CLUSTAL format seed alignment for MF_01216

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

AZOR1_BACSU      --------MSTVLFVKSSDRTAEE------GVSTKLYEAFLAAYKENN-------PND-E
AZOR1_BACLD      --------MSKVLFVKANDRTAEE------AVSVKLYEAFLNSYKENH-------PND-E
AZOR2_BACHD      --------MSKVLFVKGNPRSVDE------SVSVKMYQTFVDTYKEAN-------PND-E
AZOR4_BACAN      --------MTKVLFVKANNRPAEQ------AVSVKLYEAFLASYKEAH-------PND-T
AZOR3_BACHK      --------MTKVLFVKANNRPAEQ------AVSVKLYEAFLASYKEAH-------PND-T
AZOR4_BACCZ      --------MTKVLFVKANNRPAEQ------AVSVKLYEAFLASYKEAH-------PND-T
AZOR4_BACC1      --------MATVLFVKANNRPAEQ------AVSVKLYEAFLANYKEAH-------PND-T
AZOR3_BACCR      --------MATVLFVKANNRPAEQ------AVSVKLYEAFLANYKEAN-------PND-T
AZOR2_BACCZ      --------MSKVLFVKANDRPAEQ------AVSSKMYETFVNTYKEAN-------PNT-E
AZOR1_BACHK      --------MSKVLFVKANDRPAEQ------AVSSKMYETFVNTYKEAN-------PNT-E
AZOR2_BACAN      --------MSKVLFVKANDRPAEQ------AVSSKMYETFVTTYKEAN-------PNT-E
AZOR2_BACC1      --------MSKVLFVKANDRPAEQ------AVSSKMYETFVSTYKEAN-------PNT-E
AZOR1_BACCR      --------MSKVLFVKANDRPAEQ------AVSSKMYETFVSTYKEAN-------PNT-E
AZOR_BACSK       --------MATVLMINASDR-LEQ------GVSVKMYNQFLNSYKEAH-------PND-T
AZOR1_BACHD      ---------METLFVKANDR--EN------SVTGLLYEAFISTYKALN-------PND-S
AZOR1_LISMF      --------MTNVLFIKANGLPAER------SVSVALYEIFLTEYKKSH-------PDD-N
AZOR1_LISMO      --------MTNVLFIKANGLPAER------SVSVALYEIFLTEYKKSH-------PDD-N
AZOR1_LISIN      --------MTNVLFIKANGLPAER------SVSVALYEIFLAEYKKSH-------PDD-N
AZOR_GEOKA       --------MTKVLYITAHPHDDTQ------SYSMAVGKAFIETYKQVH-------PDH-E
AZOR_GEOSE       --------MTNVLYITAHPHDDTQ------SYSMAVGKAFIDTYKQVH-------PDH-E
AZOR3_BACHD      --------MAKVLYITAHPLNEEQ------SFSLAAGTAFIETYKEEH-------KDD-E
AZOR2_BACSU      --------MAKVLYITAHPHDEAT------SYSMATGKAFIESYKEAN-------PND-E
AZOR_BACVZ       --------MAKVLYITAHPHDEKT------SYSMATGKAFIDSYKESN-------PND-E
AZOR2_BACLD      --------MTKTLYITAHPHDERA------SYSMAAGKAFIESYKEAH-------PDD-E
AZOR_BACP2       --------MAKVLYITAHPHDETV------SYSMATAKAFIESYKEAN-------PSD-E
AZOR_STAA9       --------MAKVLYITAHPFNELV------SNSMAAGKAFIETYQQQH-------PDD-E
AZOR_STAA2       --------MAKVLYITAHPFNELV------SNSMAAGKAFIETYQQQH-------PDD-E
AZOR_STAAN       --------MAKVLYITAHPFNELV------SNSMAAGKAFIETYQQQH-------PDD-E
AZOR_STAAC       --------MAKVLYITAHPFNELV------SNSMAAGKAFIETYQQQH-------PDD-E
AZOR_STAA8       --------MAKVLYITAHPFNELV------SNSMAAGKAFIETYQQQH-------PDD-E
AZOR_STAAT       --------MAKVLYITAHPFNELV------SNSMAAGKAFIETYQQQH-------PDD-E
AZOR_STAA3       --------MAKVLYITAHPFNELV------SNSMAAGKAFIETYQQQH-------PDD-E
AZOR_STAAS       --------MAKVLYITAHPFNELV------SNSMAAGKAFIETYQQQH-------PDD-E
AZOR_STAAW       --------MAKVLYITAHPFNELV------SNSMAAGKAFIETYQQQH-------PDD-E
AZOR_STAAB       --------MAKVLYITAHPFNELV------SNSMAAGKAFIETYQQQH-------PDD-E
AZOR_STAA1       --------MAKVLYITAHPFNELV------SNSMAAGKAFIETYQQHH-------PDD-E
AZOR_STAAM       --------MAKVLYITAHPFNELV------SNSMAAGKAFIETYQQHH-------PDD-E
AZOR_STAAR       --------MAKVLYITAHPFNELV------SNSMAAGKAFIETYQQQH-------PED-E
AZOR_STAHJ       --------MTKLLYITAHPLDELG------SNSMAAGKTFVDSYKENH-------PSD-E
AZOR3_BACCZ      --------MTKVLFITANPNSAEG------SFGMAVGEAFIEAYKNEH-------PQD-E
AZOR2_BACCR      --------MTKVLFITANPNSAEG------SFGMAVGEAFIEAYKNEH-------PQD-E
AZOR3_BACC1      --------MTKVLFITANPNSAEG------SFGMAVGEAFIEAYKNEH-------PQD-E
AZOR2_BACHK      --------MTKVLFITANPNSAEG------SFGMAVGEAFIEAYKNEH-------PQD-E
AZOR3_BACAN      --------MTKVLFITANPNSAEG------SFGMAVGEAFIEAYKNEH-------PQD-E
AZOR_GEOUR       --------MAKLLYVTCNLKPTEF------SCSLSVGKKFLDEYLRQN-------PAD-E
AZOR2_LISMF      --------MSKVLFIKASPLPNEV------SRSSQVAETFMAEYKAKN-------PSD-T
AZOR2_LISMO      --------MSKVLFIKASPLPNEV------SRSSQVAETFMAEYKAKN-------PSD-T
AZOR2_LISIN      --------MSKVLFIKASPLPNEV------SRSSQVAATFIDEYKAKN-------PSD-T
AZOR_CLOP1       --------MSKVLYIKANIKNEGE------SRTFKVSDSFVEEYKKNN-------PED-E
AZOR2_CLOPE      --------MSKVLYVKANIKNEGE------SRTFKVSDSFVEEYKKNN-------PED-E
AZOR_CLOPS       --------MSKVLYIKANIKNEGE------SRTFKVSDSFVEEYKKNN-------PED-Q
AZOR_CLOB8       --------MNKVLYIKANAKPEGK------SRTFKISDVFIDEYKQNN-------PDD-E
AZOR2_CLOAB      --------MSKVLYIKANAKPEGV------SRTFKISDSFIEEYRNQK-------PND-E
AZOR_LACP7       --------MSKVLYIKANIKLEGV------SRTFQVSDHFIEEYKKQH-------PED-E
AZOR_CALS8       --------MAKLLYIKANPKSDQS------SRTFIISEHFIKVYKEFH-------PND-Q
AZOR_LACLS       --------MSKLLVVKGHPLTAEY------SLSLKGLDAFVKSYKSAH-------PED-E
AZOR2_LACLA      --------MSKLLVVKGHPLTADY------SLSLKGLDAFVKAYKAAH-------PED-E
AZOR_ENTFA       --------MSKLLVVKAHPLTKEE------SRSVRALETFLASYRETN-------PSD-E
AZOR_STRS2       --------MANLLIVKAHPLDAQK------SYALRALEEFQTRYASLH-------PED-R
AZOR2_LACPL      --------MTKLLMINAHPHTTVP------SASLTVAASFKTAYQQTH-------PHD-E
AZOR1_LACLA      --------MTTLLIILAHPHTDDF------SWSLATVEEFKKSYQESH-------PLD-K
AZOR1_BACCZ      -------MNKTLIINAHPKVDDTS------SVSIKVFNHFLESYKEFI-------PNNET
AZOR1_BACC1      -------MNKTLIINAHPKVDDTS------SVSIKVFNHFLESYTELI-------PNNET
AZOR1_BACAN      -------MNKTLIINAHPKVDDTS------SVSIKVFKHFLESYKELI-------SNNET
AZOR_STRA5       --------MNTLIVNSHPDFSNPY------SFTTILQEKFIELYNEHF-------PNH-Q
AZOR_STRA3       --------MNTLIVNSHPDFSNPY------SFTTILQEKFIELYNEHF-------PNH-Q
AZOR_STRA1       --------MNTLIVNSHPDFSNPY------SFTTILQEKFIELYNEHF-------PNH-Q
AZOR1_LACPL      -------MTKTLIVNAHPDFRNAA------HYSVQLEQAFLQLFQTRF-------PND-T
AZOR_CUPNH       ---------MNILQIDSSVL-GDN------SVSRSLTASVVADLVAA--------TPDAK
AZOR1_CUPPJ      ---------MNILQIDSSVL-GGH------SVSRNLTASVVADLVAA--------NPGAK
AZOR_AZOBR       ---------MKILRIDSSPL-GDA------SVSRQLTASIVAALRQA--------TPDAE
AZOR2_XANC5      ---------MRLLHLDSSIL-TDT------SVSRQLTAQVVQDLHAA--------IDDLH
AZOR2_XANAC      ---------MRLLHLDSSIL-TDT------SVSRRLTAQVVQDLHAA--------IDDLH
AZOR_RALSO       ---------MQVLHLDSSIL-GDA------SASRILTAAIVDELRRD--------NPGAT
AZOR_ACISJ       ---------MQLLHIDSAIT-GDQ------SVSRQLTAQTVEAWKAS--------HPATQ
AZOR_RHOFT       ---------MKLLHVDSSIL-GTY------SVSRQLSAEIVAEWRKS--------RPDTT
AZOR1_XANAC      ---------MKLLHLDSSAL-GAN------SISRELSAAVVEQQRRL--------HPEVD
AZOR1_XANC5      ---------MKLLHLDSSAL-GAN------SVTRVLSAAVVEQQRRR--------HPEVD
AZOR_XANOR       ---------MKLLHLDSSAL-GAT------SISRELSAAIVAQQRRL--------YPEVE
AZOR_XANOM       ---------MKLLHLDSSAL-GAT------SISRELSAAIVAQQRRL--------YPEVE
AZOR3_PSEPF      ---------MKLLHIDSSIL-GDN------SASRQLSSQVTKAWQAA--------EPSAV
AZOR5_PSEF5      ---------MKLLHIDSSIL-GDN------SASRQLSHSVVEAWKAA--------HPATV
AZOR1_PSEPK      ---------MKLLHIDSSIL-GDN------SASRQLSREVVEAWKAA--------DPSVE
AZOR2_PSEAE      ---------MKLLHIDSSIL-GDA------SASRQLSAELVQAWRQN--------EDGLD
AZOR_PSE14       ---------MNLLHLDSSIL-GDH------SASRQLTHEVVQAYQRS--------HADSQ
AZOR_PSEU2       ---------MNLLHLDSSIL-GDH------SASRQLTHEVVQAYLTA--------HADSQ
AZOR1_PSESM      ---------MNILHLDSSIL-GDH------SASRQLSRDVVEAYKST--------HADSH
AZOR_RHIME       ---------MKILHIDSGIL-GEH------SVSRRLTSAIVSQLKAD--------RPDAE
AZOR_SINMW       ---------MKILHIDSGIL-GEH------SVSRRLTAAIVSQIKAD--------RPDAD
AZOR7_BURL3      ---------MKLLHIDSSIL-GQG------SVSRELSAEVVATFRAR--------DPGLT
AZOR_BRASB       ---------MKLLHIDSSIA-GVG------SVTRELSAEIVALLKGA--------DKSWN
AZOR2_BRADU      ---------MKLLHIDSSVL-GPH------SVSRQVSAAIVDRLRQA--------TPSLE
AZOR_RHOPB       ---------MKLLHIDSSVL-GPH------SVSRQVSAAIVARLREV--------NPGAA
AZOR_XANCP       ---------MKLLHLDSSIL-GDY------SASRQLTASIVAKLQAA--------DPALQ
AZOR_GLUDA       ---------MKLLHLDASILPEDS------SVSRTLSAAVVAHVRAL--------QPDLT
AZOR_GLUOX       ---------MKLLHIDSSIL-GDS------SASRHVSAAAVAQFRKK--------DPSVE
AZOR_CHRVO       ---------MKLLHLDSSIL-ADN------SVTRELSAVVADTLRQR--------HANVE
AZOR_LEGPH       ---------MKLLAIDSSIL-TNT------SVSRQLTRSFVSRWQKI--------YPETE
AZOR_SALPA       --------MSKVLVLKSSIL-AGY------SQSGQLTDYFIEQWREK--------HVADE
AZOR_SALTI       --------MSKVLVLKSSIL-AGY------SQSGQLTDYFIEQWREK--------HVADE
AZOR_SALTY       --------MSKVLVLKSSIL-AGY------SQSGQLTDYFIEQWREK--------HVADE
AZOR_SALPB       --------MSKVLVLKSSIL-AGY------SQSGQLTDYFIEQWREK--------HVADE
AZOR_SALCH       --------MSKVLVLKSSIL-AGY------SQSGQLTDYFIEQWREK--------HVADE
AZOR_SALAR       --------MSKVLVLKSSIL-AGY------SQSGQLTDYFIEQWREK--------HVADE
AZOR_CITK8       --------MSKVLVLKSSIL-AGY------SQSGQLSDYFVEQWREK--------HPADA
AZOR_SHIBS       --------MSKVLVLKSSIL-AGY------SQSNQLSDYFVEQWREK--------HSADE
AZOR_ECOUT       --------MSKVLVLKSSIL-AGY------SQSNQLSDYFVEQWREK--------HSADE
AZOR_ECO24       --------MSKVLVLKSSIL-AGY------SQSNQLSDYFVEQWREK--------HSADE
AZOR_SHISS       --------MSKVLVLKSSIL-AGY------SQSNQLSDYFVEQWREK--------HSADE
AZOR_SHIDS       --------MSKVLVLKSSIL-AGY------SQSNQLSDYLVEQWREK--------HSADE
AZOR_ECOLC       --------MSKVLVLKSSIL-AGY------SQSNQLSDYFVEQWREK--------HSADE
AZOR_ECOHS       --------MSKVLVLKSSIL-AGY------SQSNQLSDYFVEQWREK--------HSADE
AZOR_ECOLI       --------MSKVLVLKSSIL-AGY------SQSNQLSDYFVEQWREK--------HSADE
AZOR_SHIFL       --------MSKVLVLKSSIL-AGY------SQSNQLSDYFVEQWSEK--------HSADE
AZOR_SHIF8       --------MSKVLVLKSSIL-AGY------SQSNQLSDYFVEQWSEK--------HSADE
AZOR_ECO57       --------MSKVLVLKSSIL-AGY------SQSNQLSDYFVEQWREK--------HSADE
AZOR_ECOL5       --------MSKVLVLKSSIL-AGY------SQSNQLSDYFVEQWREK--------HSADE
AZOR_ECOL6       --------MSKVLVLKSSIL-AGY------SQSNQLSDYFVEQWREK--------HSADE
AZOR_CROS8       --------MSKVLVLKSSIL-AGY------SQSNQLSDYFVEQWREK--------HSADE
AZOR_YERPE       --------MSKVLVLKSSIL-ATS------SQSNQLADFFVEQWQAA--------HAGDQ
AZOR_YERPN       --------MSKVLVLKSSIL-ATS------SQSNQLADFFVEQWQAA--------HAGDQ
AZOR_YERP3       --------MSKVLVLKSSIL-ATS------SQSNQLADFFVEQWQAA--------HAGDQ
AZOR_YERPP       --------MSKVLVLKSSIL-ATS------SQSNQLADFFVEQWQAA--------HAGDQ
AZOR_YERPA       --------MSKVLVLKSSIL-ATS------SQSNQLADFFVEQWQAA--------HAGDQ
AZOR_YERPS       --------MSKVLVLKSSIL-ATS------SQSNQLADFFVEQWQAA--------HAGDQ
AZOR_YERE8       --------MSKVLVLKSSIL-ATY------SQSNQLADFFVEQWKTA--------HAGDE
AZOR_PECAS       --------MSKVLVLKSSIL-AGY------SQSNQLADHFTTQWQSA--------HPDDS
AZOR_SODGM       --------MSKVLVVKSSIL-ATF------SQSNPLADHFIDQWREQ--------HLNDD
AZOR_PHOLL       --------MSKVLVLKSSIM-AQH------SHTNQMADFFIEKWQTN--------HADDS
AZOR_VIBVY       --------MSRLLVLKSSIL-GDY------SQSNKLVDEFINHFDQQ------------Q
AZOR_VIBVU       --------MSRLLVLKSSIL-GDY------SQSNKLVDEFINHFDHQ------------Q
AZOR_VIBPA       --------MSRVLALKSSIL-GDY------SQSNKLVEDFIKNVDQD------------K
AZOR_SHESH       --------MSKVLILKSSIL-GDY------SQSGQLVEHLKQHWEQQ--------G--AE
AZOR_SHELP       --------MAKVLVLKSSIL-GDY------SQSAKLIDHLQQHWQGQ--------G--AE
AZOR_SHEDO       --------MAKVLVLKSSIL-GDY------SQSSALIGHLMSHWQQQ--------G--AQ
AZOR_SHESM       --------MSKVLVLKSSIL-GGY------SQSALLVDHLIGKWEDQ--------G--AT
AZOR_SHESR       --------MSKVLVLKSSIL-GGY------SQSALLVDHLIGKWEDQ--------G--AT
AZOR_SHESA       --------MSKVLVLKSSIL-GGY------SQSALLVDHLIGKWEDQ--------G--AT
AZOR_SHEON       --------MSKVLVLKSSIL-GGY------SQSALLVDYLIGKWEKQ--------G--AT
AZOR_SHEB9       --------MSKVLILKSSIL-GGY------SQSAVLIDHLASHWETQ--------G--AA
AZOR_SHEB8       --------MSKVLILKSSIL-GGY------SQSAVLIDHLASHWETQ--------G--AA
AZOR_SHEB5       --------MSKVLILKSSIL-GGY------SQSAVLIDHLASHWETQ--------G--AA
AZOR_SHESW       --------MSKVLILKSSIL-GGY------SQSAVLIDHLASHWENQ--------G--AA
AZOR_SHEPC       --------MSKVLILKSSIL-GGY------SQSAVLIDHLASHWENQ--------G--AA
AZOR_SHEFN       --------MAKVLILKSSIL-GSY------SQSSALVDYLNQQWSSK--------G--AQ
AZOR_SHEAM       --------MSKVLVLKSSIL-GDF------SQSGRLIDEWVAARRAS--------G--DT
AZOR1_PHOPR      --------MSNVLVLKSSIL-GDY------SQSNGLIDHLVSSWGDS--------V--SS
AZOR_PSYIN       --------MINFLALKSSIL-GDY------SSSSKLIDELLAKYTPQ--------Q--AI
AZOR_AERS4       --------MANILVLKSSIL-GQY------SQSNALIDGFLADHQS------------DT
AZOR4_BURL3      --------MARILVLKSSIN-GSQ------SQTSTLIDTFLAERQAN--------GHADD
AZOR_HAEI8       --------MSNVLVLKSSIS-GNN------SQTNQLADYVIEKLQ------------GNN
AZOR_HAEIN       --------MSNVLVLKSSIS-GNN------SQTNQLADYVIEKLQ------------GNN
AZOR_HAEIG       --------MSNVLVLKSSIS-GNN------SQTNQLVDYAVEKLQ------------GNN
AZOR_HAEIE       --------MNNVLVLKSSIS-GNN------SQTNQLADYVIEKLQ------------GNH
AZOR_HYPNA       --------MSNLLVLNSSAN-TGE------SVSRILIDEAVNQILTA--------APGTD
AZOR2_PSEF5      --------MSRVLIIESSAR-QQD------SVSRQLTQTFIQQWQAA--------HPGDS
AZOR2_PSEPF      --------MSRVLIIESSAR-QQD------SVSRQLTQTFISQWKAA--------HPADQ
AZOR2_PSEPK      --------MSRVLIIESSAR-QQD------SVSRQLTKDFIQQWQAA--------HPADQ
AZOR3_PSEAE      --------MSRVLVIESSAR-QRG------SVSRLLTAEFISHWKIA--------HPADR
AZOR_AROAE       ---------MNILQINSSAR-SDA------SNSTRVANSIVERLRAS--------HPGAA
AZOR_DECAR       ---------MKILQINASAR-SAG------ANSTRLADTVTARLLAR--------NPNAV
AZOR_AZOSB       ---------MNILQINSSAR-SEG------ANSTRVANDVTTRLLAA--------NPDAT
AZOR_BURP1       --------MTTILQINSAAR-SQG------AQSTLLADELTAKLQQG--------NPGAT
AZOR_BURPS       --------MTTILQINSAAR-SQG------AQSTLLADELTAKLQQG--------NPGAT
AZOR_BURMA       --------MTTILQINSAAR-SQG------AQSTLLADELTAKLQQG--------NPGAT
AZOR_BURTA       --------MTTILQINSAAR-SQG------AQSTMLADELTAKLQQG--------NPGAT
AZOR6_BURL3      --------MTTILQINSAAR-SQG------AQSTLLANELTAKLQQS--------NPGAK
AZOR_ALCBS       ---------MNILVIKSSVF-GDN------GNSSALVNAQVDALKAK--------HPQAT
AZOR_BORPA       ---------MKTLVILSSIL-GDR------SNSKQLADHLLARLKQS--------EPGGT
AZOR_BORBR       ---------MKTLVILSSIL-GDR------SNSKQLADHLLARLKQS--------EPGGT
AZOR_BORA1       ---------MKTLVLLSSIL-GDR------SKSKALADHFLARMCEH--------EPASD
AZOR_SACD2       MTTESQSAVKTILHVESSLF-GEG------GVSSQLSTELVTKLQNKYADVNAKVNTNVK
AZOR_MARMS       --------MATLLRIDSSAS-GEN------SKSRQLANEFVEKWLAK--------NPEGK
AZOR_RHIL3       --------MSSILLLTSSPR--AD------SLSTPIAVDLAEKLKSQN--------PGSV
AZOR1_RHIEC      --------MSSILLLTSSPR--AE------SLSTPIAADLAEKLKNQK--------PGSV
AZOR_AGRFC       --------MSNILLITSSPR-GDE------SVSNKFAGELAGKLKAKS--------ASNT
AZOR_RHILO       ---------MSILLVTSSPR-GAA------SHSTRIATEFAEKLLAAD--------PSNT
AZOR2_RHIEC      --------MTNILIVTSSPR-GPE------GLSTRFATEIAEGLKTA---------LGGT
AZOR_AZOC5       --------MTSILLVTSSPR-GAD------SLSTRFATEIAEGLKAR---------FGGA
AZOR1_BURL3      --------MSRILLITSSPR-STD------SLSTRFAHDLARQLAARD--------AAGA
AZOR_HERAR       --------MTKILNINSSVR-IGD------SISRKVTTEFINKWKARE--------ADAI
AZOR1_HAHCH      ----MSQPITRILKIDSSAR-AES------SMSRKLAQQLTEQLIAAN--------PGAE
AZOR1_JANSC      --------MTHILRIDASAR-RDG------SVSRDLTTQIVDLL-------------GGE
AZOR_THIDA       ---------MRVLRVDASAR-VDD------SVTRRLADLMLEILGERV--------PDLS
AZOR1_COLP3      ---------MNILRLDASMR-KTG------SYSRILTDKLIEQLTSGK---------NNE
AZOR_RHOS1       --------MTTILRIDSSIK-GEA------AVSRRLTQRILDRLLEAH--------PDAT
AZOR_RHOS4       --------MTTILRIDSSIK-GEA------AVSRRLTQRILDRLLEAH--------PDAT
AZOR_ERYLH       --------MSTILHITASIR-GDE------SISRALSSKLVERLSGT----------DTK
AZOR_PELUB       ---------MKIYQIDSSAR-KEG------SSSRALAKKLLNKIKKP----------GDE
AZOR_NOSS1       --------MANILHIDSS-PRGDR------SISRKLSYEFITSWKDT--------HPGDT
AZOR2_TRIV2      --------MANILHIDSS-PRGDR------SISRKLSYEFLTSWKDT--------HPGDT
AZOR1_TRIV2      ---------MKLLHLDSS-PRGER------SISRSLTQQFVSLWKQM--------HLDVP
AZOR_FRACC       --------MPHLLHVDSS-LATES------STSRSIATIFAEAWREA--------HPDGI
AZOR_FRAAA       --------MPNLLHVDAS-LAQEG------STSRSLAATYIDAWRAA--------HPDGT
AZOR_STRAW       --------MATLLHIDSSVFPSAA------SASRAVAETFRTAWQEQ--------HPDGT
AZOR_NOCFA       --------MPTLLHLDAS--PRRR------SISRDIGAAFADSWRAT--------APNGH
AZOR1_PSEAE      --------MSRILAVHAS-PRGER------SQSRRLAEVFLAAYREA--------HPQAR
AZOR1_PSEPF      --------MSKILAIHAS-PRGER------SHSRRLAETFLSAWQVR--------HPQAQ
AZOR1_PSEF5      --------MSTVLAIHGS-PRGER------SHSRRLADAFLQAWQAA--------NPQGR
AZOR_GRABC       --------MTRLLVVETS-PRGNY------SISRNMTRGFVAEWQAA--------HSDGE
AZOR2_JANSC      --------MPKLLVVETS-PRGAA------SISRNITKTFVAKWKAA--------HADSA
AZOR8_BURL3      --------MPTLLVVEAS-PRGEQ------SISRGLTKMFVNQWKRE--------QHDGR
AZOR3_BURL3      --------MFKLLQIDSS-PMGDA------SISRRLTQEYARNWLRA--------HPDGR
AZOR_HYDCU       --------MATVLRIDSSAL-SNG------SHSKALADFFQTQWLEK--------HPTDS
AZOR_BRASO       --------MTRLLRIDASAR-HTG------SFSRDLADLFVSGWLAH--------EPQAE
AZOR4_PSEF5      --------MNNLLLINASPR-GQG------SHGNQLALELVSSLRQR--------YPHLE
AZOR5_BURL3      --------MNNLLFVDASPH-GSR------SLGARIAREAIAQWQAA--------HPHAR
AZOR2_CUPPJ      --------MPKLLYLSVSPR-AEN------SYSRQAGARMIAWLERR--------HGPLT
AZOR_ALKEH       --------MTTLLLVHSSAR-TGG------SRTREMADILTAEWHAR--------GDNHQ
AZOR2_HAHCH      ---------MNLLHIKVSPN-LFG------SASREVSDYLVDRLKVK--------HPQLN
AZOR_DESVV       --------MATILYIKASPR-GER------SHSVTVADAFVKAYSEA--------NPGDV
AZOR_DESVH       --------MATILYIKASPR-GER------SHSVTVADAFVKAYSEA--------NPGDV
AZOR3_PSEF5      --------MTRLLHIQCSPR-LRR------SASLEIAHSFIQSYRQQ--------RPDTE
AZOR2_BURL3      ---------MRLLNIVSSPR-GAR------SASIAVARAFVDAYRQT--------GATID
AZOR9_BURL3      --------MTRVLYIEGSPN-KDY------SASIEVCNAFLDTYRHA--------HPDHE
AZOR_DESPS       --------MSKLLYIEASPR-KNK------SFSTRVAQSFINTFLDA--------DPANR
AZOR2_PSESM      ---------MHILHIASSPR-GER------SVSLKLASRYLETLTSL--------HPEST
AZOR1_BRADU      --------MAKLLHLSCSPR-P-D------SESSAGARVFLDGFRQM--------RPDWD
AZOR_RUEPO       --------MTKLLQIIASPR-GGD------SKSNALADAFVAAQRAK--------DSTLQ
AZOR_MYCPU       --------MAKVLVIKTSMMGAN-------SISNVLNDKFMEYYKEKN--------PNDE
AZOR_MYCPE       --------MAKLLVIKASMVDKSI------SFSEELTNRFVKYYLESN--------PNDE
AZOR_MYCMO       ------MKIQKVLVIKSSMTENLPSG----SFSSALSDKFMEYYRKEN--------PIDK
AZOR_MYCS5       --------MAKVLVLSGGLSEKEK------SYSSQMLDLFVKTYKEVH--------PNDE
AZOR_MYCMS       --------MSKVLVLKTTAQADEV------SNSVALTNRFLEEYKKFN--------PDDE
AZOR_MYCCT       --------MSKVLVLKTTAQADEV------SNSVALTNRFLEEYKKFN--------PDDE
AZOR1_MESFL      --------MSKLLVINGSVIPSDK------SNSHEMARIFLEEYKKVN--------PNDE
AZOR_MYCGA       --------MSKVLFINASPVANEA------SFSYQLAKTFESEYLKLN--------PSDQ
AZOR_MYCGE       --------MKKVIIVDASVTPSG-------SYTHLLLDRFLQTYKKQN--------SSVE
AZOR_MYCPN       --------MKKVIIIDASVSPSG-------SYTHLLLERFLATFQAKN--------KDVE
AZOR_MYCH7       ---------MNILVIKSSVNEKKG------SYSSHLSDLFIKFYLEIH--------PEDQ
AZOR_MYCH2       ---------MNILVIKSSVNEKKG------SYSSHLSDLFIKFYLEIH--------PEDQ
AZOR_MYCHJ       ---------MNILVIKSSVNEKKG------SYSSHLSDLFIKFYLEIH--------PDDQ
AZOR2_MESFL      --------MKKVLVINSSVSQLNN------SDSLAMSNMFIEEYKKMN--------PNDE
AZOR2_COLP3      --------MITLLHIDTSARRTDNDVKEYNSISKSLAAHFMDKWITLN--------SKDK
AZOR2_PHOPR      ---------MRVLYITANPKLIHH------SVSLSLGELALQYYRELN--------PSHI
                                                                             

AZOR1_BACSU      VVELDLHK--ENLPYLGRDMINGTFK--------AGQG---MEMTEDEKKQAAIADKYLN
AZOR1_BACLD      IVELDLYR--ENPPYLGRNAINGTFK--------AGKG---MELNEDEKAAAAVADRYLD
AZOR2_BACHD      VIELDIYN--EQLPYLDSTMLAGIFK--------AGQQ---LELTAEEEEARKVADRYLT
AZOR4_BACAN      VVELDLYK--EELPYVGVDMINGTFK--------AGKG---FDLTEEEAKAVAVADKYLN
AZOR3_BACHK      VVELDLYK--EELPYVGVDMINGTFK--------AGKG---FDLTEEEAKAVAVADKYLN
AZOR4_BACCZ      VVELDLYK--EELPYVGVDMINGTFK--------AGKG---FDLTEEEAKAVAVADKYLN
AZOR4_BACC1      VVELDLYK--EELPYVGVDMINGTFK--------AGKG---FDLTEEEAKAVAVADKYLN
AZOR3_BACCR      VVELDLYK--EELPYVGVDMINGTFK--------VGKG---FDLTEEEAKAVAVADKYLN
AZOR2_BACCZ      ITELDLFA--LDLPYYGNIAISGGYK--------RSQG---MELTAEEEKAVATVDQYLN
AZOR1_BACHK      ITELDLFA--LDLPYYGNIAISGGYK--------RSQG---MELTAEEEKAVATVDQYLN
AZOR2_BACAN      ITELDLFA--LDLPYYGNIAISGGYK--------RSQG---MELTAEEEKAVATVDQYLN
AZOR2_BACC1      ITELDLFA--LDLPYYGNIAISGGYK--------RSQG---MELTAEEEKAVATVDQYLN
AZOR1_BACCR      ITELDLFA--LDLPYYGNIAISGGYK--------RSQG---MELTAEEEKAVATVDQYLN
AZOR_BACSK       VEELNLFA--EKLPYYGNTAITGQYK--------KAQG---VELTGEEKEIVETIERYQE
AZOR1_BACHD      IVELDLFQ--EHMPYLNALMIEVNYK--------AAQG---IPLPTSEEEVDHIVKRHLN
AZOR1_LISMF      VTELDLFE--ADLPYYDVTMMSGLHK--------EAAG---ETLSPEEKRLADIANSYLD
AZOR1_LISMO      VTELDLFE--ADLPYYDVTMMSGLHK--------EAAG---ETLSPEEKRLADIANSYLD
AZOR1_LISIN      VTELDLFE--ADLPYYDVTMMSGLHK--------EVAG---ETLTPEEKRLADIANGYLD
AZOR_GEOKA       VIHLDLYK--EYIPEIDVDVFSGWGK--------LRSGKSFEELSDEEKAKVGRMNELCE
AZOR_GEOSE       VIHLDLYK--EYIPEIDVDVFSGWGK--------LRSGKSFEELSDEEKAKVGRMNELCE
AZOR3_BACHD      VIHLDLYK--EEIPHIDAHVFSGWGK--------LQNNKGFEELSQEEQAKVGRLSELSE
AZOR2_BACSU      VVHIDLYK--ENIPHIDADVFSGWGK--------LQSGTGFEELSESEKAKVGRLGELSD
AZOR_BACVZ       VVHIDLYK--ENIPHIDADVFSGWGK--------LQSGTGFEELSENEKAKVGRLNELSD
AZOR2_BACLD      VIHLDLYR--ENIPQIDADVFSGWGK--------LQSGSGFEQLSEHEKAKVGRLNELSE
AZOR_BACP2       VVHIDLYK--ENIPHIDADVFAGWGK--------LQSGAGFDTLSAEEQAKVARLNELSD
AZOR_STAA9       VKHIDLFE--TYIPVIDKDVLTGWGK--------MSNG---ETLTDDEQMKVSRLSDILE
AZOR_STAA2       VKHIDLFE--TYIPVIDKDVLTGWGK--------MSNG---ETLTDDEQMKVSRLSDILE
AZOR_STAAN       VKHIDLFE--TYIPVIDKDVLTGWGK--------MSNG---ETLTDDEQMKVSRLSDILE
AZOR_STAAC       VKHIDLFE--TYIPVIDKDVLTGWGK--------MSNG---ETLTDDEQMKVSRLSDILE
AZOR_STAA8       VKHIDLFE--TYIPVIDKDVLTGWGK--------MSNG---ETLTDDEQMKVSRLSDILE
AZOR_STAAT       VKHIDLFE--TYIPVIDKDVLTGWGK--------MSNG---ETLTDDEQMKVSRLSDILE
AZOR_STAA3       VKHIDLFE--TYIPVIDKDVLTGWGK--------MSNG---ETLTDDEQMKVSRLSDILE
AZOR_STAAS       VKHIDLFE--TYIPVIDKDVLTGWGK--------MSNG---ETLTDDEQMKVSRLSDILE
AZOR_STAAW       VKHIDLFE--TYIPVIDKDVLTGWGK--------MSNG---ETLTDDEQMKVSRLSDILE
AZOR_STAAB       VKHIDLFE--TYIPVIDKDVLTGWGK--------MSNG---ETLTDDEQMKVSRLSDILE
AZOR_STAA1       VKHIDLFE--TYIPVIDKDVLTGWGK--------MSNG---ETLTDDEQMKVSRLSDILE
AZOR_STAAM       VKHIDLFE--TYIPVIDKDVLTGWGK--------MSNG---ETLTDDEQMKVSRLSDILE
AZOR_STAAR       VKHIDLFE--TYIPVIDKDVLTGWGK--------MSNG---ETLTDDEQMKVSRLSDILE
AZOR_STAHJ       VKHIDLFN--EDIPMIDKDVLTGWGK--------LRNG---DELTSEEQQKVNRLSEILD
AZOR3_BACCZ      VVTIDLFN--TTVPAIDADVFAAWGK--------FAAGEGFETLTEAQQQKVAAMNTNLE
AZOR2_BACCR      VVTIDLFN--TTVPAIDADVFAAWGK--------FAAGEGFEALTEVQQQKVAAMNTNLE
AZOR3_BACC1      VVTIDLFN--TTVPAIDADVFAAWGK--------FAAGEGFEALTEAQQQKVAAMNTNLE
AZOR2_BACHK      VVTIDLFN--TTVPAIDADVFAAWGK--------FAAGEGFEALTEAQQQKVAAMNTNLE
AZOR3_BACAN      VVTIDLFN--TTVPAIDADVFAAWGK--------FAAGEGFEALTEAQQQKVAAMNTNLE
AZOR_GEOUR       VYFLDLYR--DNIQRIDADVLSGWGK--------MRNGESFASLTTDEQRKVGHIWKHAD
AZOR2_LISMF      VEELVLYN--TEVPLLDLELMTAGRE--------LQAGKAFTDLAPDVQKKLNAYNALTE
AZOR2_LISMO      VEELVLYN--TEVPLLDLELMTAGRE--------LQAGKAFTDLAPDVQKKLNAYNALTE
AZOR2_LISIN      VEELVLYN--TEVPLLDLELMTAGRE--------LQAGKAFTDLAPDVQKRLNAYNALTE
AZOR_CLOP1       IITLDLYK--ENIDFLRADDLGKLFG------------------PKDEESKNNSILKYAY
AZOR2_CLOPE      IITLDLYK--ENIDFLRVDDLGKLFG------------------TKDEESKNNSILKYAY
AZOR_CLOPS       IITLDLYK--ENIDFLRADDLGKLFG------------------PKDEESKNNSILKYAY
AZOR_CLOB8       IITLDLYK--EDIDFLRSKDLDTVFG------------------PKNEESKNHPTLKYAY
AZOR2_CLOAB      IITLDLYK--EGISFL-TEEAIKLHV------------------PKQGEGKDHHVLKYAY
AZOR_LACP7       VVVLDLYK--ENIDFLRPEDLEAMAD------------------INDETKKNTTFLKYAF
AZOR_CALS8       IITLDLYK--EGIHFLSQEDINDIFA------------------PKTEASKHHPILKYAY
AZOR_LACLS       IEELDVFS--ADIPTLNTELVSA-----------MFAGENAE-LTASQKDKLARFAGFTD
AZOR2_LACLA      IEELDVFS--ADIPTLNTELVSA-----------MFAGENAE-LTASQKDKLARFAGFTE
AZOR_ENTFA       IEILDVYAPETNMPEIDEELLSAWGA--------LRAGAAFETLSENQQQKVARFNELTD
AZOR_STRS2       IEIVDVFE--DQIPALDKPLLEA-----------MGAAKRGEAISPEQAEQLGRYNALTQ
AZOR2_LACPL      ITTRDLYQ--DGVPALNDTTFEAWR----------KRKYGEELTSVEAE-LLSRHASWLA
AZOR1_LACLA      IIIRDLFS--EKVPALDNETFAAWK----------RNKYAPDTLSAEDKNLLHRHEEYLE
AZOR1_BACCZ      IEQINLYD--DVVPMIDKTVL-SAWE--------KQGNG--QQLTDEEQKVTERMSEILQ
AZOR1_BACC1      IEQINLYD--DVVPMIDKTVL-SAWE--------EQGNG--QQLTDEEQKVTERMSEILQ
AZOR1_BACAN      IEQINLYD--DVVPMIDKTVL-SAWE--------KQGNG--QELTREEQKVTERMSEILQ
AZOR_STRA5       LSILNLYD--CVLPEITKEVLLSIWS--------KQRKG--LELTADEIVQAKISKDLLE
AZOR_STRA3       LSILNLYD--CVLPEITKEVLLSIWS--------KQRKG--LELTADEIVQAKISKDLLE
AZOR_STRA1       LSILNLYD--CVLPEITKEVLLSIWS--------KQRKG--LELTADEIVQAKISKDLLE
AZOR1_LACPL      VDVLNLYD--TVIPQATVPELLGIWE--------KQAQH--VNLSIEEQRLFAINQQLLQ
AZOR_CUPNH       VTVRDLDQ--DAPAHLSGNLLP------------VLG-GPKEGLSAIQEAELQRTEQWLA
AZOR1_CUPPJ      VTVRDLDQ--DAPAHLSGHLLP------------VLG-GPKDGLNAAQEAELQRTETWLA
AZOR_AZOBR       VSVRDLTV--APPDHLTGELMQ------------VVKFRNLEGLTARQQEELALTDALVD
AZOR2_XANC5      ATYRDLAA--VPIAHLSGAIAA------------GFRPLPQPASDAALVAEHALSEQLVD
AZOR2_XANAC      ATYRDLAA--APIAHLSGAIAA------------GFRPLPQPDSDAASVAEHALSEQLVD
AZOR_RALSO       VIHRDLAV--EAIPHLDGAIAA------------GFRATGADGFDAVTLAEHARSEALVG
AZOR_ACISJ       VSYLDLVA--DAPAHF-TMDAM------------APRTGQTDGLSEAQQRENAVSERLVS
AZOR_RHOFT       VEYLDLAL--NAPNHF-GADAI------------AIKGIAQPEPTEAQRAENALSEQLVS
AZOR1_XANAC      VSYRDLDR--DPIPHLTAQTLA------------QTDPA-----------EAAAAEAVMQ
AZOR1_XANC5      VSYRDLDR--DPIPHLTAQTLA------------QTDPA-----------EAAAAEAVMQ
AZOR_XANOR       VTYRDLDR--DPIPHLTAQTLA------------QTDPA-----------EAAAAEAVMQ
AZOR_XANOM       VTYRDLDR--DPIPHLTAQTLA------------QTDPA-----------EAAAAEAVMQ
AZOR3_PSEPF      VTYRDLAA--DAISHFSSTTLV------------AAGTTAELR-NAAQQHEAELSATTLA
AZOR5_PSEF5      VTYRDLAN--DAISHFSAATLV------------AAGTAAELR-DAAQKHEAQLSAQALA
AZOR1_PSEPK      VVYRDLAA--DAIAHFSAATLV------------AAGTPEDVR-DAAQAFEAKLSAETLE
AZOR2_PSEAE      VTYRDLAA--DAVAHFSALTLA------------AGSTPAELR-DAALKHEVAVGEEVLE
AZOR_PSE14       VTYRDLAS--EALGHFSAASLA------------AAGTPVEAR-DASQQQEVDTNEATLQ
AZOR_PSEU2       VTYRDLAS--DALGHFSAASLA------------AAGTPVEVR-DAAQQQEVAGNEATLQ
AZOR1_PSESM      VTYRDLAS--EALGHFSAASLA------------AAGTPVEAR-DAAQQQEVDNNEATLQ
AZOR_RHIME       ITYRDLAS--ERVPHLTGAQIM------------APADL--EGVDALLAADVRIGRQMLE
AZOR_SINMW       ITYRDLAS--ERVPHLTGAQIM------------APADL--EGVDPDLAADVRIGRQMLE
AZOR7_BURL3      VTRLDLAA--TPIGHLSAEHLA------------AAQG---APISDALKADVEIGQRALA
AZOR_BRASB       VIYRDLVA--EPLSHLTGGYLA------------ALQG---APADQAVQADVGAGLAVME
AZOR2_BRADU      VVYRDLTQ--TPLAHLSGSHLA------------AAQG---APAPAELGPDLAASAAVLN
AZOR_RHOPB       VTYRDLGA--SPLAHLSGAHLA------------VAQG---AVPAPELQDDLAAGAAVLE
AZOR_XANCP       YTYRDLAA--NPIGHLSGAHLA------------AAQNPP-ATRTPELANDLALGVQVLQ
AZOR_GLUDA       VTRRDLVA--HPLSHMTLANLP------------PDHP----ASVPGNEVERAESQAVLE
AZOR_GLUOX       VISLDLAS--DPLPHLDVEALS------------WLGKDL-TPDVSG-RPELIAGANALK
AZOR_CHRVO       TSYRDLAA--NPIAHLSGEIVG------------ARFAPE-SDWTATQRSEAALSEQLIE
AZOR_LEGPH       VVYRDLHA--QPINHLSQKILA------------ANSVPS-TQISAEIREEMNLSMQLIS
AZOR_SALPA       ITVRDLAA--NPVPVLDGELVG------------AMRPG-DAPLTPRQQDALALSDELIA
AZOR_SALTI       ITVRDLAA--NPVPVLDGELVG------------AMRPG-DAPLTPRQQDALALSDELIA
AZOR_SALTY       ITVRDLAA--NPVPVLDGELVG------------AMRPG-DAPLTPRQQDALALSDELIA
AZOR_SALPB       ITVRDLAA--NPVPVLDGELVG------------AMRPG-DAPLTPRQQDALALSDELIA
AZOR_SALCH       ITVRDLAA--PPVPVLDGELVG------------AMRPG-DAPLTPRQQDALALSDELIA
AZOR_SALAR       ITVRDLAA--NPVPVLDGELVG------------AMRPG-DAPLTPRQQDALALSDELIA
AZOR_CITK8       ITVRDLAA--NPVPVLDGELVG------------ALRPS-DAPLTPRQQDALALSDELIA
AZOR_SHIBS       ITVRDLAA--NPIPVLDGELVG------------ALRPS-DAPLTPRQQEALALSDELIA
AZOR_ECOUT       ITVRDLAA--NPIPVLDGELVG------------ALRPS-DAPLTPRQQEALALSDELIA
AZOR_ECO24       ITVRDLAA--NPIPVLDGELVG------------ALRPS-DAPLTPRQQEALALSDELIA
AZOR_SHISS       ITVRDLAA--NPIPVLDGELVG------------ALRPS-DAPLTPRQQEALALSDELIA
AZOR_SHIDS       ITVRDLAA--NPIPVLDGELVG------------ALRPS-DAPLTPRQQEALALSDELIA
AZOR_ECOLC       ITVRDLAA--NPIPVLDGELVG------------ALRPS-DAPLTPRQQEALALSDELIA
AZOR_ECOHS       ITVRDLAA--NPIPVLDGELVG------------ALRPS-DAPLTPRQQEALALSDELIA
AZOR_ECOLI       ITVRDLAA--NPIPVLDGELVG------------ALRPS-DAPLTPRQQEALALSDELIA
AZOR_SHIFL       ITVRDLAA--NPIPVLDGELVG------------ALRPS-DAPLTPRQQEALALSDELIA
AZOR_SHIF8       ITVRDLAA--NPIPVLDGELVG------------ALRPS-DAPLTPRQQEALALSDELIA
AZOR_ECO57       ITVRDLAA--NPIPVLDGELVG------------ALRPS-DAPLTTRQQEALALSDELIA
AZOR_ECOL5       ITVRDLAA--NPIPVLDGELVG------------ALRPS-DAPLTPRQQEALALSDELIA
AZOR_ECOL6       ITVRDLAT--NPIPVLDGELVG------------ALRPS-DAPLTPRQQEALALSDELIA
AZOR_CROS8       ITVRDLAA--NPVPVLDGELVG------------ALRPS-DAPLTPRQQDALSLSDELIA
AZOR_YERPE       ITVRDLAA--QPIPVLDGELVG------------ALRPS-GTALTPRQQEALALSDELIA
AZOR_YERPN       ITVRDLAA--QPIPVLDGELVG------------ALRPS-GTALTPRQQEALALSDELIA
AZOR_YERP3       ITVRDLAA--QPIPVLDGELVG------------ALRPS-GTALTPRQQEALALSDELIA
AZOR_YERPP       ITVRDLAA--QPIPVLDGELVG------------ALRPS-GTALTPRQQEALALSDELIA
AZOR_YERPA       ITVRDLAA--QPIPVLDGELVG------------ALRPS-GTALTPRQQEALALSDELIA
AZOR_YERPS       ITVRDLAA--QPIPVLDGELVG------------ALRPS-GTALTPRQQEALALSDELIA
AZOR_YERE8       ITVRDLAA--QPIPVLDGELVG------------ALRPS-DAALTPRQQEALALSDELIA
AZOR_PECAS       ITVRDLAA--QPIPVLDGELVG------------ALRPS-DATLTPRQQEALKLSDDLIA
AZOR_SODGM       ITVRDLGA--QPVPELDGELVG------------ALRPS-DATLTQRQQQALELSDALIG
AZOR_PHOLL       ITVRDLTA--QSIPALDNELVH------------ALRPS-GNEMTARQKETLALSDELIA
AZOR_VIBVY       IVVRDLAQ--QPLPVLDFQVAT------------ALR-A-AGELTAEQQAIVTLSDTLID
AZOR_VIBVU       LVVRDLAQ--QPLPVLDFQVAT------------ALR-A-AGELTAEQQAIVTLSDTLID
AZOR_VIBPA       LTVRDLAA--NPLPVLDFAVAT------------ALR-A-TEDLSQEQQAVVDLSDTLIE
AZOR_SHESH       ISVRDLAA--EPLPMLDGEIAS------------GLR-G-GDQLSARQEQALLLSDSLIQ
AZOR_SHELP       VTVRDLAA--QPLPVLDGEIAM------------GLR-G-GDELSPRQQEVLALSDELVA
AZOR_SHEDO       MTVRDLAA--DPVPVLDGEIAT------------GMR-G-GDNLSPRQQQVLDLSDELIA
AZOR_SHESM       ITVRDLAGK-DVLPMVDGEIAS------------GLR-G-GDDLTARQQEMLDLSNALVE
AZOR_SHESR       ITVRDLAGK-DVLPMVDGEIAS------------GLR-G-GDDLTARQQEMLDLSNALVE
AZOR_SHESA       ITVRDLAGK-DVLPMVDGEIAS------------GLR-G-GAELTARQQEMLDLSNALVE
AZOR_SHEON       ITVRDLAGK-DVLPMVDGEIAS------------GLR-G-GAELTARQQEMLDLSNALVE
AZOR_SHEB9       ITVRDLGGK-DVLPMVDGEIAS------------GLR-G-GAELSARQQEMLALSDTLVA
AZOR_SHEB8       ITVRDLGGK-DVLPMVDGEIAS------------GLR-G-GAELSVRQQEMLALSDTLVA
AZOR_SHEB5       ITVRDLGGK-DVLPMVDGEIAS------------GLR-G-GAELSARQQEMLALSDTLVA
AZOR_SHESW       ITVRDLGGK-DVLPMVDGEIAS------------GLR-G-GAELSARQQEMLALSDTLVA
AZOR_SHEPC       ITVRDLGGK-DVLPMVDGEIAS------------GLR-G-GAELSARQQEMLALSDTLVA
AZOR_SHEFN       IKVRDLGE--NTLPMLDGELAS------------GLR-G-GDNLSERQLSALALSDELVA
AZOR_SHEAM       VTVRDLAA--EPLPVLDGEIAS------------GLR-G-GESLSPRQQEALALSDALIA
AZOR1_PHOPR      VIERDLVA--TPIPVLDGEIAG------------GLR-G-GDTLTARQEEALALSDMLIN
AZOR_PSYIN       ITEHDLAE--QPLPVLDGEIAM------------AMR-S-PEQLNDKQRDALALSDKLIS
AZOR_AERS4       VTVRDLAT--LNLPVLDGELAS------------GLR-G-GDNLNERQLAVMAQSDELIA
AZOR4_BURL3      VIVRNLVD--ADLPMLDSELFH------------ALR-G-AANPSERAQRAIVLSDELIA
AZOR_HAEI8       IVVRDLSQ--QPLPYFDTAAAI------------AVR---GEPKTTEEKQLLALSDKLIE
AZOR_HAEIN       IVVRDLSQ--QPLPYFDTAAAI------------AVR---GEPKTTEEKQLLALSDKLIE
AZOR_HAEIG       IIVRDLSQ--QPLPYFDTVAAI------------AVR---GEPKTIEEKQLLALSDELIE
AZOR_HAEIE       IVVRDLAQ--QPLPYFDTVAAI------------AVR---GEPKTTEEKQLLALSDELIE
AZOR_HYPNA       VVRRDLGA--NPVPHLTTANLA------------GVR---GTPSTSEELAARALSDELIA
AZOR2_PSEF5      ITVRDLAR--NPVPHLDANLLG------------GWMKP-AEQRSAAEQDSLQRSNELTE
AZOR2_PSEPF      ITVRDLAV--NPVPHLDINLLG------------GWMKS-AEQRNDSEQASLDRSNELTD
AZOR2_PSEPK      ITVRDLAV--SPVPHLDANLLG------------GWMKP-EEQRSAAELEALARSNELTD
AZOR3_PSEAE      FQVRDLAR--EPLPHLDELLLG------------AWTTP-CDGHSAAERRALERSNRLTE
AZOR_AROAE       VVVRSLAQ--NPHPVLDEAALG------------ALFTP-ADKRTPEQTARVALDDVLIA
AZOR_DECAR       VELRDLAS--HPHPVLDEPALG------------ALFTP-ADQRTAEQSARVALDDALIA
AZOR_AZOSB       VTVRDLAK--NPVPVLDEAALG------------ALFAP-VESRSTDQAARVAASDALIA
AZOR_BURP1       VKVRNLLA--DALPHLDDAVLG------------AFFTP-ADQRSAEQNAIVAKSDELVD
AZOR_BURPS       VKVRNLLA--DALPHLDDAVLG------------AFFTP-ADQRSAEQNAIVAKSDELVD
AZOR_BURMA       VKVRNLLA--DALPHLDDAVLG------------AFFTP-ADQRSAEQNAIVAKSDELVD
AZOR_BURTA       VKVRSLLA--DALPHLDDAVLG------------AFFTP-AEQRSAEQNAIVAKSDALID
AZOR6_BURL3      VVVRDLLA--DALPHLDESVLG------------AFFTP-ADKRTAEQNAIVAKSDALIA
AZOR_ALCBS       VRVRDLST--DPIPHLDGNRVS------------AFFTS-ATQRTDEQQAIDAFSLALID
AZOR_BORPA       VKIRDLAA--DPVPYFDGATVG------------ALFTP-AEARNAEQQRIAALSDDLVA
AZOR_BORBR       VKIRDLAA--DPVPYFDGATVG------------ALFTP-AEARNAQQQRIAALSDDLVA
AZOR_BORA1       ITVRDLAA--QPVPYFDAETAG------------ALFTP-ADARSDAQRAIVALSDALIA
AZOR_SACD2       IVKRNLAA--EPIPHLDLATIT------------AIGEG-KP----------VIGDTLIQ
AZOR_MARMS       VVARDVTA--NPLPHFTGETLG------------ALFTP-EENRTAEQQAIVAIGDELIA
AZOR_RHIL3       VVRRDLAA--NPLPHIDDLFTG------------AIRKP-PEARTAEETVAVKTSDELVN
AZOR1_RHIEC      VVRRDLAA--TPLPHIDDLFTG------------AIRKP-AEARTAEEIAAVKTSDELVA
AZOR_AGRFC       LVHRDLAA--DPIPHLDTVKTA------------AIRKP-ADQRTAEESVAADYSDKLVT
AZOR_RHILO       LVVRDLVA--NPLPHIDADYAT------------GIYTP-VEARTPRQAEVVGVSDVVLD
AZOR2_RHIEC      LSRRDLAA--NPPPHIAQAYIG------------GRVVG-PETRTPEQAKAVGLAQELVD
AZOR_AZOC5       LLTRDLAA--NPPPHITQAYIH------------GRVTP-PEARTPEQVEAVALAQEFVD
AZOR1_BURL3      VTLRDLSN--DPLPHIDDAYIV------------GRMLP-SDARSAEQAQAVELAQALVD
AZOR_HERAR       VVERDLAA--QPLPHIDGSTLG------------AFFTP-AEQRTPEQAQIATLSETLVR
AZOR1_HAHCH      VVSRDV-SG-GLPFVTEEWIGA------------SYTPA--DQRTEAQNQALALSDSLIE
AZOR1_JANSC      VTIRDL-TT-AIPQLDEAWIGA------------NFTPA--DQRTAQQQETLSLSDTLVA
AZOR_THIDA       VVRRE--AA-GMPFVDDAWVGA------------NSTDP--EARDSAQRWALAKSDELVS
AZOR1_COLP3      VTIRDL-AD-GIPLIDENWIKA------------NFTDV--DERTCEQKVCLVASDILVD
AZOR_RHOS1       VVSRDL-AQ-GIRQIDGPWLGS------------VFTAP--EQRTADQQEIARTADAVMA
AZOR_RHOS4       VVSRDL-AQ-GIRQIDGPWLGS------------VFTAP--EQRTADQQEIARTAGAVMA
AZOR_ERYLH       VITRDLSQN-DIPYVDADRFAA------------NLSPY--TERSPEQQELAAIADTLIE
AZOR_PELUB       VIYRDL-DD-DMLFVSGLTESG------------MKIAE--KDQTEEHKKMFELSDKLVS
AZOR_NOSS1       VTYRDLGH--NPVPHVDEP------------WIAAAFSS-PESHTPELKTAIELSDTLID
AZOR2_TRIV2      VTYRDLGH--NPVPHVDEP------------WIAAAFSS-PDSHTPELKAAIELSDTLID
AZOR1_TRIV2      VIYRDLGR--YPVPAIDEA------------WIAAAFCP-PAQLTPELQSALMISDELIA
AZOR_FRACC       ITYRDLSV--TPPPHLDWA------------TVSARFTP-PEQLSAEQAEAVKKGEELIA
AZOR_FRAAA       VTYRDLAL--TPPPHLDWA------------TLSAAFTP-PEQHTPEQTEGVKLREELIG
AZOR_STRAW       VIYRDLSA--NPVPHITAD------------AHTAGFAD-PATHTPGQAAAFAEREKLIA
AZOR_NOCFA       YIHRDLAA--DPVPFIDAAWTEICDAVLAAGGTDLAALP-TLVRTPAQAAAWRIVEPLLD
AZOR1_PSEAE      VARREVGR--VPLPAVTEA------------FVAAAFHPQPEQRSLAMQADLALSDQLVG
AZOR1_PSEPF      VTRREVGR--ALIPAVNEA------------FVAAAFYPEPEARPLTMQADLALSDQLVG
AZOR1_PSEF5      LTRREVGR--GALPHVSEA------------FIAAAFYPQPEARPLSMQADLALSDELVA
AZOR_GRABC       VTTRDLME--TDLQFIGAP------------WLQAYFTP-SEQHSPEMKAELALSDELVG
AZOR2_JANSC      VVQRDLTG--TGLEFVTAP------------WLEAYFTP-PDQHTDAMKQALALSDELVA
AZOR8_BURL3      VIQRDLMA--TDLPFVTMP------------WLGAYFTP-PEHQTQDMKNLLRLSDELVA
AZOR3_BURL3      VVERDLCR--IAMPPIDAA------------WIAANFTP-PDRRTAQQNEMLALSTTFTT
AZOR_HYDCU       FQTLDLSQ--TPPPHLSEATIG-------------AMFTPTEERSKEQTQQLALSTDYIE
AZOR_BRASO       IVVRDLVD--APVPHISELTIQ-------------GYYTPPAQMTPQLRTATALSDQLIA
AZOR4_PSEF5      LVERDLGA--NPLPPLGMDYAH------------ALTTP-TPFDAP----LFEVSEGLIG
AZOR5_BURL3      VVSRSLGQ--PGLPSISADYAH------------ALVAR-QPDSDP----ALACSEQLIA
AZOR2_CUPPJ      VIDRDLAA--DPVPHIDGAMAR------------ASLMP-AADRGPAEHAALALSETLIG
AZOR_ALKEH       VRVVDLAD--TPPPHVDAATIR--------------HFFGLAGAEEPATASLALSDTWIE
AZOR2_HAHCH      ETVLDLSQ--EPLPHLDGFTIE------------AFFTE-PEQRTEQQKNAVRLSDRMVD
AZOR_DESVV       VRVLDVFEA-DLPAFGTDAVVA------------RYLSGQGDPLSPAQEAAWAAVKRQVE
AZOR_DESVH       VRVLDVFEA-DLPAFGTDAVVA------------RYLSGQGDPLSPAQEAAWAAVKRQVE
AZOR3_PSEF5      VTTLDLWSL-DLPELDQTAMDA------------KYAQLAGQPLGNAEQRAWARLQALAE
AZOR2_BURL3      VDTLNVWEE-DLPDFDSGAIGA------------KYKGVANAPMDEAEQSIWRRIQSLVK
AZOR9_BURL3      IQKLDIWNL-AIPEFDEAALAA------------KYAGLSGKALTPSQATAWQRIEQLAA
AZOR_DESPS       IETLDLWDF-PLPEVDGSYLSA------------KYKILHWQDPTEAEARAWTEIANIVS
AZOR2_PSESM      VDVLDVWTI-DLLPFDGPALEA------------KYADLQGVQMSDEQQAVWKQIHALGE
AZOR1_BRADU      IDVMDLWRE-RMPEFAGPIVEA------------KYARMKAEAFDDAQRDSFAEAERMAT
AZOR_RUEPO       VDHLDLWAE-DLPAFDGDPAAA------------KMTFFGVGQMDPSKEQAWSAVARITE
AZOR_MYCPU       FIYMNLNDEKMASITMTSHNMKE-------------------------YFVAEYSDKYIN
AZOR_MYCPE       VITLDLNEVPMAQKTLNGSNLKN-------------------------FFNQEDSDFYID
AZOR_MYCMO       IIELNLND-QKDLISLSSQNFNT-------------------------FFTDGVSDKYID
AZOR_MYCS5       LEFVDLNTTKHAEVFLSRNTFAT-------------------------YWKDVESDKWID
AZOR_MYCMS       IIIVDLNKDEVGTSILTSETSST-------------------------FYQQEVTKKYIN
AZOR_MYCCT       IIIVDLNKDEVGTSILTSETFPT-------------------------FYQQEVTKKYIN
AZOR1_MESFL      IIELDLNKLVVGTNVLTTETFST-------------------------YWGEEEGMKYIN
AZOR_MYCGA       VSWLDLNELDKGSMTLTSKNSKE-------------------------HFKDENVDPLIN
AZOR_MYCGE       FIDWNLNELPVGKISYNTQNASN-------------------------FFSFENSDYYID
AZOR_MYCPN       LSTWNLNELPVGQISYNTQNAGT-------------------------FFSVENSDKYID
AZOR_MYCH7       IEVYDLNQFGLANTNLTMKNFEDK-----------------------TFYQKAESDFWIN
AZOR_MYCH2       IEVYDLNQFGLANTNLTIKNFEDK-----------------------TFYQKAESDFWIN
AZOR_MYCHJ       IEVYDLNQFGLANTNLTMKNFEDK-----------------------TFYQKAESDFWIN
AZOR2_MESFL      IINLDLNETKMSQKTLTRNNIAE-------------------------YFNQEDSFDFIE
AZOR2_COLP3      VIYRDLGL--NPPDFISQDWIA------------AVFTP-DEKQSEEQKSLLTLSDTLID
AZOR2_PHOPR      TDRLDLTT--EEYPHLNSDTLS------------------------NFMNPHSNLATQSK
                                                                             

AZOR1_BACSU      QFVKADKVVFAFPLWNFTVPAVLHTYVDYLSRAGVTFKYTQEGP----VGLMGG--KKVA
AZOR1_BACLD      EFVKADKVVFAFPLWNFAVPAVLHTYVDYLSRAGVTFTYTPEGP----KGLMGD--KKVA
AZOR2_BACHD      QFVEADKVVFAFPLWNFTIPAALHTYMDYLARAGVTFNYTAEGP----VGLMGD--KKVA
AZOR4_BACAN      QFLEADKVVFGFPLWNLTIPAVLHTYIDYLNRAGKTFKYTPEGP----VGLIGD--KKIA
AZOR3_BACHK      QFLEADKVVFGFPLWNLTIPAVLHTYIDYLNRAGKTFKYTPEGP----VGLIGD--KKIA
AZOR4_BACCZ      QFLEADKVVFGFPLWNLTIPAVLHTYIDYLNRAGKTFKYTPEGP----VGLIGD--KKIA
AZOR4_BACC1      QFLEADKVVFGFPLWNLTIPAVLHTYIDYLNRAGKTFKYTPEGP----VGLIGD--KKIA
AZOR3_BACCR      QFLEADKVVFGFPLWNLTIPAVLHTYIDYLNRAGKTFKYTPEGP----VGLIGD--KKIA
AZOR2_BACCZ      QFLEADKVVFAFPLWNFTVPAPLITYISYLSQAGKTFKYTANGP----EGLAGG--KKVV
AZOR1_BACHK      QFLEADKVVFAFPLWNFTVPAPLITYISYLSQAGKTFKYTANGP----EGLAGG--KKVV
AZOR2_BACAN      QFLEADKVVFAFPLWNFTVPAPLITYISYLSQAGKTFKYTANGP----EGLAGG--KKVV
AZOR2_BACC1      QFLEADKVVFAFPLWNFTVPAPLITYISYLSQAGKTFKYTANGP----EGLAGG--KKVV
AZOR1_BACCR      QFLEADKVVFAFPLWNFTVPAPLITYISYLSQAGKTFKYTANGP----EGLVGG--KKVV
AZOR_BACSK       QFLNADKVVFAFPLWNFTVPAPLITYLSYLAQAGKTFRYTETGP----VGLVGS--KEVA
AZOR1_BACHD      QFLAADKIVFAFPLWNLTVPAVLHTYLDYLHHPRKTFTYTEEGL----VGLLPN--KKVA
AZOR1_LISMF      QFLAADKIVMAFPLWNFSIPAQFLTYLFYLNQAGKTFKYTANGP----VGLVAD--KKIA
AZOR1_LISMO      QFLAADKIVMAFPLWNFSIPAQFLTYLFYLNQAGKTFKYTANGP----VGLVAD--KKIA
AZOR1_LISIN      QFLAADKIVMAFPLWNFSIPAQFLTYLFYLNQAGKTFKYTANGP----IGLVTD--KKIA
AZOR_GEOKA       QFISADKYVFVTPMWNFSFPPVLKAYIDAVAVAGKTFKYTEQGP----VGLLTD--KKAL
AZOR_GEOSE       QFISADKYVFVTPMWNFSFPPVLKAYIDAVAVAGKTFKYTEQGP----VGLLTD--KKAL
AZOR3_BACHD      QFVAADKYVFVTPLWNFSFPPVLKAYIDAVAVAGKTFKYTEQGP----VGLLTD--KKAL
AZOR2_BACSU      QFASADKYVFVTPLWNFSFPPVMKAYLDSVAVAGKSFKYTEQGP----VGLLTD--KKAI
AZOR_BACVZ       QFAAADKYVFVTPLWNFSFPPVMKAYLDSVAVAGKSFKYTEQGP----IGLLTD--KKAL
AZOR2_BACLD      QFIAGDKYVFVTPLWNFSFPPVMKAYFDAVAVAGKTFKYTEQGP----IGLLTD--KKAL
AZOR_BACP2       QFVSADKYVFVSPLWNFSFPPVLKAYIDSVAVAGKTFKYTEQGP----VGLLTD--KKAL
AZOR_STAA9       EFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGP----QGLLTD--KKVL
AZOR_STAA2       EFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGP----QGLLTD--KKVL
AZOR_STAAN       EFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGP----QGLLTD--KKVL
AZOR_STAAC       EFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGP----QGLLTD--KKVL
AZOR_STAA8       EFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGP----QGLLTD--KKVL
AZOR_STAAT       EFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGP----QGLLTD--KKVL
AZOR_STAA3       EFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGP----QGLLTD--KKVL
AZOR_STAAS       EFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGP----QGLLTD--KKVL
AZOR_STAAW       EFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGP----QGLLTD--KKVL
AZOR_STAAB       EFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGP----QGLLTD--KKVL
AZOR_STAA1       EFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGP----QGLLTD--KKVL
AZOR_STAAM       EFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGP----QGLLTD--KKVL
AZOR_STAAR       EFLSADKYVLVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGP----QGLLTD--KKVL
AZOR_STAHJ       EFLEADKYVFVSPMWNLSFPPVLKAYIDAISIAGKTFKYTAEGP----QGLLTD--KKVL
AZOR3_BACCZ      TFMNADRYVFVTPMWNFSYPPVVKAYLDNVAIAGKTFKYTENGP----VGLLEG--KKAL
AZOR2_BACCR      TFMNADRYVFVTPMWNFSYPPVVKAYLDNVAIAGKTFKYTENGP----VGLLEG--KKAL
AZOR3_BACC1      TFMHADRYVFVTPMWNFSYPPVVKAYLDNLAIAGKTFKYTENGP----VGLLEG--KKAL
AZOR2_BACHK      TFMHADRYVFVTPMWNFSYPPVVKAYLDNLAIAGKTFKYTENGP----VGLLEG--KKAL
AZOR3_BACAN      TFMHADRYVFVTPMWNFSYPSVVKAYLDNLAIAGKTFKYTENGP----VGLLEG--KKAL
AZOR_GEOUR       QFIAADKYVFVTPMFNLGFPAELKMYIDAVCVVGKTFAYTPTGP----VGLLKDQGRKCL
AZOR2_LISMF      QFLAADKYVFVFPLWNLGIPPLLKAYIDTFVIAGKSFRYTEHGP----EALLKD--KKAI
AZOR2_LISMO      QFLAADKYVFVFPLWNLGIPPLLKAYIDTFVIAGKSFRYTEHGP----EALLKD--KKAI
AZOR2_LISIN      QFLAADKYVFVFPLWNLGIPPLLKAYVDTFVIAGKSFRYTEHGP----EALLKG--KKAI
AZOR_CLOP1       QFADADKYIIAAPMWNLSFPAILKAYIDYVSVSGITFKYTAEGP----VGLLNN--KKAV
AZOR2_CLOPE      QFADADKYIIAAPMWNISFPAILKAYIDYVSVSGITFKYTAEGP----VGLLNN--KKAV
AZOR_CLOPS       QFADADKYIIAAPMWNLSFPAILKAYIDYVSVSGITFKYTAEGP----VGLLNN--KKAV
AZOR_CLOB8       QFAEADKYVIAAPMWNLSIPAILKAYVDYISVVGIAFKYTQEGA----VGLLEN--KKAV
AZOR2_CLOAB      QFAEADKYVIAAPFWNLSFPAILKAYIDYICVTGITFKYTEEGA----VGLCQG--KKAV
AZOR_LACP7       QFAEADKYVIAAPMWNLGSPAILKAYFDYITITGITFHYTAEGP----KGLLQN--KKAV
AZOR_CALS8       QFLEADKYVFAAPMWNLGIPAILKAYIDYITVSGITFKYTEQGA----VGLLRG--KKAV
AZOR_LACLS       QFLSADKVVIANPMYNLMIPAELKSWVDTVNVAGKTFKYTAEGP----VGLANG--KKVL
AZOR2_LACLA      QFLSADKVVIANPMYNLMIPAELKSWVDTVNVAGKTFKYTAEGP----VGLANG--KKVL
AZOR_ENTFA       QFLSADKVVIANPMWNLNVPTRLKAWVDTINVAGKTFQYTAEGP----KPLTSG--KKAL
AZOR_STRS2       QFLAADKIVVVNPLWNLNVPSQLVSWINTINVAGLTFKYGPEGS----IGLVKG--KKLL
AZOR2_LACPL      EFLAADKIVFVNPMYNHFLPAELKQYLDLTAVARKTFKYTVNGP----VGLLPD--KHVL
AZOR1_LACLA      EFLSADKYVFVNPMYNGFVTAELKQYIDVIAVPRKLFRYTENGP----IGLLEG--KKSL
AZOR1_BACCZ      QFKSANTYVIVLPLHNFNIPSKLKDYMDNIMIARETFKYTETGS----VGLLKDG-RRML
AZOR1_BACC1      QFKSANTYVIVLPLHNFNIPSKLKDYMDNIMIARETFKYTETGS----VGLLKDG-RRML
AZOR1_BACAN      QFKSANTYVIVLPLHNFNIPSKLKDYMDNIMIARETFKYTETGS----VGLLKDG-RRML
AZOR_STRA5       QFKSHHRIVFVSPMHNYNVTARAKTYIDNIFIAGETFKYTENGS----VGLMTDD-YRLL
AZOR_STRA3       QFKSHHRIVFVSPMHNYNVTARAKTYIDNIFIAGETFKYTENGS----VGLMTDD-YRLL
AZOR_STRA1       QFKSHHRIVFVSPMHNYNVTARAKTYIDNIFIAGETFKYTENGS----VGLMTDD-YRLL
AZOR1_LACPL      QFKAHHRIVIAMPLHNFNVPARLKDYIDNILVARETFRYTENGS----VGLMTDN-YRVM
AZOR_CUPNH       EFLAADVLVVGVPQYNFSIPSQLKAWIDRIAQAGRTFKYTENGP----VGLAGG--KRVI
AZOR1_CUPPJ      EFLAADVLVVGVPQYNFSIPSQLKSWIDRIAQAGRTFKYTENGP----VGLAGG--KRVI
AZOR_AZOBR       EFLAADVVVIGAPMYNFTVPTQLKAWIDRIAQAGRTFRYTETGP----VGLAGG--KKVY
AZOR2_XANC5      EFLASDIVVIGAPMYNFSVPTQLKAWIDRIAQPGRTFRYTANGP----EGLAGG--KQLI
AZOR2_XANAC      EFLASDIVVIGAPMYNFSVPTQLKAWIDRIAQPGRTFRYTANGP----EGLAGG--KQLI
AZOR_RALSO       ELLASDVIVVGAPMYNFSVPSQLKAWIDRVAQAGRTFKYTETGP----VGLTGG--KKVI
AZOR_ACISJ       QFLAADVVVIGAPFYNFAIPTQLKAWIDRIAQPGRTFQYTANGP----EGLAKG--KTVI
AZOR_RHOFT       QFLASDVIVIGAPFYNFSIPTQLKAWIDRLAQPGRTFTYNEKGP----LGLATG--KTVI
AZOR1_XANAC      QFLQADVIVIGAPMYNFAIPSTLKAWIDRIAVAGRTFQYTANGP----EGLAGG--KRVI
AZOR1_XANC5      QFLQADVIVIGAPMYNFAIPSTLKAWIDRIAVAGRTFQYTANGP----EGLAGG--KRVI
AZOR_XANOR       QFLQAEVIVIGAPMYNFAIPSTLKAWIDRIAVAGRTFHYTANGP----EGLAGG--KRLI
AZOR_XANOM       QFLQAEVIVIGAPMYNFAIPSTLKAWIDRIAVAGRTFHYTANGP----EGLAGG--KRLI
AZOR3_PSEPF      EFITADAIVVAAPMYNFTVPTQLKAWIDRIAVAGQTFRYTEAGP----EGLCGG--KKVV
AZOR5_PSEF5      EFKAADTVVVAAPMYNFTIPTQLKAWIDRIAVAGETFRYTEAGP----QGLCGG--KKVI
AZOR1_PSEPK      EFLAADAVVIGAPMYNFTVPTQLKAWIDRVAVAGKTFRYTEAGP----QGLCGN--KKVV
AZOR2_PSEAE      EFLAADVVVIGAPMYNFTISSQLKAWIDRIAVAGKTFRYTENGP----VGLAGD--KKVV
AZOR_PSE14       QFLAAEVLVIGAPMYNFTIPSQLKAWFDRIMVAGRTFRYSEAGP----EGLCGG--KKVI
AZOR_PSEU2       QFLDSDVLVIGAPMYNFTIPTQLKAWFDRILIAGRTFRYSEAGP----EGLCGG--KKVI
AZOR1_PSESM      QFLDADVLVIGAPMYNFSIPSQLKAWIDRIAVAGRTFRYSEAGP----EGLCGG--KKVI
AZOR_RHIME       EFLAADTVVVGAPMYNFSIPSQLKAWIDRLAVAGKTFRYTEAGP----EGLAKG--KKLI
AZOR_SINMW       EFLAAETVVVGAPMYNFSIPSQLKAWIDRLAVAGKTFRYSEAGA----EGLAKG--KKVI
AZOR7_BURL3      EFLAADIVVIGAPMYNFGIASQLKAWIDRISVAGTTFRYGENGP----VGLCGG--KKLV
AZOR_BRASB       DFLAADVIVIGAPMYNFGVPSQLKAWIDRLAVPGKTFSYGEHGP----VGLCKG--KKVI
AZOR2_BRADU      EFLAADVVVIGAPMYNFTIPSQLKAWIDRILVAGKTFQYGANGP----QGLAGA--KRVI
AZOR_RHOPB       EFLAADTVVIGAPMYNFTIPTQLKAWIDRILVAGKTFSYSGGTV----QGLAAG--KRVI
AZOR_XANCP       EFLDADTVVIGVALYNFTISTQLKAWIDRVLVAGKTFRYTAEGA---LEGLAGN--KRVI
AZOR_GLUDA       EFLTADIVVIGAPMYNFTIPTQLKSWLDRVLVPGRTFKYGPEGV----KGLVEG--KRVI
AZOR_GLUOX       DFKAADIVVIGVPMYNLSIPSQLKAWIDRIMVAGQTFRYTSGGG---IEGLAKG--KKVV
AZOR_CHRVO       EFIAADVLVIGAPMYNFSIPTQLKSWIDRVAAAGRTFKYTENGP----VGLVPN--KKVV
AZOR_LEGPH       ELLSASVLVIGAPMYNFSIPSQLKSWIDRIVIAGKTFKYVDGKV----QGLATG--KRAY
AZOR_SALPA       ELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGITFRYTEKG----PEGLVTG--KRAV
AZOR_SALTI       ELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGITFRYTEKG----PEGLVTG--KRAV
AZOR_SALTY       ELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGITFRYTEKG----PEGLVTG--KRAV
AZOR_SALPB       ELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGITFRYTEKG----PEGLVTG--KRAV
AZOR_SALCH       ELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGITFRYTEKG----PEGLVTG--KRAV
AZOR_SALAR       ELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGVTFRYTEKG----PEGLVTG--KRAV
AZOR_CITK8       ELQAHDVIVIAAPMYNFNIPTQLKNYFDLVARAGVTFRYTEKG----PEGLVTG--KRAV
AZOR_SHIBS       ELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENG----PEGLVTG--KKAI
AZOR_ECOUT       ELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENG----PEGLVTG--KKAI
AZOR_ECO24       ELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENG----PEGLVTG--KKAI
AZOR_SHISS       ELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENG----PEGLVTG--KKAI
AZOR_SHIDS       ELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENG----PEGLVTG--KKAI
AZOR_ECOLC       ELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENG----PEGLVTG--KKAI
AZOR_ECOHS       ELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENG----PEGLVTG--KKAI
AZOR_ECOLI       ELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENG----PEGLVTG--KKAI
AZOR_SHIFL       ELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENG----PEGLVTG--KKAI
AZOR_SHIF8       ELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENG----PEGLVTG--KKAI
AZOR_ECO57       ELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENG----PEGLVTG--KKAI
AZOR_ECOL5       ELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTEKG----PEGLVTG--KKAI
AZOR_ECOL6       ELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTEKG----PEGLVTG--KKAI
AZOR_CROS8       ELQAHDVIVIAAPMYNFNIPTQLKNYFDLVARAGVTFRYTEKG----PEGLVTG--KRAI
AZOR_YERPE       ELQANDVIVIAAPMYNFNIPTQLKNYFDMIARAGVTFRYTEKG----PEGLVTG--KRAI
AZOR_YERPN       ELQANDVIVIAAPMYNFNIPTQLKNYFDMIARAGVTFRYTEKG----PEGLVTG--KRAI
AZOR_YERP3       ELQANDVIVIAAPMYNFNIPTQLKNYFDMIARAGVTFRYTEKG----PEGLVTG--KRAI
AZOR_YERPP       ELQANDVIVIAAPMYNFNIPTQLKNYFDMIARAGVTFRYTEKG----PEGLVTG--KRAI
AZOR_YERPA       ELQANDVIVIAAPMYNFNIPTQLKNYFDMIARAGVTFRYTEKG----PEGLVTG--KRAI
AZOR_YERPS       ELQANDVIVIAAPMYNFNIPTQLKNYFDMIARAGVTFRYTEKG----PEGLVTG--KRAI
AZOR_YERE8       ELQANDVIVMAAPMYNFNIPTQLKNYFDLIARAGVTFRYTEKG----PEGLITG--KRAI
AZOR_PECAS       ELQAHDVIVIAAPMYNFNIPTQLKNYFDLVARAGVTFRYTEQG----PEGLVKG--KRAI
AZOR_SODGM       ELQANDVLVFTAPMYNFAIPSKLKNYFDLIARASVTFRYSEQG----PERLVKN--KRAL
AZOR_PHOLL       ELQDNDVIVITAPMYNFHIPTQLKSYFDMIARAGVTFRYTENG----PEGLLKG--KQVI
AZOR_VIBVY       EIKAADTLVIAAPMYNFTIPTQLKNWIDLIARAGVTFTYTEQG----PKGLIEG--KKAV
AZOR_VIBVU       EIKEADTLVIAAPMYNFTIPTQLKNWIDLIARAGVTFTYTEQG----PKGLIEG--KKAV
AZOR_VIBPA       EVKAADTLVIAAPMYNFTIPTQLKNWIDLIARAGVTFKYTENG----VQGLIEG--KKAI
AZOR_SHESH       ELKAHDTIVIAAPMYNFSIPTQLKNWIDLVARAGVSFTYTETG----PKGLITG--KRAV
AZOR_SHELP       ELKAHDTLVIAAPMYNFSIPTQLKNWIDLVARAGVTFTYTETG----PKGLVEG--KRAV
AZOR_SHEDO       ELKSHDTLVIAAPMYNFSIPTQLKNWIDLIARAGVTFTYTETG----PKGLLEG--KRAV
AZOR_SHESM       ELKANDTIVITAPMYNFNIPTQLKNWIDFVARAGVTFTYTENG----PKGLVEG--KRAV
AZOR_SHESR       ELKANDTIVITAPMYNFNIPTQLKNWIDFVARAGVTFTYTENG----PKGLVEG--KRAV
AZOR_SHESA       ELKANDTIVITAPMYNFNIPTQLKNWIDFVARAGVTFTYTENG----PKGLVEG--KRAV
AZOR_SHEON       ELKANDTIVITAPMYNFNIPTQLKNWIDFVARAGVTFTYTENG----PKGLVEG--KRAV
AZOR_SHEB9       ELKANDTIVIAAPMYNFTIPAQLKNWIDFIARAGVTFTYTETG----PKGLVEG--KRAV
AZOR_SHEB8       ELKANDTIVIAAPMYNFTIPAQLKNWIDFIARAGVTFTYTETG----PKGLVEG--KRAV
AZOR_SHEB5       ELKANDTIVIAAPMYNFTIPTQLKNWIDFIARAGVTFTYTETG----PKGLVEG--KRAV
AZOR_SHESW       ELKANDTIVIAAPMYNFTIPAQLKNWIDFIARAGVTFTYTETG----SKGLVEG--KRAV
AZOR_SHEPC       ELKANDTIVIAAPMYNFTIPAQLKNWIDFIARAGVTFTYTETG----SKGLVEG--KRAV
AZOR_SHEFN       EIKAHDTIIIAAPMYNFGIPTTLKNWIDLIARAGVTFTYTDTG----AVGLIEG--KRAI
AZOR_SHEAM       ELKVHDQLVVAAPMYNFSIPTQLKNWIDLVARAGVTFTYTAEG----PQGLIQG--KQAM
AZOR1_PHOPR      ELQNSDTIVIAAPMYNFSVPTQLKNWFDIIARAGVTFSYTENG----PVGLITG--KKVI
AZOR_PSYIN       ELVASDLLVIAAPMYNFMIPTQLKNWIDLVARAGKTFSYTEQG----PQGLISG--TRAI
AZOR_AERS4       ELKGSDLVVIAAPMYNFSIPTQLKNWIDLIARAGVTFRYTETG----PVGLVEN--TRAL
AZOR4_BURL3      ELKGSDLLLIGAPMYNLNVPTQLKNWFDLVARARVTFRYTETY----PVGLVEG--ISAI
AZOR_HAEI8       ELKNAQTLIIGAPMYNLNVPTQLKSYFDFIARPRVTFQYTANG----SEGLLKG--KKAI
AZOR_HAEIN       ELKNAQTLIIGAPMYNLNVPTQLKSYFDFIARPRVTFQYTANG----SEGLLKG--KKAI
AZOR_HAEIG       ELKNAQTLIIGAPMYNLNIPTQLKSYFDFIARPSVTFQYTAKG----PEGLLKG--KKVI
AZOR_HAEIE       ELKNAQTLIIGAPMYNLNIPTQLKSYFDFIARPRVTFQYTAKG----PEGLLKG--KKAI
AZOR_HYPNA       ELKAAGTVIIAAPMYNFSVPTSLRSWFDFVLRAGETFKYSEAG----PEGLLKG--KKVV
AZOR2_PSEF5      ELLAADVLVMAAPMYNFAIPSTLKAWLDHVLRAGVTFKYTDTG----PQGLLTG--KRAY
AZOR2_PSEPF      ELLAADVLVMAAPMYNFAIPSTLKAWLDHVLRAGVTFKYTETG----PQGLLSG--KRAY
AZOR2_PSEPK      ELLAADVLVMAAPMYNFTIPSTLKAWLDHVLRAGITFKYTPTG----PQGLLTG--KRAI
AZOR3_PSEAE      ELRMADVLVLAAPMYNFAIPSSLKSWFDHVLRAGLTFRYAEQG----PEGLLQG--KRAF
AZOR_AROAE       EIQAADAVVIGVPMYNFGVPVQLKNWIDAITRVKVTFRYTANG----PEGLLKD--KKVY
AZOR_DECAR       QVQSVDAIVLGVPMYNFGVPVQLKTWIDAIARAGVTFHYTEKG----PEGLLKG--KKVY
AZOR_AZOSB       EVQAADVLVLGVPMYNFTVTAQFKNWIDAIARAGVTFRYTANG----PEGLLKG--KTVY
AZOR_BURP1       ELRSADVIVIGAPMYNFGVSSQLKAYFDWIARAGVTFRYTSEG----PEGLIKG--KKAY
AZOR_BURPS       ELRSADVIVIGAPMYNFGVSSQLKAYFDWIARAGVTFRYTSEG----PEGLIKG--KKAY
AZOR_BURMA       ELRSADVIVIGAPMYNFGVSSQLKAYFDWIARAGVTFRYTSEG----PEGLIKG--KKAY
AZOR_BURTA       ELRSADVIVIGAPMYNFGVSSQLKTYFDWIARAGVTFRYTAQG----PEGLLKG--KKVY
AZOR6_BURL3      ELQAADVIVIGAPMYNFGISSQLKTYFDWIARAGVTFRYTENG----PEGLIKG--KKVH
AZOR_ALCBS       EIKAADHIVLGLPMYNFGIPSQLKSWIDHVARAGITFRYTEKG----PQGLLEN--KPVT
AZOR_BORPA       ELFDADRIVFAVPVYNFNLPAQFKSYIDHIARAGVTFRYTAEGK---PEGLVQG--KQVL
AZOR_BORBR       ELFDADRIVFAVPVYNFNLPAQFKSYIDHIARAGVTFRYTAEGK---PEGLVQG--KQVL
AZOR_BORA1       ELQAAERVVFAVPTYNFNLPAQLKSYLDYVARAGITFRYTPEGV---PEGLLQG--KQVY
AZOR_SACD2       ELKDADIVVLGVPMYNFGVPSGLKAWFDHIARAGSTFKYTETG----PVGLLEN--KKVY
AZOR_MARMS       ELEAADLVIVSAPMYNFGIPSTLKSYFDHVARAGRTFKYTETG----PVGLV-N--KDAY
AZOR_RHIL3       ELLAADTIVISTGLINFNIYSSLKTWIDNVARAGLTFKYTESG----PVGLATG--KKVY
AZOR1_RHIEC      ELFAADTIVISTGLINFNIYSSLKTWIDNVARAGVTFKYTESG----PVGLVTG--KKVY
AZOR_AGRFC       ELLAADTVVIGTGLINFNIYSGLKSWIDNVARAGQTFKYTETG----PVGLATG--KKVY
AZOR_RHILO       ELFAADTVILATGFINFNISSTLKSWVDHIARSGRSFAYGENG----PKGLVTG--KKVY
AZOR2_RHIEC      EVTAADVIVLGSGMINFGPSSQLKAWFDHITWPGVTFGYSAAGK---PQGLLTG--KKVY
AZOR_AZOC5       EVKAADVIVLGSGMINFGPSSQLKAWFDHITWPGVTFGYGEAGR---PQGTLTG--KKVY
AZOR1_BURL3      ELRAADIVVIGSAMTNFGPSTQLRAWFDRVIWPQVTFRYGESG----VAGTLEG--KQVY
AZOR_HERAR       ELFDADVIVIGAPMYNFSITSGLKAWIDHVARAGVTFKYTDKG----PVGLLTG--KKVY
AZOR1_HAHCH      EVQAADTLVIAVPMYNFSVPATLKAYIDQICRAQVTFRYTEQGP----VGLLEN--KKAY
AZOR1_JANSC      EVQAADTLVIGLPIYNFGVPAALKAWVDQIARAGVTFQYTETGP----KGLLEG--KRAI
AZOR_THIDA       EVMAADVLVIATPIYNFGVPASLKAWVDQVARARLTFRDTEYGP----EGLLTG--KKAY
AZOR1_COLP3      ELYKAEHIVIGLPIYNFGVPAAFKAWIDQVVRSKLTFRYGDNGP----VGLVEN--KKAY
AZOR_RHOS1       EVKEADILVIALPVYNFGAPAQLKSWVDHIARRGESFVYTETGP----VGLLTG--KRAI
AZOR_RHOS4       EVKEADILVIALPVYNFGAPAQLKSWVDHIARRGESFVYTETGP----VGLLTG--KRAI
AZOR_ERYLH       ELQAADTIVLGVPIYNFSVPATVKAWADTVARAGTTFEYTPTGP----KGKLDG--KKAY
AZOR_PELUB       ELKESDIIIISAPIYNYGPPATLKAWCDLAARIGETFKFKPNGR---REGLLKN--KQAY
AZOR_NOSS1       EFLAADRLVFGVPMYNLNIPSTFKAYIDQIVRAGKTFTVDANG---YKGLVDSS--KKVL
AZOR2_TRIV2      EFLAADRFVFGVPMYNLNIPSTFKAYIDQIVRVGRTFSVDANG---YKGLVDSS--KKVL
AZOR1_TRIV2      ELLAANLYIFGIPMYNYSVPASFKAYIDQIVRVRRTFVVSADG---YEGLLKD---KKVL
AZOR_FRACC       EVEAADEYLLSVPMYNYAVPSTFKAWIDQIIVMGRTVRQAP------DDSALTG--KKVT
AZOR_FRAAA       ELEAADELLLSLPMYNYSVPSTFKAWVDQVILVGRTLQQPP------AESVLTG--DRVT
AZOR_STRAW       ELEQADAVLIGAPMYNYAIPSTLKAWLDNVILMGRTAAN--------ENSKVTG--TPVT
AZOR_NOCFA       ELLAADVVLIGTPMYNYSIPAALKAWLDQVTFPRMSLAP-----------------RRFV
AZOR1_PSEAE      ELFDSDLLVISTPMYNFSVPSGLKAWIDQIVRLGVTFDFVLDNGVAQYRPLLRG--KRAL
AZOR1_PSEPF      ELFDHDLLLISTPMYNFNVPSGLKAWVDQIVRLGLTFDHTLDNGIAQYTPLLHG--KKAL
AZOR1_PSEF5      ELLDHQRLVISAPMHNFSVPSGIKAWVDHIVRLGLTFNTQQDNGVAQYQPLVQG--KKVL
AZOR_GRABC       ELLACDHLVVATLVYNYNVPAALKAWIDSIVRKGMTLGFDG-------KGLVTG--KKAT
AZOR2_JANSC      ELLNADELVIGTPVYNYNVPALLKAWIDHIVRKGITLGMDG-------KGLLTG--KKAT
AZOR8_BURL3      EILSADHIVIGTPVYNYNVPAVLKAYIDHIVRKGKTLGFSG-------EGLVKG--KACT
AZOR3_BURL3      ELRDADEYVIGVPMHNWGPSAHFKLWLDHIVRQGETVETTPSG----PRGLLGG--RRAT
AZOR_HYDCU       QLKKADVILISTPMYNFGIPSTLKAYLDHSLRVGETFVYTDKGP----KGLLEG--KKAI
AZOR_BRASO       EIRRADVLLLSTPMYNFSIPSALKAWIDHIVRINETFSFDGARF----AGLLPG--KRAY
AZOR4_PSEF5      ELERSDALLIATPMHNFTLPAALKLWIDYVLRIHRTFSSGPEGK----VGLLKD--RPVH
AZOR5_BURL3      EVEHSDGVLISTPMHNFTVPAALKLWIDFVLRIGRTFAATPEGK----VGLLAD--RPVL
AZOR2_CUPPJ      ELEAADIVLISTPMHNFTVPSALKAWIDHVVRSNRTFRSTPAGK----VGLLAD--RPVL
AZOR_ALKEH       QLLQADALAFAVPMYNFSLPSTLKAWLDHVIRPRRTFRKVADGE---LEGLAGP--KPAL
AZOR2_HAHCH      MLFASELIVLSSPMWNLGLPSVLKAWFDHITRAGRTFRFTDGGD---KIGLVAD--RKVY
AZOR_DESVV       DFKTADKYVIALPMWNFSIPWRLKQFFDIIIQPGLTFSYD-EQG---YHGLVTG--RPVL
AZOR_DESVH       DFKTADKYVIALPMWNFSIPWRLKQFFDIIIQPGLTFSYD-EQG---YHGLVTG--RPVL
AZOR3_PSEF5      PLHQADLLVLSIPLWNFSIPYKLKHFIDLVSHQGILFSFDPENS---LQGLLRN--KTAV
AZOR2_BURL3      RFQDADRIVVGVPMWNFGYPYKLKQLIDLVSQRNMLFTFD-GNA---YAPLLEI--PRAL
AZOR9_BURL3      PFHEADKFLFGVPLWNFSIPYKLKHLIDAISQKDVLFTFD-GAG---FAGKLAG--KKAA
AZOR_DESPS       QFKDADSYLFSIPMWNFSIPYKLKHFIDIITQPGLTFMFSPESG---YQGLVTG--KACT
AZOR2_PSESM      RFHRADVILFSVPMWNFGVPYRLKHLIDSVSQRGVLFEFD-AQG---MRGLLKG--KNVV
AZOR1_BRADU      RLSLAERVLISTPMWNFGIPYKLKQWFDIIVQPGLTFRYDPASG---YLPLLKD--RPTL
AZOR_RUEPO       RFMSADHVVMGVPMWNGGIPYRLKHYIDIITQPGMLFGFDPDNG---YSGLLRN--RKAT
AZOR_MYCPU       QLKKVDKVVMSVPMTNFNVNAVTKNYLDHISVADKTFSYKYSKK-----GEAIGLLDHLS
AZOR_MYCPE       QLKSVHKVIFSCPMTNFNISATAKNYLDHVLVANKTFSYKYSKK-----GDAIGLLNHLS
AZOR_MYCMO       QLKSVDKVVISSPMTNFNYTALLKNYLDRILVANKTFSYKYSKK-----GEAIGLLPHLK
AZOR_MYCS5       KLKAADKVILSCSMTNFGPTAVVKNFIDSVAVANKTFSYKYSKK-----GDAVGLLDHLR
AZOR_MYCMS       LLKSVDKLVIACPMYNFSTPVTLKSFIDHVSVANETFSYKYSKK-----GDVIGLITNLK
AZOR_MYCCT       LLKSVDKLVIACPMYNFSTPVTLKSFIDHVSVANETFSYKYSKK-----GDAIGLITNLK
AZOR1_MESFL      QLKDVDKLLVIAPMYNFHVSGMLKNYIDHVALANQTFSYKYATK-----GASIGLLDKLK
AZOR_MYCGA       QIKSVDKLVVIAPMTNFNYPATLKNWLDKICVANKTFSYKYSKK-----GGSIGLMDHLK
AZOR_MYCGE       ALKTAYGIVILAPMTNFNYPASLKNFIDHVFVANKTFQDKYVTK-----GASKGLLTNLK
AZOR_MYCPN       ALKAAHGVIILAPMTNFNYPATLKNFIDHVFVANKTFKDKYVTK-----GASSGMLGNLK
AZOR_MYCH7       KLRNADKIVFSTSMTNFNYSATTKNFFDAITVPNKTFLLDKNT------GKYTGLLKNIQ
AZOR_MYCH2       KLRKADKIVFSTSMTNFNYSATTKNFFDAITVPNKTFLLDKNT------GKYTGLLKNIQ
AZOR_MYCHJ       KLRNADKIVFSTSMTNFNYSATTKNFFDAITVPNKTFLLDKNT------GKYTGLLKNIQ
AZOR2_MESFL      QLKSVDKIVLNFSMVNWGIPAILKNYIDHITIANLTFTYKGSTD-----GNAIGLLSNIQ
AZOR2_COLP3      EVDQADIIVISSPMYNYGMPAVLKAWFDQVVRINKTFTFDLARGDFPIEPIMSG--KKLI
AZOR2_PHOPR      IFKDYDKYIIVAPMWNLTVPSALKAYLDTVIIPNVLFRYTEQGT---CEGLCGG---KMI
                  .       .     *                                            

AZOR1_BACSU      LLNARGGV---YSEGPM---AALEMSLNFMKTVL-GFWGVQD--LHTVVIEGHNAAPDQA
AZOR1_BACLD      LLNARGGF---YSEGPM---AAMEMSLNYMKTVM-GFFGVQD--LHTVVIEGHNAVPDDA
AZOR2_BACHD      LLNARGGY---YSEGPA---AQLEMSLNYMKTMV-GFFGVQD--PVTVVIEGHNAVPDQA
AZOR4_BACAN      LLNARGGV---YSEGPA---AEVEMAVKYVASMM-GFFGATN--METVVIEGHNQFPDKA
AZOR3_BACHK      LLNARGGV---YSEGPA---AEVEMAVKYVASMM-GFFGATN--METVVIEGHNQFPDKA
AZOR4_BACCZ      LLNARGGV---YSEGPA---AGAEMAVKYVATMM-GFFGATN--METIVIEGHNQFPDKA
AZOR4_BACC1      LLNARGGV---YSEGPA---AEVEMAVKYVASMM-GFFGATN--METVVIEGHNQFPDKA
AZOR3_BACCR      LLNARGGV---YSEGPA---AEVEMAVKYVASMM-GFFGATN--METVVIEGHNQFPDKA
AZOR2_BACCZ      VLGARGSD---YSSEQM---APMEMAVNYVTTVL-GFWGITN--PETVVIEGHNQYPDRS
AZOR1_BACHK      VLGARGSD---YSSEQM---APMEMAVNYVTTVL-GFWGITN--PETVVIEGHNQYPDRS
AZOR2_BACAN      VLGARGSD---YSSEQM---APMEMAVNYVTTVL-GFWGITN--PETVVIEGHNQYPDRS
AZOR2_BACC1      VLGARGSD---YSSEQM---APMEMAVNYVTTVL-GFWGITN--PETVVIEGHNQYPDRS
AZOR1_BACCR      VLGARGSD---YSSEQM---APMEMAVNYVTTVL-GFWGITN--PETVVIEGHNQYPDRS
AZOR_BACSK       LLNARGGV---YSNEEM---AALEMAANLVRTTM-AFWGITQ--PVEVIIEGHNAAPDQA
AZOR1_BACHD      LLNARGGV---YAED-----DRSEMAVSFVKNHL-NVFGITD--ITTVIIEGHNQFPDRS
AZOR1_LISMF      LLNARGGI---YSDGPM---QSFEMSLSYVKNVL-AHFGISE--PEMVIVEGHNAKPDQA
AZOR1_LISMO      LLNARGGI---YSDGPM---QSFEMSLNYVKNVL-AHFGISE--PEMVIVEGHNAKPDQA
AZOR1_LISIN      LLNARGGI---YSDGPL---QSFEMSLNYVKNVL-AHFGISE--PEMVIVEGHNAKPDQA
AZOR_GEOKA       HIQARGGF---YSEGPA---AEMEMGHRYLSVIM-QFFGVPS--FEGLFVEGHAAVPEKA
AZOR_GEOSE       HIQARGGF---YSEGPA---AEMEMGHRYLSVIM-QFFGVPS--FEGLFVEGHAAVPEKA
AZOR3_BACHD      HIQARGGI---YSEGPA---TDFEMGHRYLTAIM-NFFGVPS--FQGLFIEGHAAMPDKA
AZOR2_BACSU      HIQARGGY---YSEGPA---AEMEMGHRYIGIMM-NFFGVPS--FDGIFVEGHNAEPDKA
AZOR_BACVZ       HIQARGGY---YSEGPA---ADMEMGHRYIGIMM-NFFGVPS--FDGLIVEGHNAEPNKA
AZOR2_BACLD      HIQARGGY---YSEGQA---AELEMGHRYISIMM-QFFGVPE--FEGLFIEGHNAEPDKA
AZOR_BACP2       HIQARGGY---YTEGPA---AELEAGHRYLGTIA-SFFGIPS--FEGLIVEGHNAEPAKA
AZOR_STAA9       HIQSRGGY---YTEGPA---ADFEMGDRYLRTIM-TFLGVPS--YETIIIEGHNAEPHKT
AZOR_STAA2       HIQSRGGY---YTEGPA---ADFEMGDRYLRTIM-TFLGVPS--YETIIIEGHNAEPHKT
AZOR_STAAN       HIQSRGGY---YTEGPA---ADFEMGDRYLRTIM-TFLGVPS--YETIIIEGHNAEPHKT
AZOR_STAAC       HIQSRGGY---YTEGPA---ADFEMGDRYLRTIM-TFLGVPS--YETIIIEGHNAEPHKT
AZOR_STAA8       HIQSRGGY---YTEGPA---ADFEMGDRYLRTIM-TFLGVPS--YETIIIEGHNAEPHKT
AZOR_STAAT       HIQSRGGY---YTEGPA---ADFEMGDRYLRTIM-TFLGVPS--YETIIIEGHNAEPHKT
AZOR_STAA3       HIQSRGGY---YTEGPA---ADFEMGDRYLRTIM-TFLGVPS--YETIIIEGHNAEPHKT
AZOR_STAAS       HIQSRGGY---YTEGPA---ADFEMGDRYLRTIM-TFLGVPS--YETIIIEGHNAEPHKT
AZOR_STAAW       HIQSRGGY---YTEGPA---ADFEMGDRYLRTIM-TFLGVPS--YETIIIEGHNAEPHKT
AZOR_STAAB       HIQSRGGY---YTEGPA---ANFEMGDRYLRTIM-TFLGVPS--YETIIIEGHNAEPHKT
AZOR_STAA1       HIQSRGGY---YTEGPA---ADFEMGDRYLRTIM-TFLGVPS--YETIIIEGHNAEPHKT
AZOR_STAAM       HIQSRGGY---YTEGPA---ADFEMGDRYLRTIM-TFLGVPS--YETIIIEGHNAEPHKT
AZOR_STAAR       HIQSRGGY---YTEGPA---ADFEMGDRYLRTIM-TFLGVPS--YETIIIEGHNAEPHKT
AZOR_STAHJ       HIQSRGGY---YTEGPA---AEVESGDRYLRNIM-TFLGVPS--YETIIIEGHNAEPEKT
AZOR3_BACCZ      HIQATGGV---YSEGAY---AAVDFGRNHLKTVL-GFVGVND--TEYIAVEGMNANPEKA
AZOR2_BACCR      HIQATGGV---YSEGAY---AAVDFGRNHLKTVL-GFVGVND--TEYIAVEGMNANPEKA
AZOR3_BACC1      HIQATGGV---YSEGAY---AAVDFGRNHLKTVL-GFIGVNE--TEYIAVEGMNANPEKA
AZOR2_BACHK      HIQATGGV---YSEGPY---AAVDFGRNHLKTVL-GFIGVNE--TEYIAVEGMNANPEKA
AZOR3_BACAN      HIQATGGV---YSEGPY---AAVDFGRNHLKTVL-GFIGVNE--TEYIAVEGMNANPEKA
AZOR_GEOUR       HIHSSGGF---HFG------KEEDHSVPYLKSIM-GFMGIED--FESIVVEGVDAIPDRA
AZOR2_LISMF      LIHGSGGI---YSAGPT---SSFTHGEPYLRTIL-QFIGINV--VPSIFVEGIDHNPSKE
AZOR2_LISMO      LIHGSGGI---YSAGPT---SSFTHGEPYLRTIL-QFIGINV--VPSIFVEGIDHNPSKE
AZOR2_LISIN      LIHGSGGI---YSAGPT---SSFTHGEPYLRTIL-QFIGIDV--VPSIFVEGIDHNPSKE
AZOR_CLOP1       HIVSRGGG---YDNSP------YEMGDRYLRTIL-GFFGIKD--IETIAIDNLDVMGVNV
AZOR2_CLOPE      HIVSRGGG---YDNSP------YEMGDRYLRTIL-GFFGIKD--IETIAIDNLDVMGVNV
AZOR_CLOPS       HIVSRGGG---YDNSP------YEMGDRYLRTIL-GFFGIKD--IETIDIDNLDVIGVNV
AZOR_CLOB8       YIAARGGS---YAETP------YELDGIYLRSIL-GFFGIKD--ITTISAEKLDVQGENV
AZOR2_CLOAB      HIVSRGGG---YSEGPF---EMYEMGDRYLRTIF-GFLGITD--FTTIVAEKLDVVGEDV
AZOR_LACP7       HIVARGGE---YGNAP------YEMGDRYVKTIL-GFLGVSD--IQTIAIENLDIIGADV
AZOR_CALS8       HIMATGGE---YKTPPF---SDFEMANRYLKTIL-GFMGVED--FQTITAQRLDIVGEDV
AZOR_LACLS       HLQANGGV---YG--------AQDPATVYMSAIF-NFIGSD---FRQIAVEGHAYDPEKT
AZOR2_LACLA      HLQANGGV---YG--------AQDPATIYMSAIF-NFIGSD---FRQIAVEGHAYDPEKT
AZOR_ENTFA       HIQSNGGF---YE--------GKDFASQYIKAIL-NFIGVDQ--VDGLFIEGIDHFPDRA
AZOR_STRS2       HIQSNGGV---YA--------GQDPAAQYIKSIF-EFLGFED--IHQVFIEGQSADPSQS
AZOR2_LACPL      HIQAAGGY---YHQPDQ--HNQVEAGDPYLRGMM-QLYGIQD--YRTIFIEGLDQFPEQR
AZOR1_LACLA      HIQSAGGF---YHNEQDPTHMANDLGAAYIDQTM-KMVGLTDENRQQLFVEGYARYPERA
AZOR1_BACCZ      VIQASGGI---YTNDD--WYTDVEYSHKYLKAMF-NFLGIED--YQIVRAQG--TAVLDP
AZOR1_BACC1      VIQASGSI---YTNDD--WYTDVEYSHKYLKAMF-NFLGIED--YQIVRAQG--TAVLDP
AZOR1_BACAN      VIQASGGI---YTNDD--WYTDVEYSHKYLKAMF-NFLGIED--YQIVRAQG--TAVLDP
AZOR_STRA5       MLESAGSI---YSKG---QYSPYEFPVHYLKAIFKDFMAFDD--FCVVRAEG--TDILDR
AZOR_STRA3       MLESAGSI---YSKG---QYSPYEFPVHYLKAIFKDFMAFDD--FCVVRAEG--TDILDR
AZOR_STRA1       MLESAGSI---YSKG---QYSPYEFPVHYLKAIFKDFMAFDD--FCVVRAEG--TDILDR
AZOR1_LACPL      LLQASGSI---YTRND--RYTPMEFSRLYLDKMFTEIMGFDR--FEIVRAQGLQTNGVAV
AZOR_CUPNH       VVSSRGGV------RQDAN--ELDLHEKTVDIVF-RFLGI-TDITYVR-AHGLAM---GP
AZOR1_CUPPJ      VVSSRGGV------RQDAN--ELDLHEKTVDVVF-RFLGI-TDITYVR-AHGLAM---GP
AZOR_AZOBR       IASTRGGV---YSTNAAMS--ALDHQEAFLRTVL-GFLGV-TDVTVIR-AEGVGM---GP
AZOR2_XANC5      VASSRGGM---YTQGPMA---SLDFQEAYLTATF-GFLGV-RDVHFVR-AENQSR---GP
AZOR2_XANAC      VASSRGGM---YAQGPMA---SLDFQEAYLTATF-GFLGV-RDVYFVR-AENQSR---GP
AZOR_RALSO       VASTRGGM---YSAGPTA---AMDFQEAYLKTVF-GFLGI-TDVQFVR-AERLAM---GP
AZOR_ACISJ       VASSRGGV---YSTSEGGR--AMEHQESYLQTVL-GFFGV-TDVRFVR-AEGVAM---GG
AZOR_RHOFT       VASTRGGA---YSTSEGGQ--AMEHQESYLKVVF-GFFGI-TDVRIVR-AEGLAM---GD
AZOR1_XANAC      IASARGGL---YAD-PTN-----DFQEPYLRQVL-GFLGV-DDISFVR-AEGVAY---SP
AZOR1_XANC5      IASARGGL---YAD-PTN-----DFQEPYLRQVL-GFLGI-DDISFVR-AEGVAY---SP
AZOR_XANOR       IASARGGV---YAE-PSN-----DFQEPYLRQLF-GFLGI-DDITLVR-AEGVAY---SP
AZOR_XANOM       IASARGGV---YAE-PSN-----DFQEPYLRQLF-GFLGI-DDITLVR-AEGVAY---SP
AZOR3_PSEPF      IVSTAGGI---HAGQASG-----VAHEDYLKLVF-GFLGI-TDIEVVR-AEGLAY---GE
AZOR5_PSEF5      VVSTSGGL---HVGQATG-----VAHEDYLKVLF-GFFGI-TDVEFVR-AHGLAY---GE
AZOR1_PSEPK      LVSTAGGL---HAGQPTG-----AGHEDFLKVFL-GFIGI-TDLEIVR-AHGLAY---GP
AZOR2_PSEAE      IVSTAGGV---HAGQPTG-----AAHEGYLRTVL-GFFGI-TDIEVVR-AEGLAY---GE
AZOR_PSE14       IVSTSGGL---HVGQPTG-----AGHEELLKALF-AFIGI-TDLQFVR-AHGLAY---GE
AZOR_PSEU2       IVSTSGGL---HAGQPTG-----VGHEELLKALF-AFIGI-TDLQFVR-AHGLAY---GE
AZOR1_PSESM      IVSTSGGL---HQGLPTG-----AGHEELLKALF-AFIGI-TDLQFVR-AHGLAY---GE
AZOR_RHIME       VASTRGGH---YSV-APAS--AMDHQETYLRSVF-GFFGI-TDIEFIR-AEGLNL---GP
AZOR_SINMW       VASTRGGH---YSV-APAS--AMDHQETYLRSVF-GFFGI-TDIEFIR-AEGLNL---GA
AZOR7_BURL3      VASSRGGV---YSEGSPAA--AFDHQETYLKAAF-GFLGI-TDITFIR-AEGVAM---GP
AZOR_BRASB       VASARGGI---FSAGSPLA--ALDHQENYLLSFF-GFLGI-AEISFVR-AEGVAL---GP
AZOR2_BRADU      VAISRGGY---YGADMPTA--AGEHLETYLRWVF-GFIGI-TDPEFIS-ADGIQV---GP
AZOR_RHOPB       IAISRGGF---YGPDTPMA--VGEHLESYLRFVF-GFIGI-TEPDIIA-ADGIKF---SP
AZOR_XANCP       LAVARGGR---YGEGSPTA--ALEHAETYMRAAL-GFVGL-HQPEVVV-AEGLAL---GP
AZOR_GLUDA       VALSRGSF---YGQETPYA--TAEHTETYLRTAL-GFIGI-ATPEVIV-AEGVSR---GE
AZOR_GLUOX       LAVARGGL---YGEGSPAA--SFEHQLSYLKSVF-AMIGI-TDLTVIE-AEGLATN--GG
AZOR_CHRVO       LVSARGGV---HSGEQGS---LMDFQEDYVVKVL-GFLGV-SDVEIIR-AEAIGM---GP
AZOR_LEGPH       ILSSRGGF---YNAEPAL---NLDHQERYLTSIL-NFIGI-SDITFIR-AEGVNV---GE
AZOR_SALPA       VLSSRGGI---HKDTP------TDLIAPYLKVFL-GFIGI-TDVNFVF-AEGIAY---GP
AZOR_SALTI       VLSSRGGI---HKDTP------TDLIAPYLKVFL-GFIGI-TDVNFVF-AEGIAY---GP
AZOR_SALTY       VLSSRGGI---HKDTP------TDLIAPYLKVFL-GFIGI-TDVNFVF-AEGIAY---GP
AZOR_SALPB       VLSSRGGI---HKDTP------TDLIAPYLKVFL-GFIGI-TDVNFVF-AEGIAY---GP
AZOR_SALCH       VLSSRGGI---HKDTP------TDLIAPYLKVFL-GFIGI-TDVNFVF-AEGIAY---GP
AZOR_SALAR       VLSSRGGI---HKDTP------TDLIAPYLKVFL-GFIGI-TDVNFVF-AEGIAY---GP
AZOR_CITK8       ILSSRGGI---HKDTP------TDLIAPYLKVFL-GFIGI-TDVNFVF-AEGIAY---GP
AZOR_SHIBS       VITSRGGI---HKDGP------TDLVTPYLSTFL-GFIGI-TDVKFVF-AEGIAY---GP
AZOR_ECOUT       VITSRGGI---HKDGP------TDLVTPYLSTFL-GFIGI-TDVKFVF-AEGIAY---GP
AZOR_ECO24       VITSRGGI---HKDGP------TDLVTPYLSTFL-GFIGI-TDVKFVF-AEGIAY---GP
AZOR_SHISS       VITSRGGI---HKDGP------TDLVTPYLSTFL-GFIGI-TDVKFVF-AEGIAY---GP
AZOR_SHIDS       VITSRGGI---HKDGP------TDLVTPYLSTFL-GFIGI-TDVKFVF-AEGIAY---GP
AZOR_ECOLC       VITSRGGI---HKDGP------TDLVTPYLSTFL-GFIGI-TDVKFVF-AEGIAY---GP
AZOR_ECOHS       VITSRGGI---HKDGP------TDLVTPYLSTFL-GFIGI-TDVKFVF-AEGIAY---GP
AZOR_ECOLI       VITSRGGI---HKDGP------TDLVTPYLSTFL-GFIGI-TDVKFVF-AEGIAY---GP
AZOR_SHIFL       VITSRGGI---HKDGP------TDLVTPYLSTFL-GFIGI-TDVKFVF-AEGIAY---GP
AZOR_SHIF8       VITSRGGI---HKDGP------TDLVTPYLSTFL-GFIGI-TDVKFVF-AEGIAY---GP
AZOR_ECO57       VITSRGGI---HKDGP------TDLVTPYLSTFL-GFIGI-TDVKFVF-AEGIAY---GP
AZOR_ECOL5       VITSRGGI---HKDGP------TDLVTPYLSTFL-GFIGI-TDVKFVF-AEGIAY---GP
AZOR_ECOL6       VITSRGGI---HKDGP------TDLVTPYLSTFL-GFIGI-TDVKFVF-AEGIAY---GP
AZOR_CROS8       VLTSRGGI---HKDTP------TDLVTPYLSLFL-GFIGI-TDVNFVF-AEGVAY---GP
AZOR_YERPE       ILTSRGGI---HKDTP------TDLVVPYLRLFL-GFIGI-TDVEFVF-AEGIAY---GP
AZOR_YERPN       ILTSRGGI---HKDTP------TDLVVPYLRLFL-GFIGI-TDVEFVF-AEGIAY---GP
AZOR_YERP3       ILTSRGGI---HKDTP------TDLVVPYLRLFL-GFIGI-TDVEFVF-AEGIAY---GP
AZOR_YERPP       ILTSRGGI---HKDTP------TDLVVPYLRLFL-GFIGI-TDVEFVF-AEGIAY---GP
AZOR_YERPA       ILTSRGGI---HKDTP------TDLVVPYLRLFL-GFIGI-TDVEFVF-AEGIAY---GP
AZOR_YERPS       ILTSRGGI---HKDTP------TDLVVPYLRLFL-GFIGI-TDVEFVF-AEGIAY---GP
AZOR_YERE8       ILTSRGGI---HKDTP------TDLVVPYLRLFL-GFIGI-TDVKFVF-AEGIAY---GP
AZOR_PECAS       VLTSRGGI---HKGTP------TDLLEPYLRVFL-GFLGL-TDLEFVF-AEGYGY---GP
AZOR_SODGM       ILTTRDGI---HKDTS------SDLVTHYLRLFL-GFIGI-TDVSFIY-AEGVAY---GP
AZOR_PHOLL       ILTSRGGI---HKDGP------SDLLVPYLRLFL-SFIGL-TDIEFVF-TEGVAL---GP
AZOR_VIBVY       IVTTRGGI---HKDAA------SDIITPYLKTVL-GFVGI-TEVEFVY-AEALNM---GD
AZOR_VIBVU       IVTTRGGI---HKDAA------SDIITPYLKTVL-GFVGI-TEVEFVY-AEALNM---GD
AZOR_VIBPA       VVTTRGGI---HKDSP------TDNVTPYLRTVL-GFVGI-TDVEFIY-AEALNM---GE
AZOR_SHESH       LITTRGGV---HKGGA------SDHVVPYLKTVL-GFIGI-EEVETVY-SEALNM---GP
AZOR_SHELP       LVTTRGGV---HKNGA------SDHVVPYLKTVL-GFIGI-DEVETVY-GEALNM---GP
AZOR_SHEDO       VVTTRGGM---HKEGA------SDHIVPYLKTVL-GFIGI-TEVEFVY-AEALNM---GP
AZOR_SHESM       LITTRGGA---HKDGP------TDHIVPFLKTFL-GFIGI-TDVEVVY-GEALNM---GP
AZOR_SHESR       LITTRGGA---HKDGP------TDHIVPFLKTFL-GFIGI-TDVEVVY-GEALNM---GP
AZOR_SHESA       LITTRGGA---HKDGP------TDHIVPFLKTFL-GFIGI-TDVEVVY-GEALNM---GP
AZOR_SHEON       LITTRGGA---HKDGP------TDHMVPFLKTFL-GFIGI-TDVDVVY-AEALNM---GP
AZOR_SHEB9       LVTTRGGA---HKDGP------TDHVVPYLKTVL-GFIGI-TNVEVVY-AEALNM---GP
AZOR_SHEB8       LVTTRGGA---HKDGP------TDHVVPYLKTVL-GFIGI-TNVEVVY-AEALNM---GP
AZOR_SHEB5       LVTTRGGA---HKDGP------TDHVVPYLKTVL-GFIGI-TNVEVVY-AEALNM---GP
AZOR_SHESW       LVTTRGGA---HKDGP------TDHVVPYLKTVL-AFIGI-TNVEVVY-AEALNM---GP
AZOR_SHEPC       LVTTRGGA---HKDGP------TDHVVPYLKTVL-AFIGI-TNVEVVY-AEALNM---GP
AZOR_SHEFN       IVTTRGGA---HKGGP------TDHVVPYLTTVL-GFIGI-NNVETIY-AEALNM---GP
AZOR_SHEAM       LITTRGGV---HKGSG------SDHVVPYLKTVL-GFIGI-TDVDTVY-AEALSM---GP
AZOR1_PHOPR      VVTTRGGM---HKDGP------TDTMVPYLKTIL-GFIGL-TDVEFVY-GEALAM---GE
AZOR_PSYIN       IVTTRGGM---HKEQG------TDQQVPYLKTVL-NFMGI-SDIEVVY-AESLAM---GP
AZOR_AERS4       VISPRGGM---HVGSA------TDLVTPYMRTVL-GFIGI-KDVDFIY-AEGMGM---GP
AZOR4_BURL3      VFSSRGGV---HVGQD------TDAVTPYLRAVL-GLMGI-VDVEFVY-AEGLDM---KP
AZOR_HAEI8       VLCAFGGL---YDE--------ENLVTQYMKSIL-GFIGI-TDVQFVY-AQGIGF---GP
AZOR_HAEIN       LLCAFGGL---YDE--------ENLVTQYMKSIL-GFIGI-TDVQFVY-AQGIGF---GP
AZOR_HAEIG       VLCAFGGL---YDE--------ENLVTQYMKSIL-GFIGI-TDVQFVY-AQGIGF---GP
AZOR_HAEIE       VLCAFGGL---YDE--------ENLVTQYMKSIL-GFIGI-TDVQFVY-AQGIGL---GA
AZOR_HYPNA       VLTSRGGL---YSEGPAA---AADFQEPYLRHLL-GFVGI-TDVTFIH-AEKIGF---GP
AZOR2_PSEF5      VLTARGGI---YAGST------ADHQEPYLRQVM-GFIGI-HDVEFIH-AEGLNL---GG
AZOR2_PSEPF      VLTARGGI---YAGGP------ADHQEPYLRQVM-GFIGI-NDVTFIH-AEGMNL---GG
AZOR2_PSEPK      VLTARGGI---HAGAS------SDHQEPYLRQVM-AFIGI-HDVDFIH-AEGLNM---SG
AZOR3_PSEAE      VLTARGGI---YAGGG------LDHQEPYLRQVL-GFVGI-HDVTFIH-AEGMNM---GP
AZOR_AROAE       VAFARGGR---YRDTP------ADTQVPYLKTIF-GFLGM-TDVHFVF-AEGLAM---GA
AZOR_DECAR       VALARGGL---YRDTP------ADSQVPYLKSVL-GFLGM-TDVEFIY-AEGLAM---GA
AZOR_AZOSB       VALARGGQ---YRGSP------LDTQVPYLKAVL-GFLGI-TDVRFIY-AEGLNM---GP
AZOR_BURP1       VVSARGGK---HVGMP------TDSQTPFLKTFL-GFIGL-TDVTFVY-AEGLAL---GP
AZOR_BURPS       VVSARGGK---HVGMP------TDSQTPFLKTFL-GFIGL-TDVTFVY-AEGLAL---GP
AZOR_BURMA       VVSARGGK---HVGMP------TDSQTPFLKTFL-GFIGL-TDVTFVY-AEGLAL---GP
AZOR_BURTA       VVSARGGK---HVGMP------TDSQTPFLTTFL-GFIGM-TDVTFVY-AEGLAL---GP
AZOR6_BURL3      VVTARGGK---YAGTP------NDSQTPYLRTFL-GFVGM-TDVNFIF-AEGLNL---GP
AZOR_ALCBS       VLAARGGI---YAGTS------NDTVTPYIKLFF-GFIGI-TDVEFVF-AEGLNM---GD
AZOR_BORPA       MLIARGGK---SEGTP------DDTMTPYLKQML-AFLGM-TDVTFIA-AEGMAM---GE
AZOR_BORBR       VLIARGGK---SEGTP------DDTMTPYLKQML-AFLGM-TDVTFIA-AEGMAM---GE
AZOR_BORA1       VLIARGGK---ALGTP------QDSMTPYLKQML-GFLGM-QDVTVIA-AEGMAM---GE
AZOR_SACD2       VVTSRGGY---HKDAA------SDVEVPFLKTFL-GFLGL-NDVEFIY-AEGLNL---SG
AZOR_MARMS       IFAASGSF---LAGAP------VDHQVPHIQTFL-GFIGL-NVKDTFI-AGGQAM---GE
AZOR_RHIL3       VVLASGGV---YSQGPAA---PLNHAVPYLKSVL-GFLGI-SDIETIY-VEGLAF---GP
AZOR1_RHIEC      VVLASGGV---YSQGPAA---PLNHAVPYLKSVL-GFLGI-TDIETIY-VEGLAF---GP
AZOR_AGRFC       IVLAAAGV---YSEGPAV---SMNHAVPYLKTVL-GFMGM-TDVEVIY-VEGLAF---GP
AZOR_RHILO       IVLASGGI---YSEGAAV---QFDHAIPYLRGVL-GFLGM-TDVDVIR-IEGVGM---GP
AZOR2_RHIEC      LVTASGGV---FSEGDWA---AFDFQTGYLRHLL-SFIGL-TDIQIIR-VEGTVF---GP
AZOR_AZOC5       LVTAAGGV---FSEGDWA---PFDFQTGNLRHLL-GFVGL-TDVEIIR-VEGTVF---GP
AZOR1_BURL3      LVTASGGI---FSEGPYA---PFDYQSGYLKHLL-GFIGM-TDIREVR-VEGTVL---GA
AZOR_HERAR       IFTASGGV---YSEGPAQ---AMDFNATYLRTVL-GFIGL-TDVTIIN-SEGVAM---GA
AZOR1_HAHCH      VVTVTGGT---PVNSA------ADFVSAYMRQVL-GFIGI-KDVTFIN-ADRIM------
AZOR1_JANSC      VAVASGGT---EAGSD------IDFATGYMRHVL-GFIGI-TDVTFVT-ADRLM------
AZOR_THIDA       VLVASGGT---EVGSD------IDFATPWLEFVL-GFLGI-TDVEVIA-ADRGM------
AZOR1_COLP3      IIIASGGT---KLGTE------IDFISDYLRHIL-GFIGI-TDVTFID-SSGLG------
AZOR_RHOS1       VAFTSDGT---PLGSE------LDHASGWLRQVL-GFVGI-TDVDFVA-ADRMV------
AZOR_RHOS4       VAFTSDGT---PLGSE------LDHASGWLRQVL-GFVGI-TDVDFVA-ADRMV------
AZOR_ERYLH       ITVASGGT---PVGSE------VDFMSPWLKFFL-GFLGI-SEVEVVATADGIMG-----
AZOR_PELUB       LVITSGGT---KLNSS------EDFLTPWLKFIL-NFFGI-EKVEVIS-ADQMA------
AZOR_NOSS1       IITSRGGS---YPPGTPYA--AYDYQEPYLRAIL-GFMGL-TDVTFIHAESLNMGE--DA
AZOR2_TRIV2      IITSRGGS---YPPGTPYA--AYDYQEPYLRAIL-GFMGL-TDVTFIHAESLNMGE--DA
AZOR1_TRIV2      VITTRGGS---YAG----E--PLDFQEPYLRAVF-GFIGI-TDVTFIHAENLAIGS--EE
AZOR_FRACC       VVTAQGGS---YGPGTPKE--GWDHQQPYVAHIL-AALGA-TDIEFIRVEMTLAPV--NP
AZOR_FRAAA       VIATQGGS---YGVGTPKE--GWDHQLPFIAHVL-ESLGA-TDVELVRVEMTLAPV--NP
AZOR_STRAW       VIASRGGS---YAPGTPRE--PYEYVQNYLKAVL-SDALG-LELEFIVPELTMAAH--NP
AZOR_NOCFA       VAAARGGS---YSPGTPKA--AFDHQERYLRDFF-AGHFAVTDTVFVTAELANARQ--DP
AZOR1_PSEAE      IVTSRGGHG--FGPGGENQ--AMNHADPWLRTAL-GFIGI-DEVTVVAAEGEESGG--RS
AZOR1_PSEPF      IVTSRGGFG--FGPGGELE--ALNHADPWLRTAL-GFIGI-NDVTVVAAEGEESAE--RT
AZOR1_PSEF5      IVTSRGGGG--FGPGGEHE--AMNHADRWLRTAL-GFIGI-EDVTVVAAEGEESAP--ER
AZOR_GRABC       VLMASGGV---YTEGSPIR--DRDIATQYLRLVL-GVIGI-ADVTVVAGGGAKAVD--MR
AZOR2_JANSC      VLIASGGI---YSEGSPIA--DRAIAPQYLKLIL-GVIGI-ENVTIVAGGGAKAVD--MG
AZOR8_BURL3      IVMASGGA---YTPDSPIR--DRDIATGYLRLIL-KVIGI-EDVTVIAGGNAKAVD--MG
AZOR3_BURL3      FVIAAGWR---YGPDAERA--QRNFLEPWLRTLF-GFLGV-EDMRFVMADGAADVF--TG
AZOR_HYDCU       VVAASG-GD--YT-QSPLD--AMNFVTPYLKTAL-GFIGI-EDVTLVEAPGMAGD----E
AZOR_BRASO       VVTAAGAGG--YTGDGPLA--PANFVQPYLQFLL-GFLGI-ADVTFVPIEQTTAD----A
AZOR4_PSEF5      VLVSSGGFH--QGERARQ----PDFLTPYLRQVL-NTLGL-FDLQFTYLQGLVFGD--EA
AZOR5_BURL3      VLVRSGGIC--RGAAARQ----PDFLTPYLKQVL-AVIGF-STVDFIYLEGVAPDD--AA
AZOR2_CUPPJ      AVVSCGGPF--HDGPGSQ----RDMMTPYLQYVF-GSVGI-TQVEVVRMENMARGE--DF
AZOR_ALKEH       VMTASGGL---FADTS------LDHLRPYMKTAL-AFMGIDSPRFVDWEGTARADI--DP
AZOR2_HAHCH      VVMASGSA---FSNGP-YV--SHDQFTPYINVAF-QYVGI-RDLNFIRIDGTHDP-----
AZOR_DESVV       VSYARGGAY---PAGTPAE--GWDFQKRYLEHIL-GFIGF-TDIRSVVVEPTLAG---GP
AZOR_DESVH       VSYARGGAY---PAGTPAE--GWDFQKRYLEHIL-GFIGF-TDIRSVVVEPTLAG---GP
AZOR3_PSEF5      AAYARGLDF-SSRSSTPAP--AFDFQKPYIEAWL-NFIGI-ANQHSLIVEKTILGPDIDQ
AZOR2_BURL3      VIHVRGQSR-EPGAGADNP--GFRHQADYIEFWL-RFIGV-SEVRSLTVEHTW------G
AZOR9_BURL3      VIYARGLGYQSPGSFTPAA--EFDLQRPYMETWL-RFVGV-QDVTGIVVERTLF-----G
AZOR_DESPS       VIYARGAQY----RGTKGS--TLDFQKTYMELLL-SFIGF-ENIHSIRVEPTLT----DS
AZOR2_PSESM      VFASRGVAL---GEDFPTE--AYDHQVAYLKTWA-RMVGI-PTIDAVLSEATLAD----P
AZOR1_BRADU      VILASGSDF---VTGMNRG--RTDMATPYLREAL-RFIGI-SDVRFVPIGPTTGP----A
AZOR_RUEPO       VVTTSGVWS---EGADARF--GSDFHSTYLKWWF-ETIGI-TDVTFVRYQPSLLT----D
AZOR_MYCPU       -VQILTTQ------GAPLGWYPWGNHSEYLKGHW-RFLGAKVADHILV-DSVKIGENSKK
AZOR_MYCPE       -VQLLTTQ------GAPLGWYPWGNHTENLKGTF-EFMGTKVVTPILV-DGTKIPENANK
AZOR_MYCMO       -VQILTTQ------GAPLGWYTWGDHTKNLEGTF-EFIGAKVAKSVVM-DGLKTPQYSSL
AZOR_MYCS5       -VMIVTTQ------GAPKDWYLWGSHTNWLIGTW-KFLGAKYVDTFEL-NGTKLSVFADK
AZOR_MYCMS       -AQILGVQ------GAPLGWYPWGQHTQYVEGAM-RFLGIDFNKTVLL-AGVKVAPLLQL
AZOR_MYCCT       -AQILGVQ------GAPLGWYPWGQHTQYVEGAM-RFLGIEFNKTVLL-AGVKVAPLLEL
AZOR1_MESFL      -VQILATQ------GAPKGWYPWGDHVAYLKGTW-EFMGAKVAEPILL-AGVKVEPLSTQ
AZOR_MYCGA       -VMIINTQ------GAPEGWYAFADVTVLLKGVF-EFIGA-MVDSIKV-AGTKV-EYLNK
AZOR_MYCGE       -VVVLASQ------GAPLGWYPWADHVSNLKGLF-GFAGVTHFESVLI-DDTKI-LYKDK
AZOR_MYCPN       -VVVLGSQ------GAPLGWYPWGDHVNSLRGLF-GFAGVASFASVII-DGTKL-LYKDK
AZOR_MYCH7       NVQILTAQ------GAPLGWYPFGNHSALIKQIF-EFLGAKVRSDFFVLDGTKVAPNNQK
AZOR_MYCH2       NVQILTAQ------GAPLGWYPFGNHSALIKQIF-EFLGAKVRSDFFVLDGTKVAPNNQK
AZOR_MYCHJ       NVQILTAQ------GAPLGWYPFGNHSALIKQIF-EFLGANVRSDFFVLDGTKVAPNNQK
AZOR2_MESFL      DVQILATK------GGT--GTPNSAFTEYVKNIW-EFLGAKVKSEIIINEMMDIPPYAEQ
AZOR2_COLP3      LISSSGEFGFEIGGIREK----MNYLAPHVETAS-KYLGVEEFYEIKSEYQEFAD-----
AZOR2_PHOPR      YIGARGGD---YSHPPQSE---YAFDDKYMEGIA-KMIGLESYQSYVANAVGGYR----R
                                              :                              

AZOR1_BACSU      QEIVEKGLQEAKDLAAKF---------------
AZOR1_BACLD      QKIIENGLAEAKKLAASF---------------
AZOR2_BACHD      EEIINKGLEEVKKVAQSF---------------
AZOR4_BACAN      EEIITAGLEEAAKVANKF---------------
AZOR3_BACHK      EEIITAGLEEAAKVANKF---------------
AZOR4_BACCZ      EEIITAGLEEAAKVANKF---------------
AZOR4_BACC1      EEIIAAGLEEAAKVASKF---------------
AZOR3_BACCR      EEIIAAGLEEAAKVASKF---------------
AZOR2_BACCZ      QQIVEEGLENVKKVAAKF---------------
AZOR1_BACHK      QQIVEEGLENVKKVAAKF---------------
AZOR2_BACAN      QQIVEEGLENVKKVAAKF---------------
AZOR2_BACC1      QQIVEEGLEKVKKVAAKF---------------
AZOR1_BACCR      QQIVEEGLENVKKVAAKF---------------
AZOR_BACSK       DAIISEGLENVKKAAVAF---------------
AZOR1_BACHD      ETIIQKGLQKAKQVAKTF---------------
AZOR1_LISMF      KDIISAGAKEAVELAKIF---------------
AZOR1_LISMO      KDIISAGAKEAVELAKIF---------------
AZOR1_LISIN      KDIISAGAKEAAELAKIF---------------
AZOR_GEOKA       EEIKANAIARAKDLAHTF---------------
AZOR_GEOSE       EEIKANAIARAKDLAHTF---------------
AZOR3_BACHD      QEIKEDGIRRAKELARTF---------------
AZOR2_BACSU      QQIKEDAIARAKEAGKTF---------------
AZOR_BACVZ       QQIKEDAIARAKEAGKSF---------------
AZOR2_BACLD      EEIKQNAIVRAKELGRTF---------------
AZOR_BACP2       EQIKADAIERAKALGKTF---------------
AZOR_STAA9       EEIKATSINNAEKLATTF---------------
AZOR_STAA2       EEIKATSINNAEKLATTF---------------
AZOR_STAAN       EEIKATSINNAEKLATTF---------------
AZOR_STAAC       EEIKATSINNAEKLATTF---------------
AZOR_STAA8       EEIKATSINNAEKLATTF---------------
AZOR_STAAT       EEIKATSINNAEKLATTF---------------
AZOR_STAA3       EEIKATSINNAEKLATTF---------------
AZOR_STAAS       EEIKATSINNAEKLATIF---------------
AZOR_STAAW       EEIKATSINNAEKLATIF---------------
AZOR_STAAB       EEIKATSINNAEKLATTF---------------
AZOR_STAA1       EEIKATSINNAEKLATTF---------------
AZOR_STAAM       EEIKATSINNAEKLATTF---------------
AZOR_STAAR       EEIKATSINNAEKLATTF---------------
AZOR_STAHJ       EEIKAASIAEAKELAKTF---------------
AZOR3_BACCZ      QEIKEAAIANARELAKRF---------------
AZOR2_BACCR      QEIKEAAIANARELAKRF---------------
AZOR3_BACC1      QEIKEAAIANARELAKRF---------------
AZOR2_BACHK      QEIKEAAIANARELAKRF---------------
AZOR3_BACAN      QEIKEAAIANARELAKRF---------------
AZOR_GEOUR       ESFKGAAVEKARGVASQF---------------
AZOR2_LISMF      AEIVAAAKAVAQESAAEF---------------
AZOR2_LISMO      AEIVAAAKAVAQESATEF---------------
AZOR2_LISIN      AEIVAAAKAVAHESAAEF---------------
AZOR_CLOP1       EEKVEEGIEKAISLAKKF---------------
AZOR2_CLOPE      KEKVEEGIEKAISLAKKF---------------
AZOR_CLOPS       KEKVKEGIEKAISLAKKF---------------
AZOR_CLOB8       DKILEEAIDKAKETAKNF---------------
AZOR2_CLOAB      EGILRNTIEKAKEQAKEF---------------
AZOR_LACP7       EAKVKEGKEKAGLVAKEF---------------
AZOR_CALS8       EKIISNALKEAEEIAKRF---------------
AZOR_LACLS       EELLAEFIKKVELEAQAF---------------
AZOR2_LACLA      EELLSEFINKVELEAQTF---------------
AZOR_ENTFA       EELLNTAMTKATEYGKTF---------------
AZOR_STRS2       QVIFEEAMAKIDQILESY---------------
AZOR2_LACPL      EQAITAAQVAAEKLAGEF---------------
AZOR1_LACLA      DELKEKAFTSAENFGKAF---------------
AZOR1_BACCZ      NEVLQNAYREVEEAASRLANK------------
AZOR1_BACC1      NEVLQNAYKEVKEAASRLANK------------
AZOR1_BACAN      TEVLQNAYKEVEEAASRLANKYIFSLEE-----
AZOR_STRA5       QVVLDKMNQDLREAFEAFYSKE-----------
AZOR_STRA3       QVVLDKMNQDLREAFEAFYSKE-----------
AZOR_STRA1       QVVLDKMNQDLREAFEAFYSKE-----------
AZOR1_LACPL      SQALKQAKMDLKAAFERFYD-------------
AZOR_CUPNH       QFREAGLASARTEIAALNDASRLAA--------
AZOR1_CUPPJ      DAREAGLSSARTEIAALNDGGRLAA--------
AZOR_AZOBR       DARAKALAAAQQEIDAL--AVPVAA--------
AZOR2_XANC5      EPAAAALISAQASIADVVRSVGRGVAHARVEA-
AZOR2_XANAC      GPAAAALISAQASIADVVRSVARGVVHTRVEA-
AZOR_RALSO       DARAQALEAAHAAMHDVVNQAIAA---------
AZOR_ACISJ       DAKAQALAAAAQAIEAHVKAHAANQDRVSQAA-
AZOR_RHOFT       APKAAALSAARADMELATA--------------
AZOR1_XANAC      QHRADALASALAGLSEEEAAAGA----------
AZOR1_XANC5      QHRADALASALAGLGEEEEAAVSA---------
AZOR_XANOR       QHRADALAAALAGLRAEQDAAVMA---------
AZOR_XANOM       QHRADALAAALAGLCAEQDAAVMA---------
AZOR3_PSEPF      EVRNNAMSAAQAKISEQLFAAA-----------
AZOR5_PSEF5      EVRSKAMSDAQAQISQQLFAAA-----------
AZOR1_PSEPK      EQRSQAIDAAQAQIASELFAAA-----------
AZOR2_PSEAE      EPRTQAIAAARRQIAGQFAAA------------
AZOR_PSE14       EPRANAMTAAQQHIESELFAA------------
AZOR_PSEU2       EPRASAMSAAQHYIQNELFAA------------
AZOR1_PSESM      EPRANAMAAAKQQIESELLAA------------
AZOR_RHIME       DQKQFAIAEAEKTIAEGNVLKLAS---------
AZOR_SINMW       DQKQFAIAEAEKTIAEGNVFKLAS---------
AZOR7_BURL3      DLRSGAIASAKEAAA-----ALAA---------
AZOR_BRASB       VVRAKAIAAAKEHAA-----KLAA---------
AZOR2_BRADU      DHREKALAGALQAAT-----SLQAA--------
AZOR_RHOPB       EHREKAIASALSAVT-----ALRAA--------
AZOR_XANCP       EARAAGMAAAQAQID-----ALPV---------
AZOR_GLUDA       DQRAAAIEAAHQTVA-----ALRV---------
AZOR_GLUOX       ADRARILSDAEQKAS-----AL-----------
AZOR_CHRVO       DKRATSIHLAKEAIAKLAL--------------
AZOR_LEGPH       EIRTQSLHQAEAKIQQLLQFQMA----------
AZOR_SALPA       EVAAKAQADAKAAIDSVVAA-------------
AZOR_SALTI       EVAAKAQADAKAAIDSVVAA-------------
AZOR_SALTY       EVAAKAQADAKAAIDSVVAA-------------
AZOR_SALPB       EVAAKAQADAKAAIDSVVAA-------------
AZOR_SALCH       EVAAKAQADAKAAIDSVVAA-------------
AZOR_SALAR       EVAAKAQSDAKAAIDSVVAA-------------
AZOR_CITK8       EVAAKAQSDAKAAIDSVVAA-------------
AZOR_SHIBS       EMAAKAQSDAKAAIDSIVAA-------------
AZOR_ECOUT       EMAAKAQSDAKAAIDSIVAA-------------
AZOR_ECO24       EMAAKAQSDAKAAIDSIVAA-------------
AZOR_SHISS       EMAAKAQSDAKAAIDSIVAA-------------
AZOR_SHIDS       EMAAKAQSDAKAAIDSIVAA-------------
AZOR_ECOLC       EMAAKAQSDAKAAIDSIVSA-------------
AZOR_ECOHS       EMAAKAQSDAKAAIDSIVSA-------------
AZOR_ECOLI       EMAAKAQSDAKAAIDSIVSA-------------
AZOR_SHIFL       EMAAKAQSDAKAAIDSIVAA-------------
AZOR_SHIF8       EMAAKAQSDAKAAIDSIVAA-------------
AZOR_ECO57       EMAAKAQSDAKAAIDSIVAA-------------
AZOR_ECOL5       EMAAKAQSDAKAAIDSIVAE-------------
AZOR_ECOL6       EMAAKAQSDAKAAIDSIVAE-------------
AZOR_CROS8       EMATKAQSDAKAAIDALVSA-------------
AZOR_YERPE       EVATKAQADAKTLLAQVVAA-------------
AZOR_YERPN       EVATKAQADAKTLLAQVVAA-------------
AZOR_YERP3       EVATKAQADAKTLLAQVVAA-------------
AZOR_YERPP       EVATKAQADAKTLLAQVVAA-------------
AZOR_YERPA       EVATKAQADAKTLLAQVVAA-------------
AZOR_YERPS       EVATKAQADAKTLLAQVVAA-------------
AZOR_YERE8       EVATKAQADAKELLTQVVSA-------------
AZOR_PECAS       DVAQKATEDAKTQLSQLVTA-------------
AZOR_SODGM       EAAVKAQEEAKASIQSFVSA-------------
AZOR_PHOLL       DAANQAQQTAREVLQAIAS--------------
AZOR_VIBVY       DFANKGLASASEHLAALTA--------------
AZOR_VIBVU       DFANKGLASASEHLAALTA--------------
AZOR_VIBPA       DAASKGISDAQSQLATMA---------------
AZOR_SHESH       EASKQGIESAQQALEKIVA--------------
AZOR_SHELP       EANEQGISQAKQSIEQLVA--------------
AZOR_SHEDO       DATAQGLLEAKTALDSLTA--------------
AZOR_SHESM       EANQKGISEAKQSLDALTV--------------
AZOR_SHESR       EANQKGISEAKQSLDALTV--------------
AZOR_SHESA       EANQKGISEAKQSLDALTV--------------
AZOR_SHEON       EANQKGISEAKASIDKLAV--------------
AZOR_SHEB9       EAHDKGMSEAKHSIDQLKA--------------
AZOR_SHEB8       EAHDKGMSEAKHSIDQLKA--------------
AZOR_SHEB5       EAHDKGMSEAKHSIEQLKA--------------
AZOR_SHESW       EAHDKGMSEAKHSIDLLTA--------------
AZOR_SHEPC       EAHDKGMSEAKHSIDLLTA--------------
AZOR_SHEFN       DAAETGISQAKLAIDAITL--------------
AZOR_SHEAM       EAAERGIKDARDQLALVG---------------
AZOR1_PHOPR      EMAAKGITNAKSALEKISA--------------
AZOR_PSYIN       ETAELNLEQARKQLSVFTNDISTLNSQS-----
AZOR_AERS4       DAQAKGIEQAKGQLETLAL--------------
AZOR4_BURL3      HGFDAGLADARRQMDALHA--------------
AZOR_HAEI8       EAIEKAQASAKNKINEIVAAL------------
AZOR_HAEIN       EAIEKAQASAKNKINEIVAAL------------
AZOR_HAEIG       EAIEKAQASAKNKINEIVAAL------------
AZOR_HAEIE       EAIEKAQSSAKNKINELITSL------------
AZOR_HYPNA       EARAAAITGAKGQIAKVAQTFSTVAA-------
AZOR2_PSEF5      DFHEKGLNQANAKLAQVA---------------
AZOR2_PSEPF      DFQEKGLNQANAKLSQVA---------------
AZOR2_PSEPK      EFHEKGVNQAKAKLAAVA---------------
AZOR3_PSEAE      EFREKGLARARERMRQALETDTSLCVPLPTLR-
AZOR_AROAE       DAAEQAFAEAERDIEAALA--------------
AZOR_DECAR       ESASKAFAEAEAQIEELIA--------------
AZOR_AZOSB       EAAAKGFAQAAADLDAALAA-------------
AZOR_BURP1       DAATEALASAREAIAAV----------------
AZOR_BURPS       DAATEALASAREAIAAV----------------
AZOR_BURMA       DAATEALASAREAIAAV----------------
AZOR_BURTA       DAASEALASAREAIAAV----------------
AZOR6_BURL3      DAQSAALAGAREAIAAA----------------
AZOR_ALCBS       DVKEKALAVARSELLAST---------------
AZOR_BORPA       LAAQEGLALARQRIDALSLDARQGLAAA-----
AZOR_BORBR       LAAQEGLALARQRIDALSLDARQGLAAA-----
AZOR_BORA1       FAAAEGLAQAKARIDELLPQLA-----------
AZOR_SACD2       KR-EQGLADASAKIAALVGEEAA----------
AZOR_MARMS       PG-EDAFNQAKSQIAVAV---------------
AZOR_RHIL3       EAAEKAIDAAKSRVQEIALAA------------
AZOR1_RHIEC      EAAEKAIGAAKSRVEEIALAA------------
AZOR_AGRFC       EAVEKAVAAAEAKVEELAQAA------------
AZOR_RHILO       DAVTAALAKATAKVDAVVASQQAAAAA------
AZOR2_RHIEC      EAAKAAIAATEAQVRAVLEKAA-----------
AZOR_AZOC5       EAAKAAIAATEAQVRSILETAA-----------
AZOR1_BURL3      EAVQAAIAKAGQELQALVEQAG-----------
AZOR_HERAR       EGVNKALAKTSNTINELLPA-------------
AZOR1_HAHCH      VDPESILADAQQQIAAATEVAAA----------
AZOR1_JANSC      VDPDAAHKTAQTQIEALAA--------------
AZOR_THIDA       LRGDSARQNAAEHVADVLERDWPALAEAS----
AZOR1_COLP3      RDESQTLAHAHKAIERV----------------
AZOR_RHOS1       FGADEAMARAEAAVAALAA--------------
AZOR_RHOS4       FGADEAMARAEAAVAALAA--------------
AZOR_ERYLH       EGGEEKIASAHKQVEQVAA--------------
AZOR_PELUB       LDYEKSIKEAEKQIENII---------------
AZOR_NOSS1       REKSLAGAKDAIAQAVANW--------------
AZOR2_TRIV2      REKSLADAKDAIAQAVANW--------------
AZOR1_TRIV2      RQLAIATAHEAIQQVVKTWQSSTCI--------
AZOR_FRACC       ALAEFIDLFQRSKAEAAAAARLRASV-------
AZOR_FRAAA       ALADFTDVYERSRAAGESALRARAAA-------
AZOR_STRAW       AMSELVPLAEASRAKAHEDAAAKAKELADRFAA
AZOR_NOCFA       ALAARRAEHDASYADALDTARRLGKEYR-----
AZOR1_PSEAE      FEDSCDEAEQRLLALARSA--------------
AZOR1_PSEPF      FAVSVAEAEQRLLDLARAF--------------
AZOR1_PSEF5      FAQSCGEAQQRLLALAQSF--------------
AZOR_GRABC       ETTMEDFIETLQPAIEAAAA-------------
AZOR2_JANSC      EATMDGFIATLDSELTAAAQ-------------
AZOR8_BURL3      EISRSDFLEAFASDMADAAARPVVQV-------
AZOR3_BURL3      KADSAVFLAPHVDAVRALFA-------------
AZOR_HYDCU       ASINKSIKQAKQTLQNCL---------------
AZOR_BRASO       AAVADGRAAAASRIRTLVAGAVGAQQPA-----
AZOR4_PSEF5      VRATLDEARSALSLQPLFNPLVCA---------
AZOR5_BURL3      IDAVRGQLAQSALLARRATETA-----------
AZOR2_CUPPJ      V--ARGFERLNAWTGSLAIRAA-----------
AZOR_ALKEH       AAQRRTVTAQLREWVHAC---------------
AZOR2_HAHCH      LTRDVAVPKAISSVDEMII--------------
AZOR_DESVV       DTAQAKRAEAVEQARRMALEF------------
AZOR_DESVH       DTAQAKRAEAVEQARRMALEF------------
AZOR3_PSEF5      ASRQAAAEQAQALAQQLAARQY-----------
AZOR2_BURL3      ARASDSIERAQARAVEMAAEF------------
AZOR9_BURL3      ANGTVDRSRAIDEARTIARTF------------
AZOR_DESPS       ASRERVLATAKLEAISLAKELYSLI--------
AZOR2_PSESM      ATAEANFTAALAEASKLAAAVQP----------
AZOR1_BRADU      DPILAARETAYRRLREIATWF------------
AZOR_RUEPO       DP-QAGYDRALAALTAA----------------
AZOR_MYCPU       TPQEIIEKFDGEIKKAAYSF-------------
AZOR_MYCPE       TPVERINEFDSVIRLKAKEFAALPAVDWKPLEQ
AZOR_MYCMO       KAPEALDLFDKVIKTAAENF-------------
AZOR_MYCS5       KPYDVVEEFRQDALEKAKQF-------------
AZOR_MYCMS       TPEQRVETIIDEVIEAARTF-------------
AZOR_MYCCT       TPAQRVETIIDEVIQAAKTF-------------
AZOR1_MESFL      SPKEIVSSITSDLIAAAKKF-------------
AZOR_MYCGA       QPKEIVEPNLALIKEKAKNF-------------
AZOR_MYCGE       NKQEVVDLFAHKVDQVANNF-------------
AZOR_MYCPN       SKSEVVDMFAKQVDAIANEF-------------
AZOR_MYCH7       PIADFVAQRQNQIKILAENF-------------
AZOR_MYCH2       PIADFVAQRQNQIKILAENF-------------
AZOR_MYCHJ       PIADFVAQRQNQIKILAENF-------------
AZOR2_MESFL      SPIENLEKVKEQILKAAKNF-------------
AZOR2_COLP3      ARHEESLSNAYRGVEELVKQLV-----------
AZOR2_PHOPR      RSVAQWVEHAKYDIEQMVTSF------------