CLUSTAL format seed alignment for MF_01217

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ACP_BACHD       --------MADTLSRITKIVVDRLGV-DEAEVKPEASFKDDLGADSLDVVELVMELEDEF
ACP_BACSU       --------MADTLERVTKIIVDRLGV-DEADVKLEASFKEDLGADSLDVVELVMELEDEF
ACP_LISMO       --------MAEVLEKVTKIIVDRLGV-EESKVTLEASFKEDLGADSLDVVELVMELEDEF
ACP_STAAM       ---------MENFDKVKDIIVDRLGV-DADKVTEDASFKDDLGADSLDIAELVMELEDEF
ACP_DEIRA       ---------MATFDDVKDVIVDKLGV-DEGKVTPEARFVEDLGADSLETVELIMGLEDKF
ACP_HELPJ       ---------MALFEDIQAVIAEQLNV-DAAQVTPEAEFVKDLGADSLDVVELIMALEEKF
ACP_CAMJE       ---------MATFDDVKAVVVEQLSI-DADAVKMESKIIEDLGADSLDVVELIMALEEKF
ACP_BRAHO       ---------MALIDEIKDVVANQLNISDKSKITDTASFVDDLNADSLDLVELIMELEKRY
ACP_CHLTR       ---------MSLEDDVKAIIVDQLGV-SPEDVKVDSSFIEDLNADSLDLTELIMTLEEKF
ACP_CHLPN       ---------MSLEDDVIAIIVEQLGV-DPKEVNENSSFIEDLNADSLDLTELIMTLEEKF
ACP_AQUAE       ---------MSLEERVKEIIAEQLGV-EKEKITPEAKFVEDLGADSLDVVELIMAFEEEF
ACP_FUSNN       -----------MLDKVKEIIVEQLGV-DADQIKPESNFVDDLGADSLDTVELIMSFEEEF
ACP_CLOAB       ----------MVFEKVKDIIADQLGI-DATEIKMESSFIDDLGADSLDIVELIMALEEEF
ACP_CALS4       ----------MIFEKVRNIIAEQLGI-DPEEITMESSFIDDLGADSLDIVELIMALEEEF
ACP_CLOPE       -----------MFDKLKEIIADKLSV-NEDEITMESTFIDDLGADSLDIVELIMALEEEL
ACP_AZOBR       --------MSDVAERVKKIVVDHLGVE-ESKVTENASFIDDLGADSLDTVELVMAFEEEF
ACP_RHOSH       --------MSDIADRVKKIVVEHLGVE-EEKVTETTSFIDDLGADSLDTVELVMAFEEEF
ACP_CAUVC       --------MSDILERVRKIVIEHLDAD-PEKVTEKASFIDDLGADSLDNVELVMAFEEEF
ACP_NEIMA       --------MSNIEQQVKKIVAEQLGVN-EADVKNESSFQDDLGADSLDTVELVMALEEAF
ACP1_RALSO      --------MDNIEQRVKKIVAEQLGVA-EADIKNESSFVNDLGADSLDTVELVMALEDEF
ACP_COMTE       --------MSDIEARVKKIIAEQLGVE-ESQVTNEKAFVADLGADSLDTVELVMALEDEF
ACP_ECOLI       --------MSTIEERVKKIIGEQLGVK-QEEVTNNASFVEDLGADSLDTVELVMALEEEF
ACP_MORMI       --------MSNFEERVKKIIIEQLGVK-EEEVKNEASFVDDLGADSLDTVELVMALEEEF
ACP_PASMU       --------MS-IEERVKKIIVEQLGVK-EDEVKPEASFVEDLGADSLDTVELVMALEEEF
ACP_LEUMU       --------MSDIEQRVKNVVVEQLGVD-EAEVTNAASFVDDLGADSLDTVELVMALEEEF
ACP_XYLFA       --------MSDIEARVRKIVAEKLNVD-EEKVTNTSTFVDELGADSLDTVELVMALEDEF
ACP_BUCAI       --------MKNIEERIKKIIFEKLDIK-QEKIFNDASFIDDLGADSLDTVELIMALEEEF
ACP_NOSS1       ------MSQSETFEKVKKIVIEQLSVENPDTVTPEASFANDLQADSLDTVELVMALEEEF
ACP_SYNY3       ------MNQ-EIFEKVKKIVVEQLEVD-PDKVTPDATFAEDLGADSLDTVELVMALEEEF
ACP_GUITH       ------MNEQEIFEKVQTIISEQLGVD-KSQVTKDANFANDLGADSLDTVELVMAIEEAF
ACP_PORPU       ------MQDNEIFEKVQDIVAEQLGIE-KTIVTREANFSSDLGADSLDTVELVMAIEEKF
ACP_CYACA       -----MVTKEEILKKVQSIVSEQLGIS-KEQVLVDSHFTNDLGADSLDNVELVMAIEEEF
ACP_CYLSN       -------MS-DTLKRLQKIVSEQLSVD-PEKVTSTADFGKQLGADSLDIIELIMTIEYEF
ACP_TRICV       -------MSDDTFSRIQSIVEEQLGVE-SSKIKLETDFQKDLGADSLDVVELIMAFEEEF
ACP_RICPR       MEFKIMSTTDKIEQKVIEMVAEKLNKD-KAIITTDSRFIEDLKADSLDTVELMMAIEVEY
ACP_BORBU       -----MDN-DEIFSKVRSIISEQLDKK-EDEITTDSRFVEDLNADSLDIYELLYLLEEAF
ACP2_PSEAE      --------MDDIETRVRKLVAARFGVE-ECDIRLDSDFRNDFGAESLEVVELVMALEAEF
ACP_TREPA       --------MDELFLRMRALVAEKLEVE-EASITLDSSFRGDLGADSLDTYELVYAIEEEM
ACP_THEMA       -----MASREEIFSKVKSIISEKLGVD-ESQVTEEAKLIDDLGADSLDLVDLVMDFESEF
ACP3_RALSO      ------MSNPTVLDQIRHIIAQALDKP-VETIHAEQSFRRDLGADSLDSVEIVMAIEDQF
ACP_STRPN       ---------MAVFEKVQEIIVEELGKD-ASEVTLESTF-DDLDADSLDLFQVISEIEDAF
ACP_LACLA       ---------MAVFEKVQDIIVDELGKE-KEEVTLETSF-EELDADSLDLFQIINDIEDEF
ACP_MYXXA       -----MASKEEILAGLAEIVNEETGLD-TAEVQPEKSFTDDLDIDSISMMTIVVNAEDKF
ACP2_RALSO      ------MTETEILERIRSIFQENFAID-PARVTPEAHLFEELDLDSIDAVDLAIKLQEMT
ACP_SACEN       ------MDRKEIFERIEQVLAEQLGIP-AEQITEEADLREDLGMDSLDLVELVSALEDEV
                               :  :.           :     :  ::  :*:.   :    :   

ACP_BACHD       DLEISDEEAEKIATVADVVEYIEGRQ----------------
ACP_BACSU       DMEISDEDAEKIATVGDAVNYIQNQQ----------------
ACP_LISMO       GVEISDGDAENINTVGDAVKYIEANA----------------
ACP_STAAM       GTEIPDEEAEKINTVGDAVKFINSLEK---------------
ACP_DEIRA       GVTIPDEAAETIRTVQAAVDYIDNNQ----------------
ACP_HELPJ       NIEIPDEQAEKIVNVGDVVKYIEDNKLA--------------
ACP_CAMJE       EVEIPDSDAEKLIKIEDVVNYIDNLKK---------------
ACP_BRAHO       EIKIPQEDQEKIKNVADAAKYIEEHKK---------------
ACP_CHLTR       AFEISEDDAEQLRTVGDVIKYIQERQN---------------
ACP_CHLPN       AFEISEEDAEKLRTVGDVFTYIKKRQAEQ-------------
ACP_AQUAE       GIEIPDEDAEKIQTVGDVINYLKEKVGG--------------
ACP_FUSNN       GVEIPDTEAEKIKTVQDVINYIEANKK---------------
ACP_CLOAB       DIEMPDEEAEKVSSVGDVVNYIKAHTEE--------------
ACP_CALS4       DIEIPDEDAEKIKTVGDVVEYLSNIVE---------------
ACP_CLOPE       EMEIPDEDAEGFKTVGDVVEYITEHTEK--------------
ACP_AZOBR       GCEIPDDAAEKILTVKDAIDFIKANAAA--------------
ACP_RHOSH       GIEIPDDAAETIQTFGDAP-----------------------
ACP_CAUVC       DIEIPDDAAEHIQTVGDAVKFITEKTA---------------
ACP_NEIMA       GCEIPDEDAEKITTVQLAIDYINAHNG---------------
ACP1_RALSO      GMEIPDEEAEKITTVQQAIDYARANVKA--------------
ACP_COMTE       GIEIPDEDAEKITTVQNAIDYANTHQA---------------
ACP_ECOLI       DTEIPDEEAEKITTVQAAIDYINGHQA---------------
ACP_MORMI       DTDIPDDEAEKITTVQAAIDYVVSSAE---------------
ACP_PASMU       DIEIPDEEAEKITTVQSAIDYVQNNQ----------------
ACP_LEUMU       GTEIPDEEAEKITTVQLAIDYVKSHQ----------------
ACP_XYLFA       QCEIGDEAAEKMTSVQHAIDYIKSNAKC--------------
ACP_BUCAI       DIEISDEEAEKINTVQKSIDFIQKKNLKK-------------
ACP_NOSS1       DIEIPDEAAEKITTVQEAVDYINNQVAASA------------
ACP_SYNY3       DIEIPDEVAETIDTVGKAVEHIESK-----------------
ACP_GUITH       NIEIPDDAAEQISNLQQAVDFISQKVAA--------------
ACP_PORPU       AIEIPDEDAEKITNLSEVVDFIKSKLNTISV-----------
ACP_CYACA       NIVISDIDAEKISNVREAVEFIIDKINNKANA----------
ACP_CYLSN       NIDIEDHYASKITTVQDALNYIENKIKQK-------------
ACP_TRICV       DINVNDDAAGDIKTVQQVLEYIEAESAK--------------
ACP_RICPR       GIDIPDDEATKIKTVSDVIKYIKERQS---------------
ACP_BORBU       DDKIPENEANEFETVGDVVNFIKKRKG---------------
ACP2_PSEAE      GVEIADDDAERIETVRQAIDYLEEAVPT--------------
ACP_TREPA       GITIPDEKANEFETVRDAYEFIKSKVT---------------
ACP_THEMA       GVKVDDADLEKISTVGDIVSYIEKKLG---------------
ACP3_RALSO      AVEFDEDSTAAVDTVQDLVTYIEAALASRGAQTA--------
ACP_STRPN       DIQIEAE--NDLKTVGDLVAYVEEQAK---------------
ACP_LACLA       DVEVDTE--ADMKTVADLVKYVENNK----------------
ACP_MYXXA       GVKIPDEEVKNLKTVQDAVDFIXGA-----------------
ACP2_RALSO      GRRIKPEEFKSVRTVGDVIGAVQSLLAA--------------
ACP_SACEN       GMRVEQSQLEGIETVGHVMELTLDLVARLATASAADKPEAAS
                   .       . ..