLIDSNET---YSKAR
DGTL1_RICRO      KKFLHERVYKSNKITAISLKCTKIVQGLFKVYMDDINLLPVNWKMLIDSNET---YSKAR
DGTL1_RICCN      KKFLHERVYKSNKITAISLKCTKIVQGLFKVYMDDINLLPVNWKMLIDSNET---YSKAR
DGTL1_RICFE      KKFLHERVYKSNKITAISLKCTKIVQGLFKVYMDDINLLPVNWKMLIDSNET---YSKAR
DGTL1_RICAH      KKFLHERVYKSNKITAISLKCTKIVQGLFKVYMDDINLLPVNWKMLIDSDDT---YSKAR
DGTL1_RICCK      KKFLHERVYKSNKITAISLKCTKIVQGLFKVYMDDINLLPVNWKMLIDSNEI---YSKAR
DGTL1_RICB8      KKFLHERVYKSNRITAISLKCTKIVQGLFKVYMEDVNLLPVNWKIQIDSNNP---NSKAR
DGTL1_RICBR      KKFLHERVYKSNRITAISLKCTKIVQGLFKVYMEDVNLLPVNWKIQIDSNNP---NSKAR
DGTL1_RICPR      KKFLHKRVYESNKMIAISIKCTKIVQGLFKIYMDDINLLPTNWKILIDSNKT---YSKAR
DGTL1_RICTY      KKFLHKRVYESNKMIAISIKCTKIVQGLFKIYMDDINLLPTNWKILIDSNET---YSKAR
DGTL1_CLOPE      RKFLFDNIYLGKYLEDERKKAEFVLEKVIEYYYNNWEEMPDLYRNICEEEG------IHR
DGTL1_CLOTE      RKFMFQRVYKGSILKEERDKAKFVLYQVFNYYLKNSNKMPEFYKNIVEQEG------LYQ
DGTL1_CALS4      RAFLFEKVYIGSKAKRDEEKAKRVVEQLFYYFYDNVDKMPKEFVRLAEIYG------RER
DGTL1_SYNAS      KAYLFENVYRKPQVCIMNEKGKLIIRRIFHHLEKRPEMLPGIFKTRFDEAAD-S-SGKRR
DGTL1_LEPBL      KFFLYEKLYRHEDLVRMSDYGKKVIESLFDYFLKHPEKIPDTYKERIEEES------LYR
DGTL1_LEPBJ      KFFLYEKLYRHEDLVRMSDYGKKVIESLFDYFLKHPEKIPDTYKERIEEES------LYR
DGTL1_LEPIC      KSFLYEKLYRHEDLIRMSDYGKKIIESLFDYFLKHPEKIPDTYKERIEEES------LYR
DGTL1_LEPIN      KSFLYEKLYRHEDLIRMSDYGKKIIESLFDYFLKHPEKIPDTYKERIEEES------LYR
DGT1A_DEIRA      GDFLRERLYRHWQVEREVYQAEQVLTELFGAFLTRPALLPPRPRSRVGRDG------LPR
DGTL1_DEIGD      GLFLREHLYRHWRVEMQVEQAARLLQTLFTAYLARPSMLPPQVRAQAELDG------LPR
DGTL1_RALSO      KRFLFDNLYRHYLVMRMAAKARRIIEDLFRVFLEDPRLLPPQYQARDPADQ-------PR
DGTL1_THIDA      KRFLLHHLYRHYKVARMSTKAGRIISDLYAAFTGDARLLPPEHQARESLEG-------TR
DGTL1_BORPE      KKFLFDNLYRHYRVVRMTTKAQRIVRELFQAFLGDPRLLPPDYRREQPQDQ-------AR
DGTL1_BORBR      KKFLFDNLYRHYRVVRMTTKAQRIVRELFQAFLGDPRLLPPDYRREQPQDQ-------AR
DGTL1_BORPA      KKFLFDNLYRHYRVVRMTTKVQRIVRELFQAFLGDPRLLPPDYRREQPQDQ-------AR
DGTL1_AZOSB      KGFLRENLYWHYQVLRMTDKARRIIGDLFGAFMADPRLLPPQYQEKARTDK-------PR
DGTL1_NITEC      KRFLHKNLYKHYQVMRMSNKAHHIVEKLFSAFAAEPALLPPKYQHKFRDHG-------HQ
DGTL1_NITEU      KRFLHKNLYKHYQVMRMSNKARHTIEKLFTTFETEPALLPYEYQQKFQEYG-------HQ
DGTL1_GEOSL      KRFLFTNLYRHHKVERMRVKAERYLTQLFESYVKHPTLLPRKYQQKMDTLGR------ER
DGTL1_WOLSU      KKLLFTKLYRHEQVNRKMFFGRGCIRALFEDFMNEKNLLPKELQERINQGGK-----AHR
DGTL1_STRCO      KAVAVRYVMQRTEQERLRADQRIVVAELAEALTARAPDGLDPQFRALFDAAADD-RARKR
DGTL1_STRAW      KAVADWYVMQRAEQERLRADQRVVVAELAEALTARAPEGLDPQFWALFDEAADD-RARKR
DGTL1_MYCA1      KILALQFIMSDPRHQQTQAGQRERIHRVAHWLYAGAPRTLDPVFAAAFNTAADD-GARWR
DGTL1_MYCPA      KILALQFIMSDPRHQQTQAGQRERIHRVAHWLYAGAPRTLDPVFAAAFNTAADD-GARWR
DGTL1_MYCTA      KILALQFIMSDPRHLETQARQRERIHRVAHRLYSGAPQTLDPVYAAAFNTAADD-AARLR
DGTL1_MYCTU      KILALQFIMSDPRHLETQARQRERIHRVAHRLYSGAPQTLDPVYAAAFNTAADD-AARLR
DGTL1_MYCBO      KILALQFIMSDPRHLETQARQRERIHRVAHRLYSGAPQTLDPVYAAAFNTAADD-AARLR
DGTL1_MYCBP      KILALQFIMSDPRHLETQARQRERIHRVAHRLYSGAPQTLDPVYAAAFNTAADD-AARLR
DGTL1_MYCUA      KILALQFIMSDPRHLETQARQRERIHRVAQLLYAGAPRTLDPIFAAAFNAAGDD-GARMR
DGTL1_MYCLE      KILALQFIMSDPRHLEGQARQRERIHRVANWLYSGAPSTLDPVFVTAFTTAVDD-NARWR
DGTL1_MYCSK      KMLALQFIMSDHGHLGIQADQRTRIHEVALILWGQAPSSLDPLFAPEFVAAEDD-GARLR
DGTL1_MYCSS      KMLALQFIMSDHGHLGIQADQRTRIHEVALILWGQAPSSLDPLFAPEFVAAEDD-GARLR
DGTL1_MYCSJ      KMLALQFIMSDHGHLGIQADQRTRIHEVALILWGQAPSSLDPLFAPEFVAAEDD-GARLR
DGTL1_MYCVP      KTLALQFIMSDHRHLQIQADQRNRIHEVALALWGQAPGSLDPQFAAEFAAAPDD-GARLR
DGTL1_MYCS2      KMLALQFIMSDHQHLQVQADQRTRIHEVALALWAQAPGSLDPQFAPEFAAAGDD-GARLR
DGTL1_COREF      KTLAVLYVMDDPGHLARQDRQRDRIFRVFDYLTLGAPGSLDPMYRQWFLEADDD-AGRAR
DGTL1_CORGL      KTLAVLYVMDDPGHLARQNRQRDRIFRVFDYLVLGAPGSLDPMYRQWFIEADSE-SEQIR
DGTL1_VIBPA      KHFVSQYVIQVPQVQIVEYKGQQIIMDIFEALSADPERLLPIHTKELWQSATSD-SGKMR
DGTL1_VIBCB      KHFVSKYVIQVHQVQIVEYKGQQIIMDLFEALSADPERLLPTHTQALWQEVANE-SAKMR
DGTL1_VIBVU      KHFVSQYVIQIPQVQIVEYKGQQIIMDLFEALSADPQRLLPLPTRHRWELAETD-TSKMR
DGTL1_VIBVY      KHFVSQYVIQIPQVQIVEYKGQQIIMDLFEALSADPQRLLPLPTRHRWELAETD-TSKMR
DGT1A_VIBCH      KHFVSQYVIQIPQVQRFEYKGQQLIMDLFEALSADPERLLPQATGEKWRKAQEQ-DEGMR
DGTL1_ALIF1      KKFVGQFVIHNSEMQRIEYKGQQIVMEIFDALNSDPERLLPENDKREWREAKESGANAHR
DGTL1_SHEON      KQLVYKYVIRKPEIQMLEYKGQQIVMGLFEAFASDPERLLPLNTQERWRASEQLGLNSHR
DGTL1_HAEIE      KKFVWDYVIRNVDTQRIEYKGQRMLTEMFQIFESDPERLLPRNTANRWRNAPEE--RKKR
DGTL1_HAEIG      KKFVWDYVIRNVDTQRIEYKGQRMLTEMFQIFESDPERLLPRNTANRWRNAPEE--RKKR
DGTL1_HAEI8      KKFVWDYVIRNVDTQRIEYKGQRMLTEMFQIFESDPERLLPRNTENRWRNAPKE--GKKR
DGTL1_PASMU      KAFVRDHVILNVDTQRIEYKGQRILTEMFQIFESDPERLLPRNTAKRWQQASKE--SKKR
DGT1B_DEIRA      QKIITNEVIKTHRVRVLESKGQRMIFSIFGELVRDPESFLPRETLDKYNKATGN--LRMR
DGT1B_VIBCH      KKLLFKAILRKKDIQLYERRGEQIIRGLFEVYSDEKYNKDNMLLPPELRAINDC---KTR
DGT1B_RHILO      KQYTFVAAIYAPRVKLGEYRGYDLVTDIFKALMGDRGDLLMPADVRGRIRKAPNVSVKAR
                                         :  :                               :

DGTL1_BRASO      RISHFIAGMTDRFALTEHHRLFDSTPDLR--------
DGTL1_BRASB      RIGHFIAGMTDRFALTEHHRLFDSTPDLR--------
DGTL1_BRADU      RIGNFIAGMTDRFALTEHQRLFDSTPDLR--------
DGTL1_NITHX      RIGNFIAGMTDRFAITEHRRLFDSTPELR--------
DGTL1_RHOPB      RICNFIAGMTDRYALTEHQRLFDLTPELR--------
DGTL1_RHOP2      RIRNFIAGMTDRYALTEHQRLFDSTPDLR--------
DGTL1_RHOPS      RIRNFIAGMTDRYALTEHQRLFDSTPDLR--------
DGTL1_AZOC5      RVADYIAGMTDRYALDQHARFFDTTPELR--------
DGTL1_PARL1      RVCDFIAGMTDKFAIEEHARLFDLHDPRA--------
DGTL1_CAUVC      VVCDYIAGMTDRFAIEEHRKLFHLDVWN---------
DGTL1_RHIEC      HVGDYLAGMTDTYAISAHRRLFDHTPDLR--------
DGTL1_RHIL3      HVGDYLAGMTDTYAISAHRRLFDHTPDLR--------
DGTL1_AGRFC      HVGDYLAGMTDSYALRAHQRLFDHTPDLR--------
DGTL1_SINMW      HVGDYLAGMTDTFAISVHRRLFDHTPDLR--------
DGTL1_RHIME      HVGDYLAGMTDTFAISVHRRLFDHTPDLR--------
DGTL1_BRUME      RVADYLAGMTDNYAVREHRRLFDRTPDLA--------
DGTL1_BRUC2      RVADYLAGMTDNYAVREHRRLFDRTPDLA--------
DGTL1_BRUSU      RVADYLAGMTDNYAVREHRRLFDRTPDLA--------
DGTL1_BRUO2      RVADYLAGMTDNYAVREHRRLFDRTPDLA--------
DGTL1_BRUAB      RVADYLAGMTDNYAVREHRRLFDRTPDLA--------
DGTL1_BRUA2      RVADYLAGMTDNYAVREHRRLFDRTPDLA--------
DGTL1_BRUSI      RVADYLAGMTDNYAVREHRRLFDRTPDLA--------
DGTL1_OCHA4      RVADYLAGMTDNYAVREHRRLFDHTPDLA--------
DGT1A_RHILO      SVADFLAGMTDTYALKEHRRLFDRTPDLS--------
DGTL1_BARHE      LIADFLSGMTDHYALREYQHLFDCTDNFI--------
DGTL1_BARQU      LIADFLSGMTDHYALREYQRLFDCTNNFV--------
DGTL1_BART1      LIADFLSGMSDHYALREYHRLFDHTNHFV--------
DGTL1_ZYMMO      HIVDYVAGMTDHYALKRYHQDIGAFDLV---------
DGTL1_RICRS      VIADYIAGMTDRFAIQEYNQLCSTSYITCF-------
DGTL1_RICRO      VIADYIAGMTDRFAIQEYNQLCSTSYITCF-------
DGTL1_RICCN      VVADYIAGMTDRFAIQEYNQLCSTSYITCF-------
DGTL1_RICFE      IIADYIAGMTDRFAIQEYNQLCSLNFNNI--------
DGTL1_RICAH      VIADYIAGMTDRFAIQEYNQLCSLNFNNILKLNYEYI
DGTL1_RICCK      VIADYIAGMTDRFAIQAYNQLC---------------
DGTL1_RICB8      IIADYIAGMTDRFAIQEYNQLCSLNFNNI--------
DGTL1_RICBR      IIADYIAGMTDRFAIQEYNQLCSLNFNNI--------
DGTL1_RICPR      VIADYIAGMTDRFAIQEYNQLCSPNFNNI--------
DGTL1_RICTY      VIADYIAGMTDRFAIQEYNQLCAPKFNKI--------
DGTL1_CLOPE      GVTDYVAGMTDDYCTNEFNKIYIPKFVMY--------
DGTL1_CLOTE      GVADYISGMSDDYCLLLFNNIYVPKIVIY--------
DGTL1_CALS4      AVADYIAGMTDKYALLKYKEIFLPSPWFEQNIFDL--
DGTL1_SYNAS      VLADYISGMTDRYVMDLYMMMFEPYEKVMFEFRE---
DGTL1_LEPBL      VISDYVAGMTDRYAEKIYQSLH---------------
DGTL1_LEPBJ      VISDYVAGMTDRYAEKIYQSLH---------------
DGTL1_LEPIC      VISDYVAGMTDRYAEKIYQSLP---------------
DGTL1_LEPIN      VISDYVAGMTDRYAEKIYQSLP---------------
DGT1A_DEIRA      AICDHLAGMTDRYALETHAALRG--------------
DGTL1_DEIGD      AICDFMAGMTDRYATEMYAALVPTSGPVSWLGELRN-
DGTL1_RALSO      WIAHYIAGMTDRYAIKEHRRIFAVEVL----------
DGTL1_THIDA      AVADYIAGMTDRYAMREHRRIYAVEEIYD--------
DGTL1_BORPE      AISDYIAGMTDRYAIREHRRLFEMG------------
DGTL1_BORBR      AISDYIAGMTDRYAIREHRRLFEMG------------
DGTL1_BORPA      AISDYIAGMTDRYAIREHRRLFEMG------------
DGTL1_AZOSB      AIADYIAGMTDRYAMKEHRRLFAVGEIH---------
DGTL1_NITEC      IIADYIAGMTDRYAIKEYRRMFAIIED----------
DGTL1_NITEU      AIADYIAGMTDRYAIREYQRLFAITEN----------
DGTL1_GEOSL      VVCDYIAGMTDRFALDEFKRLFEPYERV---------
DGTL1_WOLSU      VVADYIASMSDRYAMNLYKELHIG-------------
DGTL1_STRCO      VVVDQIASLTDASARSLHARLTGHP------------
DGTL1_STRAW      VIVDQIASLTDVAARSLHARLTGHL------------
DGTL1_MYCA1      VIVDQIASYTEGRLERIDARQAGP-------------
DGTL1_MYCPA      VIVDQIASYTEGRLERIDARQAGP-------------
DGTL1_MYCTA      VVVDQIASYTEGRLERIDADQLGVSRNALD-------
DGTL1_MYCTU      VVVDQIASYTEGRLERIDADQLGVSRNALD-------
DGTL1_MYCBO      VVVDQIASYTEGRLERIDADQLGVSRNALD-------
DGTL1_MYCBP      VVVDQIASYTEGRLERIDADQLGVSRNALD-------
DGTL1_MYCUA      VVVDQIASYTEGRLERIDAAQLGDGRVG---------
DGTL1_MYCLE      VIVDQIASYTEGRLERIDAGQASP-------------
DGTL1_MYCSK      VVIDQIASYTEGRLERVHEARSPRPLD----------
DGTL1_MYCSS      VVIDQIASYTEGRLERVHEARSPRPLD----------
DGTL1_MYCSJ      VVIDQIASYTEGRLERVHEARSPRPLD----------
DGTL1_MYCVP      VVIDQIASYTESRLERVHEARSPRPLD----------
DGTL1_MYCS2      VVIDQIASYTETRLERVHEARSPRPLE----------
DGTL1_COREF      VVVDQIASMTESRLERLARNASGISGFLG--------
DGTL1_CORGL      VIVDQIASMTESRLERLARNAADISGFLG--------
DGTL1_VIBPA      VIADYISAMTDGHAQKLHRQLFSSIVL----------
DGTL1_VIBCB      VIADYISAMTDGHAQKLHRQLFSSIVL----------
DGTL1_VIBVU      VIADYISSMTDGHAQRLHQQLFSSHH-----------
DGTL1_VIBVY      VIADYISSMTDGHAQRLHQQLFSSHH-----------
DGT1A_VIBCH      VICDYIAAMTDAYAQRLHQQLFSAQSHY---------
DGTL1_ALIF1      VIADYIAGMTDGYAQRLYNQLFVPI------------
DGTL1_SHEON      ILADYISGMTDEFAGRLYQQLFTLRLDRTWS------
DGTL1_HAEIE      IICDYIAGMSDAHALRVYQQL----------------
DGTL1_HAEIG      IICDYIAGMSDAHALRVYQQL----------------
DGTL1_HAEI8      IICDYIAGMSDAHALRVYQQL----------------
DGTL1_PASMU      VICDYMAGMSDAYALRVYQQL----------------
DGT1B_DEIRA      VICDYVSGMTDEYATKTYQRFFTPKFGSVFDV-----
DGT1B_VIBCH      LVTDYISGMMDSYAAQEYEKYFGKGSADKLYFK----
DGT1B_RHILO      EVCDFVAGMTDRYAMEFWARLNSDAAESMFKPI----
                  : . ::.  :