CLUSTAL format seed alignment for MF_01218_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

UPP_MYCGE       --------MIKKVQHALILNELTKLRDKNTTTSQFRMALNQITSLLFFEATKQ-LPLATV
UPP_MYCPN       --------MIKKVHHALIENELTKLRDKSSSSSQFRMALSQITSLLFFEVTKE-SPLEEI
UPP_UREPA       --------MHKIINHPLIKDKLTRMRKVSTVSTVFRTNLEELTQLMVYEATKD-LELNEI
UPP_MYCHO       --------MVKIFQHPLINAKLTTMRSKETSYKDFRDNLNEIASLMVYETLRD-YQTKKI
UPP_MYCPU       --------MLKVIDHPLIKQKLSVIRSQKAGHDVFRKNVIEIASLMTYEVFRN-YKLKEI
UPP_FUSNN       -------MSVIEINHPLIEHKMTILRSVDTDTKSFRENLNEIAKLMTYEATKN-LKLETT
UPP_BACCL       ------MGKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRD-LPLEEV
UPP_BACSU       ------MGKVYVFDHPLIQHKLTYIRNENTGTKDFRELVDEVATLMAFEITRD-LPLEEV
UPP_ALKHC       ------MSKVYVFDHPLIQHKLTYIRDKSTGTKEFRELVDEVAALMAFEITRD-LPLQEV
UPP_STAAM       ------MSKVHVFDHPLIQHKLSYIRDVNTGTKEFRELVDEVGMLMAYEVTRD-LELQDV
UPP_LISMO       ------MANVHVINHPLVQHKLTIIRDKNTGTKAFRELVDEVATLMAYEITRD-MELEDI
UPP_LACPL       ------MGKFEVLDHPLIQHKLTIIREKNCGTKVFREMVNEISTLMAYEVSRD-MPLKDI
UPP_STRP1       ------MGKCQVISHPLIQHKLSILRRQTTSTKDFRELVNEIAMLMGYEVSRD-LPLEDV
UPP_LATSK       ------MAKFTVLNHPLIQHKLTIIRNKNTGTKVFREVANEIAELMVYEITRD-LAMEDV
UPP_CLOAB       ------MSKVTQISHPLILHKLAFMRDKKTGSKDFREMVEEVAMLMAYEVTRE-MQLETV
UPP_CLOPE       ------MSKVTEITHPLILHKLAFIRDKNTGSKDFRELVSEVSMLMAYEVTRN-LPMEEI
UPP_CALS4       -----MYENVFVIDHPLIQHKISLIRDENTGSKEFRELVGEIAMLMAYEVTRD-LPLEEI
UPP_DEIRA       -----MCLMVTLVEHPLVQHKLSLMRDERTGVKEFRELAGELSLLLAYEAMRD-LEVEPV
UPP_THEMA       ------MKNLVVVDHPLIKHKLTIMRDKNTGPKEFRELLREITLLLAYEATRH-LKCEEV
UPP_RHILO       ------MKGVTVVDHPLVQHKLTIMRKKETSTAGFRRLLREISLLLGYEVTRN-LELTTT
UPP_RHIME       ------MDGVTVIGHPLVQHKLTIMRKKETSTAGFRRLLKEISTLLCYEVTRD-LELTTE
UPP_CAUVC       ------MSNVTVVSHPLVQHKLTKMRDKTTSTKTFRALMRETATLICYEVTRD-LPMDEV
UPP_RALSO       MTQDPRFPNLFILNHPLIQHKLTHMRDKDTSTRTFRELLREITLLMGYEITRN-LPLTTR
UPP_CHLMU       <LSSKPLAAVYVLSHPLIQHKASLLRNKNTKSKIFRECLKEISLGVCYEATRD-LALKNI
UPP_ECOLI       -------MKIVEVKHPLVKHKLGLMREQDISTKRFRELASEVGSLLTYEATAD-LETEKV
UPP_PSEAE       -------MPVHEIRHPLIRHKLGLMRRADISTKNFRELAQEVGALLTYEATKD-LPLEQY
UPP_NEIMB       -------MNVNVINHPLVRHKLTLMREADCSTYKFRTLATELARLMAYEASRD-FEIEKY
UPP_MYCTU       -------MQVHVVDHPLAAARLTTLRDERTDNAGFRAALRELTLLLIYEATRD-APCEPV
UPP_CORGL       -------MDITIVNHPLVASRLTLLRDERSDNAAFRAAANDLGAMLIYEASRD-LEVEHF
UPP_STRCO       -------MRLHVVDHPLVAHKLTTLRDQRTDSATFRRLADELVTLLAYEATRD-VRTEQV
UPP_CAMJE       ------MKNIHCINHPLIEHKLGILRAKETKPFQFRMLIDEISSFLLFEASKD-FSLKEI
UPP_AQUAE       --------MIVELSHPLIKHKVNTARIQDTSAEKLRKTLKELGFMLVYEALKD-ILLEEK
UPP_SYNY3       ---MASQLRVYVPEHPLIKHWLGVARDENTPPVLFKTAMGELGRWLTYEAARYWLPTVDT
UPP_NOSS1       ---MTVQLRVYVPPHPLIKHWLAVARDAATPSVLFRSAITELGRWLTYEAAREWLPTEET
                              *.*        *        ::    :    : :*           

UPP_MYCGE       EVETPFAK-TKGYKLKND-IVLVPIMRAGLGMIDAIVRYSDKIRVGHLGIYRQTQTTSVI
UPP_MYCPN       VVKTPFTK-TKGYKLKNE-IVLVPIMRAGLGMVDPIVRYSEKIRVGHLGIYREHEGTNVI
UPP_UREPA       EIETPVVKVAKGYKLKNK-ICLIPILRAGIGMVDGVKSLIPTATIGHIGLYRNEQTLKPV
UPP_MYCHO       SITTPMNVKYEGETLDRE-IVIIPILRAGLGMLNGIMNLVPQARVGHIGMYRNEETNEVV
UPP_MYCPU       KIDTPVAQDVLAYDYDKE-IVIVAILRAGLAMVPGIVNLLPKARVGHIGIFRDEKTFEPN
UPP_FUSNN       EVTTPLMK-TQAYTLQDK-VALVPILRAGLGMVDGILDLIPTAKVGHIGVYRNEETLEPV
UPP_BACCL       EIETPVSKARAKVIAGKK-LGVIPILRAGIGMVDGILKLIPAAKVGHIGLYRDPQTLKPV
UPP_BACSU       DINTPVQAAKSKVISGKK-LGVVPILRAGLGMVDGILKLIPAAKVGHVGLYRDPETLKPV
UPP_ALKHC       TVETPVGPATSKKIAGKK-LGLVPILRAGLGMVDGILRMIPAAKVGHVGLYRDPETLQPV
UPP_STAAM       DIETPVTKMTAKRLAGKK-LAIVPILRAGLGMTDGILSLVPAARVGHIGLYRDPETLKAV
UPP_LISMO       QVETPLQTTTAKTLTGKK-LGIVPILRAGLGMQDGILKLIPAAKVGHVGLYRDHDTLEPV
UPP_LACPL       EIETPIAKSTQKTLAGKK-VAIVPILRAGLGMVDGFLNMIPAAKVGHVGMYRDEKTLKPV
UPP_STRP1       DIQTPVSKTVQKQLAGKK-LAIVPILRAGIGMVDGLLSLVPAAKVGHIGMYRNEETLEPV
UPP_LATSK       EVETPMGPAIEKQLSGKK-LAVVPILRAGLGMVDGVLELIPAAKVGHIGMYRDEKTLQPH
UPP_CLOAB       EIETPICITKCKMLAGKK-VAIVPILRAGLGMVNGVLKLIPAAKVGHIGLYRDEKTLKPV
UPP_CLOPE       EIETPVCKTKCKVLAGKK-VAIVPILRAGLGMVDGMLQLIPAAKVGHIGLYRDEETLQPV
UPP_CALS4       EVKTPIAVAKTKVIAGKK-LGIIPILRAGLVMADGMLKLIPTAKVGHIGIYRDPETLKPV
UPP_DEIRA       RFATPIEEGDFPMLSGKK-LALVAILRAGLVMTDAIVTLVPAAKVGHIGMYRDPQSLAPV
UPP_THEMA       EVETPITKTIGYRINDKD-IVVVPILRAGLVMADGILELLPNASVGHIGIYRDPETLQAV
UPP_RHILO       TIETPIETMEAPTLEGKK-LVFASVLRAGNGLLEGLLDLVPAARVAHIGLYRDHETLEAV
UPP_RHIME       RIETPLVETDAPVLEGKK-LVFASILRAGNGLLEGMLELVPSARVAHIGVYRDHETLQAV
UPP_CAUVC       QIETPVAPTKAYEIAGKK-LVFAPILRTGLGMCEGMLDLVPSARVAHIGLYRDHETLEAV
UPP_RALSO       HIETPMGPMDAPVIAGRK-LAVVPVLRAGVGMSDGLLELIPSARVGHIGVYRD-EQHRPV
UPP_CHLMU       SIQTPLMQAECPHLTGTK-IVVIPVLRAGLGMVDGFLALVPNAKVGLIGMSRNHETFQPS
UPP_ECOLI       TIEGWNGPVEIDQIKGKK-ITVVPILRAGLGMMDGVLENVPSARISVVGMYRNEETLEPV
UPP_PSEAE       EIPGWAGPVTVEKISGKK-ITVVPILRAGIGMLDGVLSLIPGAKVSAVGVARNEETLEAR
UPP_NEIMB       LIDGWCGQIEGDRIKGKT-LTVVPILRAGLGMLDGVLDLIPTAKISVVGLQRDEETLKPI
UPP_MYCTU       PIRTPLAETVGSRLTKP--PLLVPVLRAGLGMVDEAHAALPEAHVGFVGVARDEQTHQPV
UPP_CORGL       DTKTPVAMAEGTRLKQP--PIIVPIIRAGLGMIDPALSMIPDAQVGFIGLARDEETHEPV
UPP_STRCO       DIHTPVSRTTGVKLSHPR-PLVVPILRAGLGMLDGMVRLLPTAEVGFLGMVRNEETLQAS
UPP_CAMJE       EISTPIQKTTVKKLDEK--IMICPILRAALGMLESVFKMIPDASVGFLGFVRNEETLKAD
UPP_AQUAE       EVRTWIGNKRFNYLNEEE-IVFVPILRAGLSFLEGALQVVPNAKVGFLGIKRNEETLESH
UPP_SYNY3       EVKTPLAIAKASLIDPQTPFVIVPILRAGLALVEGAQGLLPLAKIYHLGLVRNETTLEPS
UPP_NOSS1       TVQTPLEICPATVINPQVPVAVVPILRAGLGLLEGAQTVLPLASIYHLGLVRNEETLEAS
                                     . .::*:.  :            :  :*. *:       

UPP_MYCGE       SYYKKMPENIS-DSHVIILDPMLATGTTLLTAIKSIKEDKPIK--ISVIAIVAAPEGINK
UPP_MYCPN       SYYKKMPENIG-NSHVIILDPMLATGTTLATAISSIKKNHPIK--ISVVAIVAAPEGIKA
UPP_UREPA       EYFKKFPKNIS-ESDVIILDPMLATGGSVVEAVNIIKKYNPKS--IKFVCIVAAPEGLKY
UPP_MYCHO       EYFFKIPEVPH-DSYIIIVDPMLATGSSACDAIAKLDKLGFNN--IKLVCLVGVQQGIDK
UPP_MYCPU       NYFYKIPDVPK-DSEILIVDPMLATGNSAVYAIERLKKDGFKN--IRLLSLVGVQEGVDN
UPP_FUSNN       YYYCKLPTDIA-SRKVILVDPMLATGGSAVYAIDYLKEQGVTD--IIFMCLVAAPDGIAR
UPP_BACCL       EYYVKLPSDVE-ERDFIIVDPMLATGGSAVAAIDALKKRGAKS--IKFMCLIAAPGRVKA
UPP_BACSU       EYYVKLPSDVE-EREFIVVDPMLATGGSAVEAIHSLKKRGAKN--IRFMCLVAAPEGVEE
UPP_ALKHC       EYYVKLPTDVE-ERELIVIDPMLATGGSAVEAINCLKKRGATS--IKLMCLIAAPEGVEV
UPP_STAAM       EYFAKLPQDIT-ERQIIVVDPMLATGASAIEAITSLKKRGAKN--IRFMCLIAAPEGVEK
UPP_LISMO       EYFVKLPSDVE-ERLFIVVDPMLATGGSAIMAIDCLKKRGARN--MKFMCLVAAPEGVKA
UPP_LACPL       EYFVKLPSDIS-QRQLFVVDPMLATGGSAIMAMDMLKKRGASN--IKFMCLVAAPEGVKA
UPP_STRP1       EYLVKLPEDIN-QRQIFLVDPMLATGGSAILAVDSLKKRGAAN--IKFVCLVAAPEGVKK
UPP_LATSK       EYFVKLPTDID-QRQLFIVDPMLATGGSAIMAIDALKKRGATS--MRLVVLVAAPEGVKA
UPP_CLOAB       EYFCKLPQDIE-ERDIIVTDPMLATGGSAIDAITLLKKRGAKY--IRLMCLIGAPEGIAA
UPP_CLOPE       EYFCKLPQDIA-ERDVIVVDPMLATGGSAADAITLLKKRGAKQ--IRLMCLISSPEGIEF
UPP_CALS4       EYYCKLPSDIA-ERDLIVVDPMLATGGSASAAIHFLKERGAQS--IKLVNLIAAPEGIKA
UPP_DEIRA       AYYSKLPADIA-ERRVFLTDPMLATGGSANAAIQNLKDAGAQS--IKLMTILAAPEGIHA
UPP_THEMA       EYYAKLPPLND-DKEVFLLDPMLATGVSSIKAIEILKENGAKK--ITLVALIAAPEGVEA
UPP_RHILO       EYFFKAPSDLA-DRLVIVVDPMLATANSAIAAIDKLKGRGATN--IRFLCLLAAPEGIER
UPP_RHIME       EYFFKAPDNIN-ERLVIVVDPMLATGNSAIAAIEKLKERGARN--IRFLCLLAAPEGIRN
UPP_CAUVC       EYYFKAPEDIA-GRLVIVVDPMLATGHSAIAAIARLKHYGVTN--LRFVCLLAAQAGVDA
UPP_RALSO       EYLVRLP-DLE-ERTFILCDPMVATGHSAVHAVDVMKQRGVPDEHILFLALVAAPEGVEV
UPP_CHLMU       SYCCKLPEDIA-DCHVFIVDPMLATGGSASATIQLVKEHGAKN--ITLLNVLAVPEGIER
UPP_ECOLI       PYFQKLVSNID-ERMALIVDPMLATGGSVIATIDLLKKAGCSS--IKVLVLVAAPEGIAA
UPP_PSEAE       TYLEKLAPDIA-ERRSLIIDPMLATGGSMVATIDLLKKAGSKE--IRAMVLVAAPEGIEA
UPP_NEIMB       SYFEKFVDSMD-ERPALIIDPMLATGGSMVATIDLLKAKGCKN--IKALVLVAAPEGVKA
UPP_MYCTU       PYLDSLPDDLT-DVPVMVLDPMVATGGSMTHTLGLLISRGAAD--ITVLCVVAAPEGIAA
UPP_CORGL       PYLEALPQDLS-NQPVFLVDPMLATGGSLLHAIRLLADRGATD--ITAICMVSAQPGVDA
UPP_STRCO       TYATRMPDDLS-GRQVYVLDPMLATGGTLVASIRELIKRGADD--VTAVVLLAAPEGVEL
UPP_CAMJE       FYFQKLPKDAK-KRTAIVIDPMFATGGTAIDACNFLKSQGVKK--IKFISILAAPQGLKK
UPP_AQUAE       IYYSRLP-ELK-GKIVVILDPMLATGGTLEVALREILKHSPLK--VKSVHAIAAPEGLKR
UPP_SYNY3       LYLNKLPERFAPGTHLLLLDPMLATGNTIMAALDLLMARDIDANLIRLVSVVAAPTALQK
UPP_NOSS1       CYLNKLPEKFDPQTRVLITDPMLATGGSIMKAMSELTERGVDPSLVRIVSVVAAPPALQK
                 *               : ***.**. :   :   :         :  :  :.    :  

UPP_MYCGE       VEKM-H-PHVDIFLAAIDEKLNDNRYIIPGLGDAGDRLFGTK----
UPP_MYCPN       VEAA-H-PDVDIYLAAIDEKLNKDNYIIPGLGDAGDRLFGTK----
UPP_UREPA       VQEV-H-PEVDVYIAALDDKLNENGYITPGLGDAGDRIFGTK----
UPP_MYCHO       VTKQ-F-PNVDIYLASKDEKLNEHNYILPGLGDAGDRIFGTKIK--
UPP_MYCPU       IEKN-VGKDFPIFLGSLDEKLNDKKYIVPGLGDAGDRIFGTK----
UPP_FUSNN       LLNK-H-PDVPIYTAKIDQGLNENGYIYPGLGDCGDRIFGTK----
UPP_BACCL       VETA-H-PDVDIYIAALDERLNDHGYIVPGLGDAGDRLFGTK----
UPP_BACSU       LQKH-H-SDVDIYIAALDEKLNEKGYIVPGLGDAGDRMFGTK----
UPP_ALKHC       VKEA-H-PDVDIYLAALDEKLNEKGYIVPGLGDAGDRLFGTK----
UPP_STAAM       MHEA-H-PDVDIYIAALDEKLNDKAYITPGLGDAGDRLFGTK----
UPP_LISMO       LQDA-H-PDVEIYVAGLDEKLDENGYIRPGLGDAGDRLFGTK----
UPP_LACPL       LRDA-H-PDIDVYTAALDDHLNEDGYIVPGLGDAGDRLFGTK----
UPP_STRP1       LQEA-H-PDIDIFTAALDDHLNEHGYIVPGLGDAGDRLFGTK----
UPP_LATSK       VQEA-H-PDVDIYAAGLDDGLNEEGYIYPGLGDAGDRLFGTK----
UPP_CLOAB       VQEA-H-PDVDIYLASIDEKLDENGYIVPGLGDAGDRLFGTK----
UPP_CLOPE       VQKA-H-PDVDIYVACIDEKLNDHGYIVPGLGDAGDRLFGTK----
UPP_CALS4       VHKD-H-PEVPIYVASIDQGLNEHGYIVPGLGDAGDRLFGTK----
UPP_DEIRA       VQQA-H-PDVDIVTASVDSRLNDHGYIVPGLGDAGDRIYGTK----
UPP_THEMA       VEKK-Y-EDVKIYVAALDERLNDHGYIIPGLGDAGDRLFRTK----
UPP_RHILO       FTKA-H-PDVPVFTASIDRQLNEKGYIMPGLGDAGDRMYGTK----
UPP_RHIME       FQGA-H-PDVPIFTASIDSHLNEKGYIVPGLGDAGDRMYGTK----
UPP_CAUVC       LREA-H-PDVPIWTAAIDQTLNDHGYIVPGLGDAGDRTFGTR----
UPP_RALSO       FQQA-H-PGVKLYVASLDSHLNEHAYIIPGLGDAGDRLFGTKN---
UPP_CHLMU       IQKD-H-PDVTIYVASLDEKLNESAYILPGLGDAGDRLCGTSNPS-
UPP_ECOLI       LEKA-H-PDVELYTASIDQGLNEHGYIIPGLGDAGDKIFGTK----
UPP_PSEAE       VRKA-H-PDVIIYTASIDEKLDENGYIIPGLGDAGDKIFGTKQKEA
UPP_NEIMB       VNDA-H-PDVTIYTAALDSHLNENGYIIPGLGDAGDKIFGTR----
UPP_MYCTU       LQK--AAPNVRLFTAAIDEGLNEVAYIVPGLGDAGDRQFGPR----
UPP_CORGL       LAE--SGLPVRLVTATIDPGLDENAYIVPGLGDAGDRLYGPRNIDL
UPP_STRCO       MERELAGTPVTVVTASVDERLNEQGYIVPGLGDAGDRMYGAAE---
UPP_CAMJE       FSQM-H-DDVEVFVACIDEGLNEKGYIIPGLGDAGDRVFNTL----
UPP_AQUAE       IEEKFK--EVEIFVGNVDERLNDKGYIIPGLGDIGDRLYAVSVY--
UPP_SYNY3       LSNA-H-PNLTIYTAMIDEQLNDRGYIVPGLGDAGDRCFGT-----
UPP_NOSS1       LNAA-Y-SGLIVYTATIDETVNDQGFIVPGLGDAGDRIFGT-----
                .        . :  .  *  ::.  :* ***** **: