CLUSTAL format seed alignment for MF_01219

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PYRR_NOSS1       ------MATPAKVIEILSAEDLRRTLTRLASQIVERTRDLSQ-------LVLLGIYTRGV
PYRR_SYNY3       --------MAAQIIEILSPEEIRRTLTRLASQVIEKNSDLSE-------LVLLGIYTRGV
PYRR_CORGL       -----MSERNSAVLELLNEDDVSRTIARIAHQIIEKTALDSK---DADRVMLLGIPSGGV
PYRR_MYCTU       MGAAGDAAIGRESRELMSAADVGRTISRIAHQIIEKTALDDPVGPDAPRVVLLGIPTRGV
PYRR_STRCO       --MDKQQDQQQEARPVLEGPDIARVLTRIAHEIVERAKGADD-------VVLLGIPTRGV
PYRR_STAAM       ----------MSERIIMDDAAIQRTVTRIAHEILEYNKGTDN-------LILLGIKTRGE
PYRR_FUSNN       --------MEVKMKILLDEDGIRRSITRISYEIIERNKTVDN-------IVLVGIKSRGD
PYRR_BACCL       ----------MQKAVVMDEQAIRRALTRIAHEIIERNKGIDG-------CVLVGIKTRGI
PYRR_BACSU       ---------MNQKAVILDEQAIRRALTRIAHEMIERNKGMNN-------CILVGIKTRGI
PYRR_BACHD       -----------MSRLILDEQAIRRATTRIAHEIIERNKGVSD-------CLLVGIKTRGI
PYRR_LISIN       ---------MQKQVVVMDEAAIKRALTRVSYEIIERNKGTKN-------LALVGIKTRGI
PYRR_LISMO       ---------MQKQVVVMDEAAIKRALTRVSYEIIERNKGTKN-------LALVGIKTRGI
PYRR_CLOAB       ---------MNLKAKILDDKAMQRTLTRIAHEIIEKNKGIDD-------IVLVGIKRRGV
PYRR_CLOPE       ---------MHLKASLLDENAIRRALTRLSHEIIEKNKGVED-------IVLVGIKRRGY
PYRR_DEIRA       --------MTAPKATILSSDEIRRALTRIAHEIIERNKGAEN-------LAIIGVHTRGI
PYRR_THEAQ       ---------MRFKAELMNAPEMRRALYRIAHEIVEANKGTEG-------LALVGIHTRGI
PYRR_CALS4       ---------MRVKAEIMDEKAIDRALIRIAHEIVERNKGIED-------VVLVGIKTRGV
PYRR_ENTFA       ----------MPKKEVVDAVTMKRALTRISYEIIERNKGIQD-------IVLVGIKTRGI
PYRR1_LACPL      -----------MAREVVDAMTMRRALTRITYEIIEQNKGVGN-------LVFIGIKTRGI
PYRR_LACLA       ----------MARKEIIDEITMKRAITRITYEIIERNKELDK-------LVLIGIKTRGV
PYRR_LACLM       ----------MARKEIIDEITMKRAITRITYEIIERNKELDK-------LVLIGIKTRGV
PYRR_STRP1       ----------MKTKEIVDDVTMKRAITRITYEIIERNKQLDN-------VVLAGIKTRGV
PYRR_STRP8       ----------MKTKEIVDDVTMKRAITRITYEIIERNKQLDN-------VVLAGIKTRGV
PYRR_STRPN       ----------MKTKEVVDELTVKRAITRITYEIIERNKDLNK-------IVLAGIKTRGV
PYRR_HAEIN       -----------MEKIIIDHDRFLRTISRISHEIIEKHQTLDD-------LVIVGIKRRGA
PYRR_PASMU       -----------MEKIIIDENQFLRTISRISHEIIEKHQRLDN-------IVIVGIKRRGA
PYRR_PSEFL       ------------MSLPNPAELISQMAIRLKAHLEHRGISDPR---------YIGIRTGGV
PYRR_PSEPU       ------------MSLPNPADLIRQMAVDLRAHLARRAITEPR---------YIGIRTGGV
PYRR_PSEAE       ------------MSLPNPAELLPRMASDLRAHLAERGIERPR---------FVGIHTGGI
PYRR_RALSO       ----------MTSQQIDAEALYQSLVAQLRTRMAGTPAGDWS---------VAGIVSGGA
                                             :  .:                    *:   * 

PYRR_NOSS1       PLAELLARQIETLEGINVGVGALDITFYRDDLDQIGL---RTPAKTSITLD-LTGKTVVL
PYRR_SYNY3       PLAHQLAQQIEMLEQVKVPVGAIDVTLYRDDLKRIKT---RTPAKTKIPLS-LTGKRVVL
PYRR_CORGL       PLARRLAEKIEEFSGVSVDTGAVDITLYRDDLRNKPH---RALQPTSIPAGGIDNTTVIL
PYRR_MYCTU       TLANRLAGNITEYSGIHVGHGALDITLYRDDLMIKPP---RPLASTSIPAGGIDDALVIL
PYRR_STRCO       FLARRLADKLEQITERKMPVGSLDITMYRDDLRMHPP---RALARTEIPGDGIDGRLVVL
PYRR_STAAM       YLANRIQDKIHQIEQQRIPTGTIDITYFRDDIEHMSS---LTTKDAIDIDTDITDKVVII
PYRR_FUSNN       ILAERIKQKLLEVENIDAPLETIDITYYRDDIDRKNF---DLDIKDTEFKTNLTGKVVVI
PYRR_BACCL       YLARRLAERIEQIEGASVPVGELDITLYRDDLTVKTD-DHEPLVKGTNVPFPVTERNVIL
PYRR_BACSU       YLAKRLAERIEQIEGNPVTVGEIDITLYRDDLSKKTS-NDEPLVKGADIPVDITDQKVIL
PYRR_BACHD       YLANRLQERIETIEGIKLPVGEVDITLYRDDLTVKST-TEEPILQGTDVPVDVTGKKVIL
PYRR_LISIN       YLAERLHKRILEIEGIDVPVGDIDITLYRDDLSFKDDKTREPAVHGTNIPFDINGKKVVL
PYRR_LISMO       YLAERLHKRILEIEGIDVPVGDIDITLYRDDLSFKDDKTREPAVHGTNIPFDINGKKVVL
PYRR_CLOAB       PIADRIADIIEEIEGSKVKLGKVDITLYRDDLSTVSS---QPIVKDEEVYEDVKDKVVIL
PYRR_CLOPE       PLAERLSEFIEKFEGVKIPVASVDITLYRDDLTNVSD---TPNLNDPKIDVDIRGKKVII
PYRR_DEIRA       PLAERLASKLSELEGVEVPRGMLDITLYRDDLSEVAR---QPIIRETQVPFDLADRRVIL
PYRR_THEAQ       PLAHRIARFIAEFEGKEVPVGVLDITLYRDDLTEIGY---RPQVRETRIPFDLTGKAIVL
PYRR_CALS4       PLAKRIARYISRIEGKEPPVGSLDITLYRDDLTTDLE---QPVVKKKDIGVDVANKIVVL
PYRR_ENTFA       YIAQRLAERLKQLEDIDVPVGELDITLYRDDVKDME----EPELHSSDVPVSIEGKEVIL
PYRR1_LACPL      FLAQRLAQRLKQLEGVDVPVGSLDITLYRDDHHAVDV-AGQAKLNGADIPVDINGKHVIL
PYRR_LACLA       YLAKRIQERLQQLEGLEIPFGELDTRPFRDDKQAQE--------DTTEIDIDITGKDVIL
PYRR_LACLM       YLAKRIQERLQQLEGLEIPFGELDTRPFRDDKQAQE--------DTTEIDIDITGKDVIL
PYRR_STRP1       FLARRIQERLHQLEGLDLPIGELDIKPFRDDMRVEE--------DTTLMSVDITGKDVIL
PYRR_STRP8       FLARRIQERLHQLEGLDLPIGELDTKPFRDDMRVEE--------DTTLMSVDITGKDVIL
PYRR_STRPN       FIAHRIQERLKQLENLSVPVVELDTKPFRDDVKSGE--------DTSLVSVDVTDREVIL
PYRR_HAEIN       EIAELLQRRVEELSSINLPSMELDITFYRDDLTLVDQEDKMPVYSGSSQYLNIQDKTVIL
PYRR_PASMU       EIAELIKKKIADLANVELPSIDLDITFYRDDLEYAEPDSKSPTYSGASSFISIHNKEVIL
PYRR_PSEFL       WVAQALLEALGSQSP----LGTLDVSFYRDDFSQNG---LHPQVRPSALPFEIEGQHLVL
PYRR_PSEPU       WVAQALQEAMGDSSP----MGTLDVSFYRDDFSQNG---LHPQVRPSELPFEVEGQHLVL
PYRR_PSEAE       WVAEALLRELGNQEP----LGTLDVSFYRDDFTQNG---LHPQVRPSALPFEIDGQHLVL
PYRR_RALSO       WIAARLALDLGLRE-----YGIVNVALHRDDYAKKG---LHAQAQPTTLPFEVEERRILL
                  :*  :   :            ::   .***                     :    :::

PYRR_NOSS1       VDDVIFKGRTIRAALNAVNEYGRPEVIRLAVLVDRGHREVPIHPDFVGKQLPTAKEEVVK
PYRR_SYNY3       VDDVIYKGRTIRAALNAVTEYGRPQVIRLLTLVDRGHRELPIHPDFVGKILPTAAEEQVK
PYRR_CORGL       VDDVLFSGRTIRAALDALRDVGRPNYIQLAVLVDRGHRQLPIRADYVGKNLPTARAEDVS
PYRR_MYCTU       VDDVLYSGRSVRSALDALRDVGRPRAVQLAVLVDRGHRELPLRADYVGKNVPTSRSESVH
PYRR_STRCO       VDDVLFSGRTIRAALDALNDIGRPRAVQLAVLVDRGHRELPIRADYVGKNLPTSLRETVK
PYRR_STAAM       IDDVLYTGRTVRASLDAILLNARPIKIGLAALVDRGHRELPIRADFVGKNIPTSKEETVS
PYRR_FUSNN       VDDVLYTGRTIRAGLDAILSKSRPAKIQLACLIDRGHRELPIRADFIGKNIPTSHSENIE
PYRR_BACCL       VDDVLFTGRTVRAAMDAVMDLGRPARIQLAVLVDRGHRELPIRADFVGKNVPTSRSELIV
PYRR_BACSU       VDDVLYTGRTVRAGMDALVDVGRPSSIQLAVLVDRGHRELPIRADYIGKNIPTSKSEKVM
PYRR_BACHD       IDDVLYTGRTVRAALDALMDLGRPEQIQLAVLIDRGHRELPIRPDYVGKNVPTSKQEQIV
PYRR_LISIN       VDDVLYTGRTVRAAMDALMDVGRPAQIHLAVLADRGHRELPIRADYVGKNIPTSGNERVE
PYRR_LISMO       VDDVLYTGRTVRAAMDALMDVGRPAQIHLAVLADRGHRELPIRADYVGKNIPTSGNERVE
PYRR_CLOAB       VDDVLYTGRTCRAAIEAIMHRGRPKMIQLAVLIDRGHRELPIRADYVGKNVPTSKSELIS
PYRR_CLOPE       VDDVLYTCRTARAAIDAIMDQGRPEFIQLAVLVDRGHKELPIRADYVGKNIPTSKDEIIK
PYRR_DEIRA       VDDVLYTGRTVRAALDALIDLGRPEGIQLAVLVDRGHRELPIRADYVGKNLPTAKHEVVK
PYRR_THEAQ       VDDVLYTGRTARAALDALIDLGRPRRIYLAVLVDRGHRELPIRADFVGKNVPTSRNEVVK
PYRR_CALS4       VDDVIYTGRTVRAAMDAIIDLGRPKAIQLAELVDRGHRELPIRPDYVGKNVPTSRSEIIQ
PYRR_ENTFA       VDDVLYTGRTIRAAMDAVMDLGRPRKISLAVLVDRGHRELPIRADYVGKNIPTSKTEEII
PYRR1_LACPL      VDDVLFTGRTVRAALDALMDHGRPAKISLAVLVDRGHRELPIRPDFIGKNIPTALDEQVS
PYRR_LACLA       VDDVLYTGRTIRAAIDGIVKLGRPARVQLAVLVDRGHRELPIRADYVGKNIPTGRDEEII
PYRR_LACLM       VDDVLYTGRTIRAAIDGIVKLGRPARVQLAVLVDRGHRELPIRADYVGKNIPTGHDEEII
PYRR_STRP1       IDDVLYTGRTIRAAIDNLVSLGRPARVSLAVLVDRGHRELPIRADYVGKNIPTSSVEEIV
PYRR_STRP8       IDDVLYTGRTIRAAIDNLVSLGRPARVSLAVLVDRGHRELPIRADYVGKNIPTSSVEEIV
PYRR_STRPN       VDDVLYTGRTIRAAIDNIVGHGRPARVSLAVLVDRGHRELPIRPDYVGKNIPTSRSEEII
PYRR_HAEIN       VDDVLFTGRTIRAAMDALTDFGRAAKIELVIFVDRGHRELPIRADYVGKNVPTSRDELVQ
PYRR_PASMU       VDDVLYTGRTIRAALDALVDFGRAAKIELVIFVDRGHRELPIRADYVGKNVPTSRSEEVQ
PYRR_PSEFL       IDDVLMSGRTIRAAMNELFDYGRPASVTLVCLLDLDAAELPIRPNVVGATLTLAAHERVK
PYRR_PSEPU       VDDVLMSGRTIRAALNELFDYGRPASVTLVCLLDLDAGELPIRPNVLGATLSLAAHERVK
PYRR_PSEAE       VDDVLMSGRTIRAALNELFDYGRPASVTLVCLLDLNARELPIRPDVVGQTLSLGRDERVK
PYRR_RALSO       VDDVLATGRTIRAAINELFDYGRPAAVELAVLVDRGERQLPIAPDYIGERIALAADESLV
                 :***: . *: *:.:: :   .*.  : *  : * .  ::*: .: :*  :. .  * : 

PYRR_NOSS1       VYLQDWDGRDAVELVGY--------
PYRR_SYNY3       VYLQDPDGRDTVELIKG--------
PYRR_CORGL       VMLTEIDGRDAVTLTREDSEGDS--
PYRR_MYCTU       VRLREHDGRDGVVISR---------
PYRR_STRCO       VQLAEEDGRDTVLLGAKPAAPGAHP
PYRR_STAAM       VYLEEMDQRNAVIIK----------
PYRR_FUSNN       VYLKELDGKEEVVIL----------
PYRR_BACCL       VELSEVDGIDQVSIHEK--------
PYRR_BACSU       VQLDEVDQNDLVAIYENE-------
PYRR_BACHD       AKLSEVDGIDEVTIEQKTS------
PYRR_LISIN       VRLTDVDHSEDAVIINKNE------
PYRR_LISMO       VRLTDVDHAEDAVIINKNE------
PYRR_CLOAB       VNVKGIDEEDSVNIYEL--------
PYRR_CLOPE       VQIKEIDGTDSVEIYEN--------
PYRR_DEIRA       VKLQETDGTDIVELFDPEDLQ----
PYRR_THEAQ       VKVEEVDGEDRVELWEKEGA-----
PYRR_CALS4       VMLEEVDGVNKVVITEK--------
PYRR_ENTFA       VEMEERDGADRIMISKGNE------
PYRR1_LACPL      VALEEHDGHDGISIEKLEE------
PYRR_LACLA       VQMSEHDGNDSILIKRED-------
PYRR_LACLM       VQMSEHDGNDSILIKRED-------
PYRR_STRP1       VEVVEVDGRDRVSIIDST-------
PYRR_STRP8       VEVVEVDGRDRVSIIDPT-------
PYRR_STRPN       VEMTELDDQDRVLITEEA-------
PYRR_HAEIN       VRTEKQDGCYEVAILGK--------
PYRR_PASMU       VRTLKFDNCYEVALLSPTK------
PYRR_PSEFL       LSGPSPLQLELQDLAL---------
PYRR_PSEPU       LTGPAPLALERQDLASRSAL-----
PYRR_PSEAE       LVGPAPLALERKVLSSAS-------
PYRR_RALSO       LRQEGEGASARFTFTREPKTA----
                              :