CLUSTAL format seed alignment for MF_01220_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PYRH_FRACC      ------------------------------MTRYRRVVVKLSGRAIAG--------SAEF
PYRH_ORITB      ----------------------------MNNLRYNRLLIKLSGAALKGD-------SNTD
PYRH_CHLFF      -----------------------------MSKRITRVLFKISGESLSTD-------SG-N
PYRH_CHLPN      -----------------------------MAKQTRRVLFKISGEALSKD-------SS-N
PYRH_CHLMU      ----------------------------MMKKRVKRVLFKISGEALSDA-------SSSD
PYRH_FERNB      --------------------------------MYKRVLLKLSGEVLSGE--------DQK
PYRH_THEM4      --------------------------------MYKRVLLKLSGEVLSGE--------GEK
PYRH_PSELT      --------------------------------MYQRVLVKLSGEVMCGE--------GSR
PYRH_THEMA      ----------------------------------MRVLVKLSGEALSGE--------GGR
PYRH_FRATF      -------------------MSNDSSECSQKLPKLKRILLKLSGESLSAD--------QGF
PYRH_ECOLI      ----------------------MATN---AKPVYKRILLKLSGEALQGT--------EGF
PYRH_PHOLL      ----------------------MATN---AKPVYQRILLKLSGEALQGA--------EGF
PYRH_ALIF1      ----------------------MTTN---PKPVYQRILLKLSGEALQGE--------EGF
PYRH_PHOPR      ----------------------MTTN---PKPIYQRILLKLSGEALQGS--------EGF
PYRH_AERHH      ----------------------MSTN---PKPAYRRVLLKLSGEALQGS--------EGF
PYRH_SHELP      ----------------------MSTN---PKPAFRRILLKLSGEALMGE--------EGF
PYRH_IDILO      ---------------------MMSTH---PKPSYRRILLKLSGEALMGD--------EPF
PYRH_COLP3      ----------------------MTTN---PKPAYRRILLKLSGEALMGD--------EGF
PYRH_PSEA6      ----------------------MSTT---PKHAYRRILLKLSGEALMGE--------EGF
PYRH_PSEHT      ----------------------MTIN---RKPIFRRVLLKLSGEALMGD--------EGF
PYRH_PSYIN      ----------------------MKTK---PKSAYRRILLKLSGEALVGE--------EGF
PYRH_ACTSZ      -------------------------M---SNPIYKRILLKLSGEALQGA--------EGF
PYRH_HAEDU      -------------------------M---SKPIYNRILLKLSGEALQGD--------EGF
PYRH_HAES1      -------------------------M---SQPIYKRILLKLSGEALQGD--------EGF
PYRH_HAEIN      -------------------------M---SQPIYKRILLKLSGEALQGE--------DGL
PYRH_BLOPB      ----------------------MVTH---TKPIYRRIVLKMSGEALQGA--------EGF
PYRH_BLOFL      ----------------------MEYK---INPIYRRIMLKISGEALQGT--------ENF
PYRH_BAUCH      ------------------------MT---IKPIYQRILLKLSGEALQGK--------NNF
PYRH_BUCAI      ----------------------MSTD---KKFIYRRILLKISGEVLQGV--------NKF
PYRH_BUCAP      ----------------------MSTN---TKFIYHRILLKISGEVLQGV--------NKF
PYRH_BUCBP      --------------------MIFSNN---KKLKFKRVIIKLSGEALQGV--------HKF
PYRH_WIGBR      ----------------------MKNN---KIYINKKILLKLSGECLKKG--------KKN
PYRH_BUCCC      ----------------------MKKK---IKY--NRILLKISGEFLSSK--------KTF
PYRH_RUTMC      -------------------------M---LMSKYKRILLKLSGEALANT--------ENI
PYRH_VESOH      ------------------------------MSKYKRILLKLSGEALAST--------TNI
PYRH_HYDCU      -----------------------------MSLKYARVLLKFSGEALMGQ--------GQF
PYRH_PSEU5      ----------------------MAQQMSARNPRYKRILLKLSGEALMGS--------EDF
PYRH_PSEPF      ----------------------MAQQGSGYQARYKRILLKLSGEALMGS--------EEF
PYRH_SACD2      ----------------------MPNTP---DRKYKRILLKLSGEQLMGD--------EGF
PYRH_HAHCH      ----------------------MPPSAQ-TQPKYKRVLLKLSGEALMGE--------ENF
PYRH_MARHV      ----------------------MPTSSK-NQPRYKRVLLKLSGEALMGE--------HDF
PYRH_CHRSD      -------------MSAPTDRSATPAERN-EKSKYKRILLKLSGEALIGE--------HEF
PYRH_ALCBS      ---------------MSGGEKEMPTNKE-RSPRYNRILLKLSGEALAGE--------EGF
PYRH_PSYWF      ----------------------MSDK----NPQYSRILLKLSGEALAGG--------LGM
PYRH_ACIBT      ----------------------MAETI---SPRYSRILLKLSGEALSGN--------KDM
PYRH_LEGPA      ---------------------MMNESQP--KLKYKRILLKFSGEALMGK--------SQF
PYRH_COXBU      ----------------------MTNGP---QPLYRRVLLKMSGEALMGK--------GLH
PYRH_HELAH      ---------------------------MQTKIKNKRVLVKFSGEALAGDN--------QF
PYRH_WOLSU      ---------------------------MQSKR--SRVLVKFSGEALAGEN--------GF
PYRH_HELHP      ---------------------------MEYKR----VLVKFSGEALSGNS--------GF
PYRH_CAMC1      ---------------------------MSKRK---RVLVKFSGEALAGEN--------GF
PYRH_CAMC5      ---------------------------MSDKK---RVLVKFSGEALAGDS--------GF
PYRH_CAMFF      ---------------------------MSDKK---RVLVKFSGEALAGGN--------GF
PYRH_CAMJD      ---------------------------MQERK---RVLVKFSGEALAGEN--------GF
PYRH_CAMHC      ---------------------------MDKKK---RILVKFSGEALAGDS--------GF
PYRH_SULNB      ----------------------------MTKR----VLVKFSGEALAGKE--------GY
PYRH_SULDN      ---------------------------MANKR----VLVKFSGEALAGEA--------GY
PYRH_ARCB4      ----------------------------MNKR----VLVKFSGEALAGAE--------GY
PYRH_NITSB      ---------------------------MAKR-----VLIKFSGEALANED--------GH
PYRH_DESPS      -----------------------MRFIMPIKY--KRMLLKLSGEALMGKD--------SY
PYRH_DESVV      ----------------------------MSELKYKRVLLKLSGEALAGEN--------KF
PYRH_DESAG      ----------------------------MSELKYKRALIKLSGEALAGDK--------KF
PYRH_LAWIP      ----------------------------MSQMTYKRVLLKLSGESLAGRQ--------LT
PYRH_PARL1      ---------------------------MSDKPLYSRVLLKVSGEALMGPA--------QY
PYRH_MARMM      -----------MLHAVTDSSASGPADGQAGAPKFRRVLLKVSGEALMGSQ--------NY
PYRH_CAUVC      ------------------------MSDTSAPQKYRRILLKVSGEVLMGDT--------PY
PYRH_SPHAL      ----------------------------MALPGLKRILLKLSGEALMGPS--------PF
PYRH_NOVAD      ------------------------MSLPSCVPGYRRILLKLSGEVLMGEQ--------QF
PYRH_ERYLH      ----------------------------MALPEMKRVLLKLSGEVLMGEQ--------DY
PYRH_ZYMMO      ---------------------------MYKRPRFNRVLLKLSGEVLMGPG--------QF
PYRH_SPHWW      ----------------------------MDRPRFKRILLKLSGEVLMGQG--------QF
PYRH_HYPNA      ---------------------MQSGASETNKLKYRRVLLKLSGEALMGGG--------QF
PYRH_MAGSA      ---------------------------MASDAKFRRVLLKISGEGLMGTR--------EY
PYRH_RHORT      ---------------------MSEDQPHANGAYYRRVLLKLSGEGLLGNK--------EF
PYRH_GRABC      ----------------------MDGTDMTEQPVYKRVLLKVSGEALMGSR--------EY
PYRH_ACICJ      ----------------------MTAQDQTDHTRYRRVLLKVSGEALMGRR--------DY
PYRH_GLUOX      ----------------------MMTENREQSPSYKRVLLKVSGEALMGDG--------PS
PYRH_RICBR      ------------------------MTSN---LKYKRVLLKVSGEALMGDK--------QF
PYRH_RICAH      ------------------------MISNINALKYKKVLLKVSGEALMGDK--------QF
PYRH_WOLPM      --------------------MFI-STNEKSEIKYSRVLFKISGEALMGSK--------QF
PYRH_WOLTR      --------------------MHA-STGKGSKIKYSRVLFKISGEALMGSR--------PF
PYRH_EHRCJ      --------------------MSE---SSTPNVKYSRVLLKVSGEALMGEK--------GF
PYRH_EHRRW      --------------------MSE---NSANELKYSRVLLKVSGEALMGDK--------GF
PYRH_ANAMM      --------------------MSVSDGAATGSVRYSRVLLKVSGEAFVGEK--------RF
PYRH_ANAPZ      --------------------MSI-DCNVVENVRYSRVLLKVSGEALAGER--------GF
PYRH_NEOSM      ---------------------------------MRRVLLKISGERLAARG--------VS
PYRH_RHOS4      -------------------MTSEAAPASTA-VTYKRVMLKISGEALMGDQ--------GY
PYRH_ROSDO      -------------------MTTPEPQAA-----FKRVMLKISGEALMGDQ--------GF
PYRH_PARZE      --------------------MTSETPKQ-----YGRVMLKISGEALMGDQ--------GF
PYRH_PARDP      -----------------MSESASKTPGS-----YSRVMLKISGEALMGDQ--------GY
PYRH_JANSC      ----------------MPNDVTPGHPAGDD-AKYARVMLKISGEALMGDQ--------GF
PYRH_RUEST      ------------------MPQSPEQPDVSSTVSYNRVMLKISGEALMGTQ--------GF
PYRH_RUEPO      ----------------MTSSTSPETPSDPSQTRYKRVMLKISGEALMGDQ--------GF
PYRH_AQUAE      --------------------------ME-EKPKYKRILLKLSGEAFA---GEQ-----GY
PYRH_SYNFM      --------------------------MSGQKPIYRRILLKLSGEALL---GKE-----AY
PYRH_SYNP6      -------------------------------MAYKRVLLKLSGEALM---GDA-----SY
PYRH_SYNY3      -----------MGGILRLTLIPCLYINGDGGMSYQRVLLKLSGEALM---GDL-----GY
PYRH_THEEB      -----------------------------MSPKYRRVLLKLSGEALM---GNL-----NY
PYRH_NOSS1      -----------------------------MGTNYRRVLLKLSGEALM---GNM-----GY
PYRH_TRIEI      -----------------------------MRKIYQRVLLKLSGEALM---GSL-----GY
PYRH_SYNJA      -------------------------------MKYRRILLKLSGEALM---GER-----PY
PYRH_SYNPW      -------------------------------MAYARALLKLSGEALM---GDQ-----GY
PYRH_SYNS9      -------------------------------MKYTRVLLKLSGEALM---GSQ-----GY
PYRH_SYNR3      -------------------------------MAYQRVLLKLSGEALM---GDQ-----GY
PYRH_PROM1      -------------------------------MTYSRALIKLSGEALM---GDK-----PY
PYRH_PROMA      -------------------------------MSYSRVLLKLSGEALM---GSK-----PY
PYRH_PROM9      -------------------------------MTYKRVLLKLSGEALM---GEK-----PY
PYRH_GLOVI      -------------------------------MKYRRVLLKLSGEALM---GDR-----EF
PYRH_BACLD      ----------------------------MEKPKYNRIVLKLSGEALA---GEQ-----GN
PYRH_BACAN      ----------------------------MSKPKYNRVVLKLSGEALA---GEQ-----GF
PYRH_GEOTN      ----------------------------MEQPKYKRVVLKLSGEALA---GKQ-----GF
PYRH_BACHD      ------------------------------MAKYKRVVLKLSGEALA---GEQ-----GY
PYRH_BACSK      --------------------------------MYNRVVLKLSGEALA---GEQ-----GY
PYRH_OCEIH      ----------------------------MTTARYNRVVLKLSGEALS---GDQ-----GY
PYRH_LISMF      ----------------------------MDTPDYKRVVLKLSGEALA---GND-----GF
PYRH_STAS1      ---------------------------MAQTSKYERVVLKLSGEALA---GDD-----GF
PYRH_LACJO      ----------------------------MSQVKYKRIILKVSGEALA---GEK-----GT
PYRH_LACH4      ----------------------------MSQVKYKRIILKISGEALA---GDK-----GN
PYRH_LACDB      ----------------------------MSQVKYNRIILKISGEALA---GEK-----GT
PYRH_LACPL      ----------------------------MSEVKYKRVILKLSGEALA---GEK-----GF
PYRH_LACBA      ----------------------------MADVKYKRIMLKLSGEALA---GDK-----GF
PYRH_PEDPA      ----------------------------MSEVKYKRVIMKLSGEALA---GDK-----GT
PYRH_LACRE      ----------------------------MSDIKYNRVILKLSGEALA---GEK-----GF
PYRH_LACS1      ----------------------------MSDIKYKRVLLKLSGEALA---GDQ-----GK
PYRH_LACP3      ------------------------------MVKYNRIVLKISGEALA---GEA-----GF
PYRH_LACSS      ----------------------------MTNTKYKRIVLKVSGEALA---GEQ-----GF
PYRH_ENTFA      ----------------------------MVKPKYQRVVLKLSGEALA---GED-----GF
PYRH_LACLM      ----------------------------MAEIKYKRVLLKLSGEALS---GEK-----GF
PYRH_STRS2      ----------------------------MMKPKYERILIKLSGEALA---GER-----GV
PYRH_STRA3      -----------------------------MEPKYQRILIKLSGEALA---GDK-----GV
PYRH_STRT2      ----------------------------MAEPKYKRVLIKLSGEALA---GEK-----GV
PYRH_STRGC      ----------------------------MVEPKYKRILIKLSGEALA---GDK-----GV
PYRH_STRMU      ----------------------------MVKPKYSRVLIKLSGEALA---GEK-----GV
PYRH_LEUMM      ----------------------------MTDIKYKRVLMKLSGEALA---GDK-----GQ
PYRH_OENOB      ----------------------------MTEIKFHRVLLKLSGEALA---GPG-----GS
PYRH_ONYPE      ------------------------------MWMHKKILLKLSGESLK---GES-----SY
PYRH_SYMTH      ----------------------------MQTPKYRRVVLKLSGEALA---GAK-----GF
PYRH_CARHZ      ----------------------------MPSPKYKRVVLKLSGEALA---GEK-----GY
PYRH_DESRM      ----------------------------MVTPKFRRVILKLSGEALA---GQK-----GY
PYRH_MOOTA      ----------------------------MGQPKYKRVILKISGEALA---GNQ-----GF
PYRH_SYNWW      ----------------------------MQKPKYKRIVLKLSGEALA---GHN-----TY
PYRH_DESHY      ----------------------------METPRYRRVILKLSGEALA---GSQ-----GF
PYRH_CALS4      ----------------------------MSSVVYKRVVLKISGEALA---GDK-----EF
PYRH_HUNT2      ----------------------------MQKPKYKRIMLKISGEALA---GEK-----KL
PYRH_CLOPS      ----------------------------MGTCKYKRVMLKLSGEALA---GEN-----GF
PYRH_CLOBL      ----------------------------MNEPKYKRVMLKLSGEALS---GEK-----GF
PYRH_CLONN      ----------------------------MSSSKYKRVMLKISGEALS---GKK-----GF
PYRH_CLOAB      ----------------------------MQSIKYKRVMLKISGEALA---GTN-----GY
PYRH_CLOTE      ----------------------------MNDIKYKRIMLKLSGEALA---GEN-----GY
PYRH_ALKOO      ----------------------------MLEPQYKRVLLKLSGEALA---GEK-----GF
PYRH_ALKMQ      ----------------------------MAKPLYKRVLLKLSGEALA---GEK-----GF
PYRH_CLOD6      ----------------------------MDKPMYKRVLLKLSGEALA---GER-----GF
PYRH_CALS8      ----------------------------MVEPKYKRVILKLSGEALG---GEK-----GF
PYRH_MYCSJ      -------------MSEPNSDHGAGAAVGETRPLYSRVLLKLGGEMF----GGG-----AV
PYRH_MYCS2      -------------MADSN----VAGRAAPIRPLYTRVLLKLGGEMF----GGG-----QV
PYRH_MYCPA      MTESREPHVAGSAAPRPEPANGLASGQPSSRARYSRVLLKLGGEMF----GGG-----QV
PYRH_MYCLE      --------MSAAAAGRGERLN--HAGNPGHRSKYSRVLLKLGGEMF----GGG-----QV
PYRH_MYCBO      ---MTEPDVAGAPASKPEPAS-TGAASAAQLSGYSRVLLKLGGEMF----GGG-----QV
PYRH_NOCFA      -----------------------MTDPGTDRPGYRRVLLKLGGEMF----GGG-----KV
PYRH_RHOJR      -----------------------MSEPANERTGFHRVLLKLGGEMF----GGG-----KV
PYRH_CORDI      ----------------------MTEGVQNERTGYKRVMLKLGGEMF----GGG-----AV
PYRH_CORJK      ----------------------MTTAEN--REGYKRVMLKLGGEMF----GGG-----KV
PYRH_COREF      ----------------------MTTSSIEPRNSYKRVMLKLGGEMF----GGG-----KV
PYRH_SACEN      -----------------------MTDEGPSKGGYRRVLLKLGGEMF----GGG-----SV
PYRH_ACIC1      --------------MADGEGGAASAPTAGTRPVYRRVLLKLGGEMF----GGG-----HV
PYRH_STRCO      -------------------MSSTKAEKSDDGKVSGRFMLKLSGEAFS---GGG-----GL
PYRH_CUTAK      -----------------------MPERYN------RVLLKLSGEVF----GGG-----GI
PYRH_NOCSJ      ------------------------MTGYK------RVLLKLSGEMF----GGG-----KV
PYRH_CLAM3      ---------------------------MTDQTTTRRVLLKLSGESF----GGG-----QM
PYRH_LEIXX      ---------------------------MTMADKRRRVLLKLSGEAF----GGG-----QL
PYRH_PAEAT      --------------------METVNTAIQPEKTRRRVLLKLSGEVI----GGG-----KL
PYRH_TROW8      -------------------------------MASRRVLLKLSGESF----GGG-----AP
PYRH_BIFAA      ------------------------MTGENTGDNPRRVLLKLSGEAF----GGG-----KV
PYRH_THEFY      -----------------MPDNEGQHSVARRDGGWKRVVLKLSGEAFA---GEE-----QL
PYRH_DEHM1      ----------------------------MAEIKYKRILLKLSGEAFK---GAT-----GY
PYRH_LEPIC      ---------------------------MATEAKYNRILIKLSGEALA---GEG-----EF
PYRH_DEIRA      ------------------------MLKRREPDMFKRVLLKLSGEFLA---GDN-----GF
PYRH_DEIGD      --------------------------------MFKRVLLKLSGEFLS---GPAPDGSAGF
PYRH_THET2      -------------------------------MKYKRVLLKLSGEFLT---RNG------F
PYRH_RUBXD      ------------------MGESARAAETSELGPLRRVVLKLSGESLA---GNG-----GY
PYRH_ROSS1      ----------------------------MAEPRYRRILLKLSGEALA---GKG-----TH
PYRH_RHOBA      ------------------MPDIAPSSQPEGDLRYRRVILKLSGESLA---ESG-----KR
PYRH_GEOSL      ---------------------MG-------TPYYGRVLLKLSGEALA---GDQ-----GY
PYRH_PELPD      ---------------------MS-------RPKFTRVLLKLSGESLA---GSQ-----GY
PYRH_PELCD      ---------------------MDDQ-----EPVYKRILLKLSGEALA---GNQ-----GF
PYRH_BDEBA      ---------------------MK-------EPVYKRILLKLSGEALA---GKQ-----GT
PYRH_ANADF      ---------------------MPSDRAATPKPSYKRILLKLSGEALM---GDG-----KY
PYRH_MYXXD      ---------------------MSSD-TKKPLP-YQRILLKLSGEALM---GEG-----KY
PYRH_KORVE      ---------------------MS-------EPKYKRILLKLSGEALAQ--GEQ-----GF
PYRH_SYNAS      -----------------MVNFLE-------KPVYKRVLLKLSGEALMG--GHR-----SS
PYRH_SOLUE      ------------------------------MAGYKRILLKLSGEALA---GAA-----TF
PYRH_CHLPD      ------------------------------MLRYKRILLKLSGEALA---GED-----GY
PYRH_PELLD      -------------------------------MQYRRILLKLSGEALA---GKD-----GY
PYRH_CHLCH      ------------------------------MLHYKRILLKLSGESLA---GED-----GY
PYRH_CHLTE      ------------------------------MRKYRRILLKISGESLA---GES-----GY
PYRH_SALRD      -------------------MSASPDDESTSSLDHQRVLLKLSGQALL---GDR-----EF
PYRH_GRAFK      -------------------------------MHYERILLKLSGEALM---GNR-----QY
PYRH_FLAPJ      -------------------------------MKYKRILLKLSGEALM---GDR-----QY
PYRH_CYTH3      -------------------------------MKYKRILLKLSGEALM---GEQ-----KY
PYRH_BACV8      ------------------------------MARFKRILLKLSGESLM---GEK-----QY
PYRH_PARD8      ------------------------------MAQYKRILLKLSGESLM---GGK-----QY
PYRH_PORGI      ------------------------------MTAYKRVLLKLSGESLM---GAQ-----QY
PYRH_FUSNN      ----------------------------MESPFYKKILLKLSGEALM---GDQ-----EF
PYRH_ALKEH      ----------------------------MSQPQYKRILLKLSGEALMGDA--------AY
PYRH_HALHL      ------------------------------MPHYRRILLKLSGEALLGDG--------QY
PYRH_METCA      ----------------------------MTEPVYKRILLKLSGEALMGDQ--------GA
PYRH_XANC8      ----------------------------MSELSYRRILLKLSGEALMGDG--------DY
PYRH_XYLFT      ------------------------MRYPMSKLAYHRVLLKLSGEALMGSA--------DY
PYRH_NITOC      ------------------------MPLDGGKPKYRRILLKFSGEALIGEV--------GY
PYRH_DICNV      -------------------------MSTKPKPRYRRILLKMSGEALMGNQ--------AF
PYRH_METFK      ----------------------------MSTPAYKRILLKLSGEALMGDD--------SY
PYRH_NITMU      ----------------------------MTIPAYKRILLKLSGEALMGDD--------SY
PYRH_CHRVO      ---------------------------MSQVPAYKRILLKLSGEALMGDD--------SY
PYRH_NITEU      -----------------------------MPVVYKRILLKLSGEALMGDG--------HY
PYRH_POLNA      ------------------------------MPAYKRILLKLSGEALMGDD--------AF
PYRH_METPP      ------------------------------MPAFKRILLKLSGEALMGDD--------AY
PYRH_VEREI      --------------------------MSHAAPAHKRILLKLSGEALMGSD--------AF
PYRH_RHOFT      --------------------------MSVAKPAHKRILLKLSGEALMGDD--------QF
PYRH_HERAR      ----------------------------MTTPAYKRVLLKLSGEALMGDD--------PY
PYRH_BORA1      ----------------------------MSSRSYKRVLLKLSGEALMGDD--------AF
PYRH_CUPNH      ------------------------------MPAYKRVLLKLSGEALMGDD--------AF
PYRH_AROAE      ----------------------------MSVAAYKRIMLKLSGEALMGDD--------SY
PYRH_DECAR      ----------------------------MSAPKYKRILLKLSGEALMGSD--------AY
PYRH_NEIMF      ---------------------------MTQQIKYKRVLLKLSGESLMGSD--------PF
PYRH_THIDA      ------------------------------MAPVRRILLKLSGEALMGPD--------SF
PYRH_RHILO      ---------------------------MTVKPLYRRVLLKASGEALMGE--------QHF
PYRH_CHESB      -----------------------------MTPRYRRVVLKASGEALMGK--------QGF
PYRH_OCHA4      ---------------------------MSGKPAYKRVLLKASGEALMGS--------QGF
PYRH_AGRFC      --------------------------MMSSKPIYKRVLLKASGEALMGD--------QGF
PYRH_RHIEC      ---------------------------MSLEPVYKRVLLKASGEALMGA--------QGF
PYRH_BARBK      ---------------------------MTLALRYKRVLLKVSGEALMGE--------QSF
PYRH_NITHX      ----------------------------MDEPAYRRVVVKLSGEYLAGS--------QPF
PYRH_RHOP5      ----------------------------MAEPVYHRVVVKLSGEYFAGD--------QSF
PYRH_BRASB      ----------------------------MAEPVYRRVVVKLSGEYLAGP--------HSF
PYRH_BRADU      ----------------------------MTDPVYRRVVIKLSGEYLAGQ--------QGF
PYRH_RHOP2      ----------------------------MGEPIYRRVVVKLSGEYFAGP--------QHY
PYRH_RHOPA      ----------------------------MAEPIYRRVLVKLSGEYFAGP--------QDY
PYRH_AZOC5      ----------------------------MPGLPYPRILVKVSGEALMGS--------EPF
PYRH_MAGMM      ----------------------------MDVARAKRVLLKLSGEALMGE--------QAY
PYRH_PARUW      -----------------------------MSTFPKRILLKLSGETLIGN--------QGF
PYRH_MYCPU      --------------------------MGWFKYMYKRILLKLSGEGLANKEKNL-------
PYRH_MYCS5      ------------------------------MIKYKRILIKLSGEGFANKEKNL-------
PYRH_MYCMO      ---------------------------MECVMKYKRILLKLSGEGLSNKKKSL-------
PYRH_MYCH7      --------------------------------MDSTILIKLSGESLANKQKSL-------
PYRH_MYCGE      -------------------------MHKSNNKIRQRIIIKLSGAGLTKENS-Q-------
PYRH_MYCPN      --------------------------------MRLKILIKLSGAGMSADSS-E-------
PYRH_MYCGA      -------------------------------MQKPNIIIKISGASLQDKNSND-------
PYRH_UREPA      -------------------------------MRKQRIVIKISGACLK-QNDSS-------
PYRH_MYCPE      -------------------------------MNKELVILKISGASLK-GKND--------
PYRH_MESFL      -----------------------------MKYKYSTVLLKLSGEALKSENE---------
PYRH_MYCCT      -----------------------------MNYKYKTVLLKLSGEALKGDAE---------
                                                     :.* .*  :              

PYRH_FRACC      GFDSNALEHLAREIIAVRQS--GVEVAIVVGGGNLFRGN---QSDRWGIDRVEADNIGML
PYRH_ORITB      NFDIKKLKYIAQEILAIKNM--GIEVVLVTGGGNIFRGN---SAEYWKIERAEADNVGML
PYRH_CHLFF      RIDEVRLSRLVAELRAVRNC--DIETALVIGGGNIIRGLA--QQKELQINRVSADQMGML
PYRH_CHLPN      RIDEMRLSRLVSELRAVRNN--DIEIALVIGGGNILRGLA--EQKELQINRVSADQMGML
PYRH_CHLMU      KISEERLSRLIAELKVVRNA--DVEVAVVIGGGNILRGLS--QSQNLQINRVSADQMGML
PYRH_FERNB      GFNEEHVEYLIKEIKGISEY--GTKLGIVIGAGNIFRG-----RDFEGLRPTISDQIGML
PYRH_THEM4      GFNHENIIYLVDELKKILEY--GTNVGIVIGAGNLFRG-----REMQELSPTIADQIGML
PYRH_PSELT      GFDQSNINYLVQQIAQIVDY--GVNVGIVIGAGNIFRG-----EELSEIPHSLADQIGML
PYRH_THEMA      GFDPERVNYIVNEIKSAIEE--GFKIGIVVGAGNLFRG-----VELKNLTMTRADQIGLL
PYRH_FRATF      GINVESAQPIINQIKTLTNF--GVELALVVGGGNILRGGR--ANFGNKIRRATADSMGMI
PYRH_ECOLI      GIDASILDRMAQEIKELVEL--GIQVGVVIGGGNLFRGAG--LAKAGM-NRVVGDHMGML
PYRH_PHOLL      GIDASVLDRMAQEVKELVEL--GVEVGVVIGGGNLFRGAG--LAEAGM-NRVVGDHMGML
PYRH_ALIF1      GIDPATLDRMAQEVKELIEL--GVQVGVVIGGGNLFRGAG--LAEAGM-NRVVGDHMGML
PYRH_PHOPR      GIDAKVLDRMAQEVKELVEL--GVQVGLVIGGGNLFRGAG--LAEAGM-NRVVGDHMGML
PYRH_AERHH      GIDPAVLDRMAQEIKELVEL--GVQVGLVIGGGNLFRGAG--LAKAGM-NRVVGDHMGML
PYRH_SHELP      GIDPKVLDRMAQEIKELVEL--GIQVGVVIGGGNLFRGEG--LAQAGM-NRVVGDHMGML
PYRH_IDILO      GIDAKVLDRMAQEIKELVEL--GVQVGLVIGGGNLFRGEG--LAKAGM-NRVVGDHMGML
PYRH_COLP3      GIDPKVLDRMAQEIKELVEM--GIQVGLVIGGGNLFRGAG--LAEAGM-NRVVGDQMGML
PYRH_PSEA6      GIDPKVLERMAQEIKELVEL--GIEVGLVIGGGNLFRGEG--LAKAGM-NRVVGDHMGML
PYRH_PSEHT      GIDPKVLDRMAQEIKELVEL--DVEVGLVIGGGNFLRGGS--LAEAGM-NRVVGDHMGML
PYRH_PSYIN      GIDPKVLDRMALEIKSLIEV--GVQVGLVIGGGNIFRGAG--LAEAGM-NRVVGDHMGML
PYRH_ACTSZ      GIDPSILDRMALEIKELIAM--GVEVGVVLGGGNLFRGAK--LAKAGM-NRVVGDHMGML
PYRH_HAEDU      GIDPSILDRMALEIKELVEM--GVEVGVVLGGGNLFRGAK--LAKAGM-NRVVGDHMGML
PYRH_HAES1      GIDPSILDRMALEIKGLLGL--GVEVGVVLGGGNLFRGAK--LAKAGM-NRVVGDHMGML
PYRH_HAEIN      GIDPAILDRMAVEIKELVEM--GVEVSVVLGGGNLFRGAK--LAKAGM-NRVVGDHMGML
PYRH_BLOPB      GIDTTILNRMVTEVKELVKI--GIQIGIVMGGGNLFRGAE--LVKSGM-NRIVGDHIGML
PYRH_BLOFL      GVDSSILDRMVLEIKELVNI--GVQIGMIIGGGNLFRGSR--LVQFGM-NKVIGDHIGML
PYRH_BAUCH      GIDTNALNRIVQEIKELIKF--KINIGIVIGGGNLFRGTL--LAHLGI-QRVVCDHMGML
PYRH_BUCAI      GIDINSLKRIAKEIEFIVKI--GVQVGLVIGSGNLFRGAK--LSKLGL-NRVASDHIGIL
PYRH_BUCAP      GIDINSLKRIVKEIKLVLQF--GIQVGLVIGSGNLFRGAT--LSQLGV-NRIVSDHIGIL
PYRH_BUCBP      GIDIIELNRIAKEIKAIFDL--GVQIGIVIGGGNIFRGKK--LAKFGI-NKVISDYVGML
PYRH_WIGBR      LVDFDILNKITNEIKNLFNL--GIQIGIVIGGGNLFRGSQ--LKIHGI-KRNIGDHIGMM
PYRH_BUCCC      NINTIFITKLIKQIKLLTNL--GVQIGLVIGGGNLFRGSD--LEKIGM-RRSISDKIGML
PYRH_RUTMC      -IDPVALNKVVNIIKSVLSQ--NVEIAIVVGGGNIFRGAV--LAQAGM-NRITGDHMGML
PYRH_VESOH      -IDPVTLNKIVDIIKSVLSQ--NIEIAIVIGGGNIFRGET--LTKTGI-NRITSDHIGML
PYRH_HYDCU      GLDSNTLRQVVLEVKALRDL--GVEVGLVVGGGNIFRGAQ--IEGAGI-QRTTGDHMGMM
PYRH_PSEU5      GIDPKVLDRMALEVGQLVGI--GVEVGLVIGGGNLFRGAA--LSAAGM-DRVTGDHMGML
PYRH_PSEPF      GIDPKVLDRMALEVGQLVGI--GVQVGLVIGGGNLFRGEA--LSKAGM-DRVTGDHMGML
PYRH_SACD2      GIDPKVLDKMALEIGQLVGI--GVQVGLVIGGGNLFRGAA--LSRAGL-DRVTGDHMGML
PYRH_HAHCH      GIDPKVLNRMALEIGQLIGI--GVQVGLVIGGGNLFRGKA--LQDAGM-DRVTGDHMGML
PYRH_MARHV      GIDPKVLDRMALEIGALIGI--GVQVGLVIGGGNLFRGAA--LNAAGL-DRVTGDHMGML
PYRH_CHRSD      GIDPKVLDRMALEIGQLVGI--GVQVGIVIGGGNLFRGAA--LHAAGM-ERVTGDHMGML
PYRH_ALCBS      GIDPKVLDAISLEIGQLVGI--GVQVGLVVGGGNLFRGAA--LQSAGL-DRVAGDHMGML
PYRH_PSYWF      GIDTSVLDKMSLAIAHLCGL--GVQVGIVVGGGNLYRGSQ--LQKEGLVGRVTGDQMGML
PYRH_ACIBT      GIDAQVLDQMSLSIAHLVGL--GVQVGIVVGGGNLYRGSQ--LQKDGLVGRVTGDQMGML
PYRH_LEGPA      GIDPSVLDSLARDIAELIHM--GVEVGLVLGGGNLFRGKA--LSQAGV-GRVTGDHMGML
PYRH_COXBU      AIDPNVLDRMAKDVTQVYQL--GVQIAIVIGGGNFFRGAA--LQAAGI-NRITGDYMGML
PYRH_HELAH      GIDIHVLDHIAKEIRSLVEN--DIEVGIVIGGGNIIRGVS-AAQGGII-RRTSGDYMGML
PYRH_WOLSU      GIDTKILGFIASEIRSLVEN--KIEVGIVIGGGNIIRGVS-AAQDGVI-RRTSADYMGML
PYRH_HELHP      GIDVKILEYIAGEIKSLVDN--QIEVGIVIGGGNIIRGVS-AAQGGII-RRTSGDYMGML
PYRH_CAMC1      GIDTAVLKFIASEIKELIEN--DIEVGIVIGGGNIVRGVS-AAKDGII-KRTSGDHMGML
PYRH_CAMC5      GIDTAILKFIADEIKELVTN--GTEVCIVIGGGNIIRGVS-AAKDGII-RRTSGDHMGML
PYRH_CAMFF      GIDTHILKYIAGEIKGLVLN--GIEIGIVIGGGNIIRGVS-AAKDGII-KRTSGDHMGML
PYRH_CAMJD      GIENSILKFIASEIKELIKN--QIEVGIVIGGGNIIRGVS-AAKGGLI-KRTSGDHMGML
PYRH_CAMHC      GIDSTILKFIANEIKSLVDM--GVEVGIVIGGGNIIRGVS-AAAGGII-KRTSGDHMGML
PYRH_SULNB      GIDTKILKFIASEIKALVDA--GMEVAIVVGGGNIIRGVS-AAADGII-KRTSGDYMGML
PYRH_SULDN      GIDTKILNFISQEIKSLVEA--NIEVGIVIGGGNIIRGVT-AAQDGII-KRTSGDYMGML
PYRH_ARCB4      GIDTKILDYIAEEIKSLVEN--GIEVAIVIGGGNIIRGVT-AAADGVI-KRTSADYMGML
PYRH_NITSB      GINSKTLKYIASEIKPLVDS--GVEVGLVVGGGNIIRGVN-ASKEGII-RRSSGDYMGML
PYRH_DESPS      GINTGVLEFVAGEIKELVAM--GVELGVVVGAGNIFRGMA-GASKG-M-DRATADNMGML
PYRH_DESVV      GIDPATVSKICHEIADVVDM--GLQVALVIGGGNIFRGLS-SSA-KGM-DRSSADYMGML
PYRH_DESAG      GIDPETVSNICREIAEVLEM--GLQVSLVIGGGNIFRGLS-SSA-KGM-DRSSADYMGML
PYRH_LAWIP      GIDPDTVAVLCNELSSVIEL--GLQIALVIGGGNIFRGLS-ASA-KGM-DRSSADYMGML
PYRH_PARL1      GIDLDTVDRVARDIKQAIDA--GVQVCLVIGGGNIFRGLS-GAA-KGM-ERASADYMGML
PYRH_MARMM      GIDIDTADRIAREVAAAVKG--GTEMCLVIGGGNIFRGLS-GAA-KGM-DRAAADYMGML
PYRH_CAUVC      GIDTNTVQSVAEDVAEIVKS--GVELCLVIGGGNIFRGMA-GAA-KGM-ERSSADYMGML
PYRH_SPHAL      GIDPETVASMAAEVKEAKDR--GLEICLVIGGGNIFRGMA-GAA-KGM-DRAQADYMGML
PYRH_NOVAD      GIDTDYVARVAQEVKDARDS--GLEICLVIGGGNIFRGMA-GAA-KGM-DRAQADYMGML
PYRH_ERYLH      GIDPAFVMELAKEVKAAREQ--GLQICLVIGGGNIFRGMA-GAA-QGM-ERAQADYMGML
PYRH_ZYMMO      GIDPATVARVADEIRAAREA--GYQLCIVVGGGNIFRGLA-ATA-RGI-ERSSADYMGML
PYRH_SPHWW      GIDPETVARVAREI-ADVAT--HYELCLVVGGGNIFRGLA-AAA-KGF-DRTSADYMGML
PYRH_HYPNA      GIDIPTCEQFARAIAEAREA--GAEICLVIGGGNIFRGVA-GAA-KGM-ERAQADSMGML
PYRH_MAGSA      GLDPETVDRIAREVKSVRDL--GVEVCVVIGGGNIFRGVS-GAS-SGM-ERAAADNMGML
PYRH_RHORT      GLDLEMVDRVAGEVKAAHDR--GIQVCLVIGGGNIFRGIS-TAA-KGM-DRTSADYMGML
PYRH_GRABC      GLDKAMVQTIASDIADVVAF--GVEVCLVIGGGNIFRGVS-AAA-SGM-DRAQGDYIGML
PYRH_ACICJ      GLDTDTVAAIAQDIADVVAM--RVEVCLVIGGGNIFRGIS-GAA-GGM-DRAQADYMGML
PYRH_GLUOX      GVDPVMVDMVAADIADVVAS--GVEVCLVVGGGNIFRGLA-AAA-KGM-DRAQGDYAGML
PYRH_RICBR      GHDYDTIKKIAGDIKELIDS--GVEVAIVVGGGNIYRGIN-AAL-VGM-DRASADYIGML
PYRH_RICAH      GHEYEVIKKISSDIKEVIDL--GVEVAIVVGGGNIYRGIN-AAL-VGM-DRASADYIGML
PYRH_WOLPM      GHDMEAIGELSKGIVEVCNL--GVQVCIVVGGGNIFRGTS-ASL-SGC-ERASSDYIGML
PYRH_WOLTR      GHDMELIDQLCKDISDIYKL--GVQVCIVVGGGNIFRGAS-ASL-SGC-ERASSDYIGML
PYRH_EHRCJ      GCDVEVLDKLSHDLKEVYDF--GIQLCLVVGGGNIFRGAS-SSSPFGF-ERASNDYIGML
PYRH_EHRRW      GWDIETIDNLSHDLKEVHDL--GVQLCLVVGGGNIFRGAS-ASAPFGF-ERASNDYIGML
PYRH_ANAMM      GFDPAVVLRLSRDLKNVKES--GVELCIVVGGGNIFRGAS-TS--DGF-ERTSNDYVGML
PYRH_ANAPZ      GFDQDVIGKLSCDLKKVRES--GVELCIVVGGGNIFRGSS-TS--FGF-ERASNDYVGML
PYRH_NEOSM      VHDAEVIGMLARGIKRVHEM--GIQVCLVIGGGNIYRGSS-GIP--NI-DRATGDYMGML
PYRH_RHOS4      GLHPPTVQRIAREVQAVHRL--GVEICLVIGGGNIFRGLQ-GSA-QGM-ERTTADYMGML
PYRH_ROSDO      GLHPPTVERVAREVQSVHAL--GVEICMVIGGGNIFRGLQ-GSA-QGM-ERTTADYMGML
PYRH_PARZE      GLNPPTVARIANEVDSVAKM--GVEVCMVIGGGNIFRGLQ-GSA-QGM-ERTTADYMGML
PYRH_PARDP      GLHPPTVARIAQEVKSVHDM--GIEICMVIGGGNIFRGLQ-GSA-QGM-ERATADYMGML
PYRH_JANSC      GLHPPTVERIAREIQSVHDM--GVEICLVIGGGNIFRGLQ-GSA-QGM-ERTTADYMGML
PYRH_RUEST      GLHPPTVRRIAEEVKSVHDL--GVEICMVIGGGNIFRGLS-GSA-QGM-ERTTADYMGML
PYRH_RUEPO      GLHPPTVKRIAHEIKTVHDM--GVEICMVIGGGNIFRGLS-GAA-QGM-ERTTADYMGML
PYRH_AQUAE      GIDPAFLEYISHEIKNVYDL--GVQVAIVIGGGNIFRGFQ--GKEIGV-DRATADYMGML
PYRH_SYNFM      GIDSSVLDQIAEEVTAVHQM--GVQVAIVIGGGNIFRGVS--GASRGM-DRSTADYMGML
PYRH_SYNP6      GIDPAVVQRIAQEIATVVQD--GFQVAIVVGGGNIFRGIK--GAAAGM-ERATADYVGMI
PYRH_SYNY3      GIDPAVVGTIAQEIKDVLQA--GVQLAIVVGGGNIFRGVK--ASAAGM-DRATADYIGMI
PYRH_THEEB      GIDPKVVQSFASEIAQVVQA--GVQTAIVVGGGNIFRGMK--GAAAGM-DRATADYIGMI
PYRH_NOSS1      GIDPEVVKEIAQEIAEVIAT--GVQIAIVVGGGNIFRGVK--AASAGM-DRATADYIGMI
PYRH_TRIEI      GIDPAVVQGIAQEVAEVAAT--GIQIAIVVGGGNIFRGVK--AASKGM-DRATADYVGMI
PYRH_SYNJA      GIDPEVLQSIASEVASVVRA--GVQVAIVVGGGNIWRGRKE-AAAQGM-DQASADYVGML
PYRH_SYNPW      GIDPAIVQAIAKDVAGVVAS--GTQLAIVVGGGNIFRGLK--GSAAGM-DRATADYVGML
PYRH_SYNS9      GIDPEIVHSIAEDVAKVVAS--GTQLAIVVGGGNIFRGLK--GSAAGM-DRATADYVGML
PYRH_SYNR3      GIDPAIVSAIAKDVAEVVAK--GTQLAIVVGGGNIFRGLK--GSAAGM-ERATADYVGML
PYRH_PROM1      GIDPEIVQSIAKDVSKVVEN--GTQIAIVVGGGNIFRGLK--GSAAGM-DRATADYVGML
PYRH_PROMA      GIDPEIVQSIAQDVSKVVQE--GTQLAIVVGGGNIFRGLK--GSSAGM-DRATADYVGML
PYRH_PROM9      GIDPAIVQSIAEDVSKVVGN--NIQLAIVVGGGNIFRGLK--GSADGM-DRATADYVGML
PYRH_GLOVI      GIDPEVVKSLAGEIARVVEA--GTELAVVVGGGNIFRGVK--ASSSGM-DRATADYVGML
PYRH_BACLD      GINPTVIQSIAKQVKEIAEL--DVEVAVVVGGGNLWRGKT--GSDLGM-DRATADYMGML
PYRH_BACAN      GINPAVIKSVAEQVKEIAEL--DVEVAVVVGGGNIWRGKI--GSEMGM-DRAGADYMGML
PYRH_GEOTN      GIQPAVIQSIAKQVKEVAEL--DVEIAIVVGGGNIWRGKT--GSEMGM-DRATADYMGML
PYRH_BACHD      GIDPEVIQSIASQIKEIVEL--DVEVAVVVGGGNIWRGMA--GSAKGM-DRATADYMGML
PYRH_BACSK      GIDPTVIQSIAKQIKEITEL--NIEVAVVVGAGNIWRGMA--GSAQGM-DRATADYMGML
PYRH_OCEIH      GIDPKVIQSISKQVKEVADL--GVEVAIVVGGGNIWRGKV--GSEMGM-DRASADYMGML
PYRH_LISMF      GINPSVVNLISAQIKEVVEL--GVEVAIVVGGGNIWRGKL--GSEMGM-DRAAADQMGML
PYRH_STAS1      GINPIIIKSIAEQVAEVAKL--DCEIAVIVGGGNIWRGKT--GSDLGM-DRGTADYMGML
PYRH_LACJO      GINPEVIKHLAEEIKSVHDM--GVEIGIVCGGGNMWRGET--GANLGM-ERAQADYMGML
PYRH_LACH4      GINPTVIGHLAKEIKSVYDL--CVGIGIVCGGGNMWRGET--GAKLGM-ERAQADYMGML
PYRH_LACDB      GIDPTVIKKLAHEIKLVHDM--GVQIGVVCGGGNMWRGET--GAKLGM-ERAQADYMGML
PYRH_LACPL      GINPPVIKTVAEELKDVYDM--GVQIAIVVGGGNMWRGEA--GAQMGM-ERAQADYIGML
PYRH_LACBA      GINPPVIKTVAEEVKDVYNL--GIQIAIVVGGGNMWRGEA--GAQMGM-ERAQADYIGML
PYRH_PEDPA      GINPPVIQKVAEELRDVHDL--GVQIAIVVGGGNMWRGET--GEQLGM-ERVQADYIGML
PYRH_LACRE      GINPPVLKDVAKELKEVHEL--GVQIAIVVGGGNMWRGVT--GAELGM-ERAQADYIGML
PYRH_LACS1      GINPPEILKVAEEIKEVHDL--GVQIAIVVGGGNMWRGEA--GAEIGM-ERAQADYIGML
PYRH_LACP3      GIKPPVIATIAKQIKEVHEL--GVQIAIVCGGGNIWRGET--GAEMGM-ERAQADYMGML
PYRH_LACSS      GINPEIVKVVANEIKSVHDL--GVQIAIVCGGGNIWRGVT--GEQMGM-ERAQADYMGMM
PYRH_ENTFA      GIKPPVIKEIVQEIKEVHEL--GIEMAIVVGGGNIWRGQI--GAQMGM-ERAQADYMGML
PYRH_LACLM      GFDPETAKAVAEELKEVHDL--GAELAIVCGGGNVWRGVT--GEKAGM-ERAQADYMGML
PYRH_STRS2      GIDLKTVQEMAKEIQEVAES--GIQIALVIGGGNLWRGEP--AAEAGM-DRVQADYTGML
PYRH_STRA3      GIDIPTVQSIAKEIAEVHNS--GVQIALVIGGGNLWRGEP--AAEAGM-DRVQADYTGML
PYRH_STRT2      GIDLPTVQAIAKEIAEVADS--GIQIALVIGGGNLWRGEP--AAEAGM-DRVQADYTGML
PYRH_STRGC      GINIQTVQKMAEEIKEVHDL--GIEIALVIGGGNLWRGEP--AAEAGM-DRVQADYTGML
PYRH_STRMU      GIDIPTVQTIAQEIKEVHDS--GIEIALVIGGGNLWRGEP--ASKAGM-DRVQADYTGML
PYRH_LEUMM      GIDLETVSAIAEELKDVHDL--GTQIAIVVGGGNLWRGEP--ASKIGM-ERSRADYTGML
PYRH_OENOB      GIDLTTVKRVANELAEIKRAYPQVQIAIVNGGGNLWRGEP--AAKAGM-DRARADYIGML
PYRH_ONYPE      GIDPRTIKKIAWEIKEIKDL--GVKIAIIVGAGNLWRGRT--GEELGM-DRSQADYMGML
PYRH_SYMTH      GLDPQVLTALARQIKAVHDM--GVQVAIVVGAGNFWRGRL--GEQMGM-DRASADYMGLL
PYRH_CARHZ      GIDPEVVNSIAGQIAEIIKEF-GIQVAVVVGGGNIWRGLS--GSAKGM-DRATADYMGML
PYRH_DESRM      GIDPEVVYSIASQIKDVL-EH-RVQLAIVVGGGNIWRGIS--GSTKGM-DRATADYMGML
PYRH_MOOTA      GIDQEVITSIASQIKEVR-EL-GVDVAIVVGGGNIWRGVK--GSARGM-DRATADYMGML
PYRH_SYNWW      GIDNEVLNSIARQVVEVV-RQ-EVQVAIVVGGGNIWRGVA--GSAKGM-DRATADYMGML
PYRH_DESHY      GIAHEMLVTVAEQVVEIQ-KL-GVEVALVVGGGNIWRGIA--GSKQGM-DRANADYMGML
PYRH_CALS4      GIDFNVVNRIADEIKEVR-DL-GVQIGLVVGGGNIWRGRD--A--VGM-DRTTADHMGML
PYRH_HUNT2      GLDTDTINEISRNIKEVY-DL-GVEIAIVVGGGNFWRGRS--G--KGM-DRTTADYMGML
PYRH_CLOPS      GIDFNIAMNIAKAVKELV-DM-GIEVGAVVGGGNIWRGRS--G--EGM-DRTTADYMGML
PYRH_CLOBL      GFDFDFTKEISEQIKKLV-DM-GIEVGAVVGGGNIWRGRS--G--SEM-DRTTADYMGML
PYRH_CLONN      GFDFDVTQRIAKEIKEIV-DM-GIEVGAVVGGGNIWRGRN--G--EEM-DRTTADYMGML
PYRH_CLOAB      GIDFEVANRIAKEIKEIV-DL-GIEVGAVVGGGNIWRGRN--G--KGM-DRTTADYMGML
PYRH_CLOTE      GLDFKVVKRISKEIKELV-DM-GVEIGAVVGGGNIWRGRN--G--EDM-DRTTADYMGML
PYRH_ALKOO      GLDPNVVTNIATQVKDIV-NM-GVEVAIVVGGGNYWRGRT--G--EGM-DRTTADYMGML
PYRH_ALKMQ      GLDTDTINDIAHQISEIT-DM-GVQVAIVVGGGNFWRGRT--G--EGM-DRTTADYMGMM
PYRH_CLOD6      GINNDVVNDIAIAIKKIQ-EI-GVEVAVVVGGGNFWRGRT--S--EGM-DRTTADYIGML
PYRH_CALS8      GIDWEVVESIAEEISKVR-EL-GVEVAIVVGGGNFFRGRS--A--EHI-DRATADYMGML
PYRH_MYCSJ      GLDPDVVHLVARQIAEVVRSG--VQVAVVIGGGNFFRGAQ--LQQRGM-ERTRSDYMGML
PYRH_MYCS2      GLDPDVVAQVARQIAEVVRSG--AQVAVVIGGGNFFRGAQ--LQQRGM-ERTRSDYMGML
PYRH_MYCPA      GLDPDVVAQVARQIAEVVRGG--VQVAVVIGGGNFFRGAQ--LQQRGM-ERTRSDYMGML
PYRH_MYCLE      GLDLDVVAQVARQIAEVVRGG--VQVAVVIGGGNFFRGAQ--LQQRGM-ERTRSDYMGML
PYRH_MYCBO      GLDPDVVAQVARQIADVVRGG--VQIAVVIGGGNFFRGAQ--LQQLGM-ERTRSDYMGML
PYRH_NOCFA      GLDPDVVETVAEQIAEVVAGG--VQVAVVIGGGNFFRGAE--LEERGM-ERARSDYMGML
PYRH_RHOJR      GLDPDVVTKVAEQIAEVVRSG--VQVAVVIGGGNFFRGAE--LQQRGL-DRARSDYMGML
PYRH_CORDI      GIDPDVVQNVARQIASVARTG--AEIAVVIGGGNFFRGAQ--LQQRGL-DRNRSDYMGML
PYRH_CORJK      GIDPDVVQNVARQIAEVSKSG--VEVAVVIGGGNFFRGAE--LQQRGL-DRSRSDYMGML
PYRH_COREF      GIDPDVVDNVARQIAEVAKSG--AEIAVVIGGGNFFRGAE--LQQRGM-DRARSDYMGML
PYRH_SACEN      GIDPDVVGTVARQIAEVVADG--VEVAIVIGGGNFFRGAE--LQQRGM-ERARGDYMAML
PYRH_ACIC1      GVDPDIVASIARQIAAVVAEG--VQMAVVIGGGNFFRGAE--LSVRGM-DRARSDYMGML
PYRH_STRCO      GVDPDVVHAIAREIAAVVRDG--AQIAIVIGGGNFFRGAE--LQVRGM-DRARSDYMGML
PYRH_CUTAK      GVDADVVSAKAREIAEIANSG--VQVAVVVGGGNFFRGAE--LQQHGM-QRDRADYMGML
PYRH_NOCSJ      GVDPDVVQTVAREIAAVVNAG--VQIAIVTGGGNFFRGAE--LQQRGM-DRVRADYMGML
PYRH_CLAM3      GVDPDVVSALAREIAEAAKT---VEVAIVVGGGNFFRGAQ--LSQRGM-DRGRADYMGML
PYRH_LEIXX      GVNPDIVSGIAREIAQAATD---VEIAIVVGGGNFFRGAE--LSQRGM-DRGRADYMGML
PYRH_PAEAT      GVDPETVRAIAKQIAAAVTE---VEVAIVVGGGNFFRGAE--LSQSGM-DRSRADYMGML
PYRH_TROW8      LVDPDVVSAIASEIVRVSKT---IQIAIVVGGGNYFRGAE--LSRRGM-ARDRADYMGML
PYRH_BIFAA      GIDTTVVRRIAEEIVPAVKQG--VQVAIVVGGGNFFRGAE--LQQAGI-DRSRGDYMGML
PYRH_THEFY      GISPKVVGYIAQAIAEAVAKG--IQVAVVIGGGNMFRGAE--LSQGGM-ERSRADYMGML
PYRH_DEHM1      GIDIPTVRSIAHEIKHICL--MGVEVAIVVGGGNIWRGAT--AAKEGI-DRVSADYAGML
PYRH_LEPIC      GIDTNKAHSLAEEIKEVHD--LGVEIALVVGGGNIIRGTN--LAKAGI-DRATADYMGML
PYRH_DEIRA      GISPETTAELARRIIGALDG-TEVELAVVIGGGNLWRGAR---NGQGM-DPATADYIGML
PYRH_DEIGD      GISPDTTAQLARLITDALTG-TNVELAIVIGGGNLWRGAR---NGKGM-DAATADYIGML
PYRH_THET2      GIEPEATQALAREIKAAYD--TGVQLAIVIGAGNLWRGAR---QGVGM-DRATADYIGML
PYRH_RUBXD      GIDPGSLEVSVEQVLEAVE--AGAELAIVVGGGNIFRGAQV-ADELGI-ESATADYMSML
PYRH_ROSS1      SIDPNMLDYYAEEIERVHR--HGVQVAVVLGGGNIWRGNQ--AIARGM-DAAQSHYMGML
PYRH_RHOBA      GISDNELLAIAKQIKSAHES--GCQIAIVNGGGNILRGASFSGANASV-QEATAHYMGML
PYRH_GEOSL      GIDPRTITAIAAEIKEVVAT--GSQLALVIGGGNIFRGLA--ASSKGM-DRASADYMGML
PYRH_PELPD      GIDPKTITTIAREIKEVVQQ--GVQLALVIGGGNIFRGLA--ASSQGM-DRAGADNMGML
PYRH_PELCD      GIDPQVISGIAEEIREVIGL--GVQVAVVIGGGNIFRGMA--AAAGGM-DRAGADYMGML
PYRH_BDEBA      GINTATITQIAQDVAAAYKA--GVQIGLVIGGGNIYRGVA--ASAEGM-DRASADYMGML
PYRH_ANADF      GISPKTLSAIAGDVKDCVDL--GVEVALTIGGGNIFRGVS--GATEGM-DRSSADYMGML
PYRH_MYXXD      GIHPPTLMGIAEEVIELAQA--GVEVALVIGGGNIFRGVA--GATEGM-DRASADYMGML
PYRH_KORVE      GVDPTRVHEIAAEIAEVHRL--GVDIGVVVGGGNFFRGVA--EQAKDM-DRVSADHMGML
PYRH_SYNAS      SIDPEMVNAIAAEIKEVVNL--GVSLGVVVGGGNIFRGVE--ANAKGM-DRTSADYMGML
PYRH_SOLUE      GIDADRVRSLGREVADVAAS--GIQVGVVVGGGNIFRGVA--AAARSM-DRVTGDHMGML
PYRH_CHLPD      GINAQMLERYAEEIREVRNL--GAEVALVIGGGNIFRGVS--EAAANM-DRVQADYMGML
PYRH_PELLD      GINAEMLERFAEEVKEARDM--GAEIALVIGGGNIFRGVS--DAAKNM-DRVQADYMGML
PYRH_CHLCH      GINAGVLDQYAEEISEARDM--GAQIALVIGGGNIFRGVS--QAAANM-DRVQADYMGML
PYRH_CHLTE      GIDAGVLESFADDIKEATDL--GAEIALVIGGGNIFRGLS--AAAASM-DRVQADYMGML
PYRH_SALRD      GIDEAVLRTYANEVKTAVEA--GAEVAVVIGGGNIFRGVE--HAMEGM-TRAHADYMGML
PYRH_GRAFK      GIDPERLAEYAAEIKSVVDK--GVEVAIVIGGGNIFRGVA--GASRGM-DRVQGDHMGML
PYRH_FLAPJ      GIDPKRLAEYADEIKQIHDL--GVQIAIVIGGGNIFRGIA--GASNGM-DRVQGDYMGML
PYRH_CYTH3      GIDSQVLIRYANEIKAIADK--GVEITIVVGGGNIYRGIE--AAATGI-DRVQGDYMGML
PYRH_BACV8      GIDEKRLGEYAQQIKEIHDL--GVQIGIVIGGGNIFRGLS--GASKGF-DRVKGDQMGML
PYRH_PARD8      GIDEVRLNEYAAQIKEIAEM--GVQIGIVIGGGNIFRGLS--GASKGF-DRVKGDQMGML
PYRH_PORGI      GIDPNRLADYASDIKEACAM--GVQIGIVIGGGNIFRGVS--GAAKGF-DRVKGDQMGML
PYRH_FUSNN      GISSDVIASYAKQIKEIVDL--GVEVSIVIGGGNIFRGLS--GAAQGV-DRVTGDHMGML
PYRH_ALKEH      GISPDVIRRIAHEVAEVSRM--GVEIALVIGGGNIFRGAG--LAAAGM-DRVTADHMGML
PYRH_HALHL      GIAANTLDRIADELAEINAM--GVEVAVVIGGGNIFRGAG--LAASGM-DRVTADHMGML
PYRH_METCA      GIDAEILKRLATEIDELCQA--GVEVGLVIGGGNIVRGAE--KASEGL-DRVTGDHMGML
PYRH_XANC8      GIDPKVINRLAHEVIEAQQA--GAQVALVIGGGNIFRGAG--LAASGM-DRVTGDHMGML
PYRH_XYLFT      GIDPKVINRLAGEVIEAQNA--GAELALVIGGGNIFRGAG--LAAKGM-DRVTGDQMGML
PYRH_NITOC      GIDPKVVQQIALELQELNRI--GIEIGLVVGGGNIFRGAG--LAAVGM-DRVTGDHMGML
PYRH_DICNV      GLDPKVVNRIADEVRQLHEA--GVQVAIVIGGGNLFRGAQ--LAALGM-ERVTGDHMGML
PYRH_METFK      GINRATISRIVEEIKEVVDL--GVEVAVVIGGGNIFRGVA--PAAEGM-DRATADYMGML
PYRH_NITMU      GINRDVIERIVAEIAEVNQL--GVEVAVVIGGGNIFRGMT--SSAEGM-DRATADYMGML
PYRH_CHRVO      GINRTTIEQIVGQIKEVVEL--GVEVGVVIGGGNIFRGVA--PAAAGM-DRATADYMGMM
PYRH_NITEU      GIDRAVVEHIVVEVAGVLQL--GVEVAIVVGGGNIFRGMK--SAGDGM-DRVTADYMGML
PYRH_POLNA      GINRATIVRMVEEIAEVTRM--GVQVAVVIGGGNIFRGVA--GGSVGM-DRATADYMGML
PYRH_METPP      GINRATIVRMVQEVREITEM--GCEVAVVIGGGNLFRGVA--GGAVGM-DRATADYMGML
PYRH_VEREI      GINHATIVRMVQEIAEVTRL--GVQVAVVIGGGNIFRGVA--GGAVGM-DRATADYMGML
PYRH_RHOFT      GINHDTIVRMVDEIAEVTRL--GVEVAVVIGGGNIFRGVA--GGSVGM-DRATADYMGML
PYRH_HERAR      GINRATIERMVADVSEVSRL--GVELAIVIGGGNIFRGVA--PGAEGM-DRATADYMGML
PYRH_BORA1      GINRSTIVRMTDEIAEVAAM--GVELAIVIGGGNIFRGVA--PGAQGM-DRATADYMGMM
PYRH_CUPNH      GINRSTIEAMVNDIAEIVKL--GVQVAVVIGGGNIFRGVA--GGAAGM-DRATADYMGML
PYRH_AROAE      GINEDVVSRIVAEIAEVNRL--GVQVGVVIGGGNIFRGMK--GAASGM-DRATADYMGML
PYRH_DECAR      GINPQTIAAICGEIKAVADM--GVEIGVVIGGGNIFRGMA--GTATGM-DRATADYMGML
PYRH_NEIMF      GINHDTIVQTVGEIAEVVKM--GVQVGIVVGGGNIFRGVS--AQAGSM-DRATADYMGMM
PYRH_THIDA      GYHAGTMAGFVGQIRDVVAL--GVQVGIVVGGGNLFRGAT--GALAGM-NRATADSMGML
PYRH_RHILO      GIDVSVVDRIAADIAEARGL--GIEVGVVIGGGNIFRGVA--VASKGG-DRVTGDHMGML
PYRH_CHESB      GIDVSVVDQIAADIADALSL--GVEVGVVIGGGNIFRGVA--VASKGG-DRVTGDHMGML
PYRH_OCHA4      GIDVSVADRIANDIKQARSL--GVEVGVVIGGGNIFRGVA--VASKGG-DRVTGDHMGML
PYRH_AGRFC      GIDVAVADRIASDIAEARAM--GVEVGVVVGGGNIFRGVA--VASKGG-DRVTGDHMGML
PYRH_RHIEC      GIDVTVADRIASDIAEARHM--GVEVGVVVGGGNIFRGVA--VASKGG-DRVTGDHMGML
PYRH_BARBK      GIDVSVADRIASDIAEVRKM--GVEVAIVIGGGNIFRGVA--VASHGG-DRVTGDHMGML
PYRH_NITHX      GIDQPTVDRIAGDLASARAL--GTEIAVVVGGGNIFRGVE--VSSRGV-SRPTGDTMGML
PYRH_RHOP5      GIHQPTIDRIAGDLIAAQQL--GVEIAVVIGGGNIFRGVE--VSTRGV-SRPTGDTMGML
PYRH_BRASB      GIDQATVDRIADDLIAAQKL--GIEIAVVVGGGNMVRGVE--VSSQGV-SRPTGDTMGML
PYRH_BRADU      GIDQPTVDRVADDLIAARHL--GTEVAVVIGGGNIVRGVE--VSSRGV-SRPTGDTMGML
PYRH_RHOP2      GIDQPTIDRVAGDLIAARGL--GVEIAVVVGGGNIFRGVE--VSARGV-SRPTGDTMGML
PYRH_RHOPA      GIDQATIDRVAGELIAARSL--GIEIAVVIGGGNIFRGVE--VSARGV-SRTTGDTMGML
PYRH_AZOC5      GLHPPTVARIARELVAAREL--GCEVAVVVGGGNILRGAR--VAGEDL-DRSTADHMGML
PYRH_MAGMM      GIAPEFLSYLVEEVQSAIAL--DIELALVIGGGNIFRGIS--GSANGM-GRTRADQMGML
PYRH_PARUW      GIQQQACLQITKSIQQIQQL--GIQLGIVIGGGNIFRGIN--LKANGM-PRVPADHMGML
PYRH_MYCPU      AIDYKLVEDIAKQLKEVVKKG--IEVAIVVGGGNFWRGTS---AEKNGIPRNRADYIGML
PYRH_MYCS5      AIDFELVAKIASQLKIIIEKG--VQVSIVVGGGNFWRGVS---AEKNGIPRNRADFIGML
PYRH_MYCMO      LIDYEIVKNIAIQLQKIHKQG--YEVAIVVGGGNFWRGES---ASKNGIPRTRADYIGML
PYRH_MYCH7      AIDYELVRQIGSQLKEIQNLG--HKILIVIGGGNFWRGTS---AAKNGINRNTADYIGML
PYRH_MYCGE      PFSNDFFETIINQLKVLKES---YQVGIVIGGGNIIRGNN---CQEFNIAEYHGHQLGII
PYRH_MYCPN      PFSNQFLETVIAQLKQLVPN---YQIGIVIGGGNIMRGKS---CSDYNITEIAGHHLGIM
PYRH_MYCGA      CYSYQRINSLADQLKSLAKK---YNIGLIVGGGNIFRGKL---AKDFGVEINKADYIGML
PYRH_UREPA      IIDFIKINDLAEQIEKISKK---YIVSIVLGGGNIWRGSI---AKELDMDRNLADNMGMM
PYRH_MYCPE      IIDLDFLREIGRQIKVLSNN---YKVAIVLGGGNIWRGNI---AKEIGMQRYKADQMGML
PYRH_MESFL      IYNKEKLEDIAKQIVELAKNG--LKLGIVIGGGNIWRGKL---GTDIDMPQINADYMGML
PYRH_MYCCT      VYDKKCLEDIASQIIHLVKNG--LKLGIVIGGGNIWRGKL---GENIGMDAINADYMGML
                             :                *.**  **                .  .::

PYRH_FRACC      STVINSLLLRGKLTALGEDNLRVMTAVP--VPAVAEPYIRLRAVHLLEKGATVILACGNG
PYRH_ORITB      GTIINALMLKAALEKESNYKVRVMSAIK--IEAVAEPFIRSRALSHLYKGYLIILAAGIG
PYRH_CHLFF      ATLINGMAVADALKAD-DIPCLLTSTLS--CPQLADLYTPQKSAEALSQGKVLICTTGAG
PYRH_CHLPN      ATLINGMAVADALKAE-DIPCLLTSTLS--CPQLADLYTPQKSIEALDQGKILICTTGAG
PYRH_CHLMU      ATLINGMALADALKTE-DVPNLLTSTLS--CPQLAELYNPQKASDALSQGKVVICTMGAG
PYRH_FERNB      GTVINALYLKDRFENA-GIRTVIVSQIV--TLPSVKLINYDDIDLYFDAGYVVIFAGGTS
PYRH_THEM4      GTVINALYLKDIFEKN-NLRTVVVSQVS--SLPSIRPIHYDDINLYFDAGYLVIFAGGTS
PYRH_PSELT      GTVINALYLKGSLQKV-GIKCVVVSQVT--SLPSIRPIHYDDINLYFDAGYVVIFAGGTS
PYRH_THEMA      GTVMNSVYLKDIFERS-GLKARIYSQIV--NLPDVERVNYDSIESALRENSILIFAGGTS
PYRH_FRATF      ATMINALALRDMLISE-GVDAEVFSAKG--VDGLLKVASAHEFNQELAKGRVLIFAGGTG
PYRH_ECOLI      ATVMNGLAMRDALHR-AYVNARLMSAIP--LNGVCDSYSWAEAISLLRNNRVVILSAGTG
PYRH_PHOLL      ATVMNGLAMRDALHR-AYVNARLMSAIP--LNGVCDNYSWAEAISLLRHGRVVIFSAGTG
PYRH_ALIF1      ATVMNGLAMRDALHR-AYVNARVMSAIP--LKGVCDDYNWADAIAQLRQGRVVIFSAGTG
PYRH_PHOPR      ATVMNGLAMRDALHR-AYVNARVMSAIP--LNGVCDSYNWAEAISQLRQGRVVIFAAGTG
PYRH_AERHH      ATVMNGLAMRDALHR-AYVNARLMSAIS--LQGICDSYVWAEAISQLRAGKVVIFSAGTG
PYRH_SHELP      ATVMNGLAMRDALHR-AYVNARLMSAIP--LKGVCDDYNWAEAISLLKSGRVVIFAAGTG
PYRH_IDILO      ATVMNGLAMRDALHR-AFVNARLMSAIE--LTGVCDSYNWAEAISLLKSGRVVIFSAGTG
PYRH_COLP3      ATVMNGLAMRDALHR-AFVNTRLMSAID--LAGVCERYNWANAISLLKSGRVVIFSAGTG
PYRH_PSEA6      ATVMNGLAMRDALHR-AFVNARLMSAIP--LNGVCDAYNWAEAISLLKSGRVVIFAAGTG
PYRH_PSEHT      ATVMNGLAMRDALHR-AFVNCRLMSAIP--LHGMCDAYNWAEAISLLKTGRVVIFAAGTG
PYRH_PSYIN      ATVMNGLAMRDALQR-SHVNSRLMSAIP--LNGVCDDYNWAKAIRYLKQGTVVIFAAGTG
PYRH_ACTSZ      ATVMNGLAMRDALHR-ADVNAKLMSAFQ--LNGICDTYNWSEAIKMLREKRVVIFSGGTG
PYRH_HAEDU      ATVMNGLAMRDALHR-AEVNAKLMSAFQ--LNGICDTYNWSEAIKMLREKRVVIFSAGTG
PYRH_HAES1      ATVMNGLAMRDALHR-ANVNAKLMSAFQ--LNGICDTYNWSEAIKMLCEKRVVIFSAGTG
PYRH_HAEIN      ATVMNGLAMRDSLFR-ADVNAKLMSAFQ--LNGICDTYNWSEAIKMLREKRVVIFSAGTG
PYRH_BLOPB      ATIMNGLAMRSALNH-AYVHSHLMSAIP--LNGVCDHYNWMKAINLLSNNWVVIFAAGTG
PYRH_BLOFL      ATIMNGLVMHNALHR-VYVDSSVMSAIP--LQGVCDNYNWMRAIDLLSNNKVVIFGAGTG
PYRH_BAUCH      ATVINSLAIRNTMLH-ININANILSAIP--LDGICELYNLDKAIDLLEKNIVVIFAAGIG
PYRH_BUCAI      STVINSLAMRDTINSISSIKTCLMSAIP--LNGICEIYNYEKAMNLLSNHVVVIFSAGTG
PYRH_BUCAP      STIINSLAMKDIMNS-YSIPSYVMSSIP--VDGICETYNYERAIDLLSNNFVVIFAAGTG
PYRH_BUCBP      STIMNGLLLCDSMDL-VHLSSCLMSSIC--IDKICEQYSFKKALSLLRRNKVVVFSGGLG
PYRH_WIGBR      STLINGLFIYNHFER-LNIKSQLISPFPFNINGICESYNIFRINKILKKK-IVIFCFGIG
PYRH_BUCCC      STVMNGLLLHEFMQT-ANIKSKIFSSTL--LEGICERYHIDKAIKCLEKKSVAIFCFGLG
PYRH_RUTMC      ATVMNALAIADVCQK-NKVDTLVMSGFS-IGGGVCDSINHVHAKQALNEGKVVIFCAGTG
PYRH_VESOH      STIINALAIADTCQK-NKVDALVMSGLS-IGGGICNSINHIYAKQALKKGKVIIFCAGTG
PYRH_HYDCU      ATVINALALRDVIED-MGMSSVVYSAMA-IEG-VSHGFNANHVKKGMAEGQVAIFAAGTG
PYRH_PSEU5      ATVMNALAMRDALER-SNIPALVMSAIS--MVGVTDHYDRRKAMRHLKSGEVVIFSAGTG
PYRH_PSEPF      ATVMNALAMRDALER-ANISAIVMSAIS--MVGVTDHYDRRKAMRHLNSKDVVIFAAGTG
PYRH_SACD2      ATVMNALAMRDALER-SNISSTVMSAIP--MHGVTDQYDRRKALRLLDNGEVVIFSAGTG
PYRH_HAHCH      ATVMNALAMRDALER-SNIATRVMSAIP--MSGVVEHYDRRRAIRDLKEGDVVIFCAGTG
PYRH_MARHV      ATVMNGLAMRDALER-SNIRTRVMSAIP--MSGIVEHYDRRRAVRDLKEGDVVIFSAGTG
PYRH_CHRSD      ATVMNGLAMRDALER-SNIRSRVMSAIP--MSGVVEHYDRRTAIRYLTSGDVVIFSAGTG
PYRH_ALCBS      ATVMNGLALRDALER-SNIRTRLMSAIP--MSGVVEHYDHRNANRHLKNGEVVIFCAGTG
PYRH_PSYWF      ATVMNGLAMRDALER-RNINTRLMSALP--IGEVTESYSSRNAIRYLKNGDVCIFVAGTG
PYRH_ACIBT      ATVMNGLAMRDALVR-RNIRTRLMSALP--IGTVVESYSSRDAIRHLSQGEVCVFVAGTG
PYRH_LEGPA      ATLMNALALRDALER-IDLPARIMSAIP--MLGVVDPYHRRKAITHLRNGQVVIFAAGTG
PYRH_COXBU      ATLMNALALRDAFER-SNLPVRILSAIP--MTGVADAFHRRKAIHHLQQGRVVIFAAGTG
PYRH_HELAH      ATVINAVAMQEALEHI-GLDTRVQSAIE--IKEICESYIYRKAIRHLEKGRVVIFGAGTG
PYRH_WOLSU      ATVINAVAMQEALEHA-GLDVRVQSAIE--LKEICESYIYRRAIRHLEKGRVVIFGAGTG
PYRH_HELHP      ATVINAVAMQEALEYL-GVDVRVQSALE--IKEVCESYIYRRAIRHLEKGRVVVFGAGTG
PYRH_CAMC1      ATVINSIAMREALERS-GLEVRVQSAIK--MEAICETFIVGRAQRHLEKGRVVIFAAGTG
PYRH_CAMC5      ATVINSIAMREALERG-GLDVRVQSAIK--MEAICETFIVGRANRHLEKGRVVIFAAGTG
PYRH_CAMFF      ATVINAIAMREALEYS-GLSVRVQSAIK--MEAICETFIMGRAQRHLEKGRVVIFAAGTG
PYRH_CAMJD      ATVINAIAIQEALERS-GLEVRVQSAIQ--MEAFCETYIMRRAQRHLEKGRVVVFAAGTG
PYRH_CAMHC      ATVINAIAMREALEFY-DVDVRVQSAIK--MEAICETFIIGRAKRHLEKGRVVIFAAGTG
PYRH_SULNB      ATVINGVAIQEALEHI-GLEARLQSAID--MHEIGEAFIIRRARRHLEKGRVVIFAGGTG
PYRH_SULDN      ATVINGIAMQEACEHA-GLQVRMQTAIK--MEQIAEPYINRRAVRHLEKGRVVIFAAGTG
PYRH_ARCB4      GTVINGVAMQEALEYK-GLSARLQTAIK--MEQIAEPFIVRKAMRHFEKGRVVIFGAGTG
PYRH_NITSB      ATVINAVALQEALEYF-GLTARVQSAIE--MNEICEPFIVRRAMRHLEKGRIVIFAAGTG
PYRH_DESPS      ATVMNSLAMQDALERS-GVITRAMSAIP--MQSICESYIRRRATRHLEKGRVVIFAAGTG
PYRH_DESVV      ATVLNALAVQDALEKL-GHPTRVLSAIT--MQEVCEPYIRRRAERHLEKGRVVICAAGTG
PYRH_DESAG      ATVLNAVAVQDALEKL-GHATRVLSAIT--MQEVCEPYIRRRAERHLEKGRVVICAAGTG
PYRH_LAWIP      ATVLNALAIQDTLEKK-GHPTRVLSAIA--MQEVCEPYVRRRAMRHLEKGRVIICAAGTG
PYRH_PARL1      ATVMNALAMQTALEAI-GVPTRVQSAIP--MMTVCEPYIRRRAVRHMEKGRVVIFAAGTG
PYRH_MARMM      ATVMNALAMQTALERI-GVQTRVQSAIP--MTTVCEPYIRRRATRHMEKGRVVIFAAGTG
PYRH_CAUVC      ATVMNALAMQDALERI-GVETRVQSAIP--MATVCEPYIRRRAQRHLEKGRVVIFAAGTG
PYRH_SPHAL      ATVMNALAMQNALEQL-GVQTRVQSAIE--MDKVCEPVIRRRAERHMEKGRVVIFAAGVG
PYRH_NOVAD      ATVMNALAMQSALEQL-GVPTRVQSAIE--MDKVCEPVIRRRAERHLEKGRIVIFAAGVG
PYRH_ERYLH      ATVMNALAMQSALEQL-GVHTRVQSAIQ--MDQVCEPVIRRRAERHLEKDRVVIFAAGVG
PYRH_ZYMMO      ATVMNAIAVQNALENL-GVDTRVQSAIP--MPTVCEPFIRRRAERHMEKGRVVIFAAGTG
PYRH_SPHWW      ATVMNALAVQNALEQI-GVDTRVQSAIP--MSTVCEPFIRRRAERHLEKGRIVIFAAGTG
PYRH_HYPNA      ATVMNALAMQSVLENL-GVPTRVQSALN--MDAICEPYIRRRAHRHMEKGRVVIFAAGIG
PYRH_MAGSA      ATVINALSVQNALEKV-GVETRVQSAIV--MPTVCEAFIRRRAIRHLEKGRVVIFAAGTG
PYRH_RHORT      ATVMNALAVQNALEKR-GVQTRVQSAIP--MSMVCEPYIRRRAIRHMEKGRVVIFAAGTG
PYRH_GRABC      ATVMNALAMQAALEKL-NVPTRVQSAIP--MASVCEPYVRRRAQRHMEKGRVVIFAAGTG
PYRH_ACICJ      ATVMNALAMQSALEKR-GVATRVQSAIP--MSAVCEPYIRRRAERHMEKGRVVIFAAGTG
PYRH_GLUOX      ATVINALMLQNALERR-GMETRVMTAIQ--MAAIAEPYIRRRAVRHMEKGRVVIFAAGTG
PYRH_RICBR      ATVINALTLQNVMESL-NIYTRVLSAIP--MMSVCEPYIRRRAKRHMEKGRVVIFAGGTG
PYRH_RICAH      ATVINALTLQNVMESL-DIYTRVLSAIP--MMSVCEPYIRRKAKRHMEKKRVVIFAGGTG
PYRH_WOLPM      ATIINALILQNFLEKN-LVASRVLSAIP--MATVCEPYIRRKAIRHLEKGRVVIFAAGTG
PYRH_WOLTR      ATIINALILQNFLEKN-SVNSKVLSAIP--MVTICEPYIRRKAIHHLEKGRVVIFAAGTG
PYRH_EHRCJ      ATMMNALSLQNALEKI-NVQSRVLSAIP--ITAVCETYIRRRAIRHLEKGRVVICAAGVG
PYRH_EHRRW      ATMMNALSLQNSLEKI-NVQSRVLSAVS--ITAVCETYIRRRAIRHLEKGRIVICAAGVG
PYRH_ANAMM      ATVINALALQNALEEM-GVECRVLSAMP--MTAVCETYVRRRAVRHLEKGRVVICAAGIG
PYRH_ANAPZ      ATMINALALQNSLEDM-GIASRVLSAIP--MTAVCETYIRRRAIRHLEKGRVVICAAGIG
PYRH_NEOSM      ATVINALALQGAINNL-GVVSRVQSAIP--MRSICEPYVRQKAISHMEKNRIVIFAAGTG
PYRH_RHOS4      ATVMNALAMQAALESL-GIFTRVISAIP--MDQVCEPYIRRRAVRHLEKKRVCIFAAGTG
PYRH_ROSDO      ATVMNALAMQSALEGL-GIHTRVISAIT--MNEVAEPYIRRRAVRHLEKKRVCIFAAGTG
PYRH_PARZE      ATVMNALAMQSALEAL-GHHCRVISAIR--MDEVCEPYIRRRAIRHLEKKRIVIFAAGTG
PYRH_PARDP      ATVMNALAMQAALEAL-KIHTRVISAIR--MDEVAEPYIRRRAVRHLEKKRVCIFAAGTG
PYRH_JANSC      ATVMNALAMQGALESL-GVYTRVISAIT--MNEVAEPYIRRRAIRHLEKKRVCIFAAGTG
PYRH_RUEST      ATVMNALGMQSALEDL-GVFTRVISAIR--MDEVAEPYIRRRAVRHLEKKRVCIFAAGTG
PYRH_RUEPO      ATVMNALGMQAALEGL-GVFTRVISAIR--MDEVAEPYIRRRAVRHLEKKRVCIFAAGTG
PYRH_AQUAE      ATVINALALQSALENHVNIPTRVLSAIE--MRQVAEPYIRRRAIRHLEKGRIVIFAGGTG
PYRH_SYNFM      ATVMNALALQQALEKH-GTSTRVQSAID--MKEVAEPYIRRRALRHMEKGRIVIFAAGTG
PYRH_SYNP6      ATVMNAITLQDALEQL-QVPTRVQTAIA--MQEVAEPYIRRRAIRHLEKGRVVIFGSGTG
PYRH_SYNY3      ATVMNAMTLQDALEQM-DIPTRVLTAIA--MQEVAEPYIRRRAIRHLEKGRVVIFGAGSG
PYRH_THEEB      ATVMNAMTLQDALEQM-NVPTRVQTAIA--MQEVAEPYIRRRAIRHLEKGRVVIFGAGSG
PYRH_NOSS1      ATVMNAMTLQDSLERI-GVQTRVQTAIA--MQELAEPYIRRRAIRHLEKGRVVIFGAGSG
PYRH_TRIEI      ATVMNAITLQDALEQV-GVPTRVQTAIA--MQELAEPYIRRRAIRHLEKGRVVVFGAGSG
PYRH_SYNJA      ATVINALTLQDAIERA-GIPTRVQTAIA--MQEVAEPYIRRRAIRHLEKGRVVIFGAGSG
PYRH_SYNPW      ATVMNAITLQDGLERA-GIPTRVQTAIE--MQEVAEPYIRRRAIRHLEKGRVVVFGAGCG
PYRH_SYNS9      ATVMNAITLQDGLERA-GVPTRVQTAIA--MQEVAEPYIRRKAMRHLEKGRVVVFGAGCG
PYRH_SYNR3      ATVMNAITLQDGLERA-GVPTRVQSAIA--MQEVAEPYIRRKAMRHLEKGRVVIFGAGCG
PYRH_PROM1      ATVMNAITLQDGLERA-GVPTRVQSAID--MQQIAEPYIRRRAIRHLEKGRVVVFGGGCG
PYRH_PROMA      ATVMNAITLQDGLERA-GVETRVQTAIE--MQQIAEPYIRRRAIRHLEKGRVVVFGGGCG
PYRH_PROM9      ATVMNAISLQDGLERV-GVATRVQTAIE--MQEIAEPYIRRRAMRHLEKGRVVVFGGGCG
PYRH_GLOVI      ATVMNALTLQDALEQQFQVQTRLLSAIE--MKEVAEPFIRRRAMRHLEKGRVVIFGAGSG
PYRH_BACLD      ATVMNSLALQDSLETL-GIQSRVQTSIE--MRQVAEPYIRRKAIRHLEKKRVVIFAAGTG
PYRH_BACAN      ATVMNSLALQDSLENI-GIQTRVQTSIE--MRQVAEPYIRRKAVRHLEKKRVVIFAAGTG
PYRH_GEOTN      ATVMNALALQDSLEQL-GVETRVQTSIE--MRQVAEPYIRRRAIRHLEKKRVVIFAAGTG
PYRH_BACHD      ATVMNSLALQDSLENL-DVQSRVQTSIE--MRQVAEPYIRRRAIRHLEKKRVVIFAAGTG
PYRH_BACSK      ATVMNSLALQDSLEAI-GVESRVQTSIE--MRQVAEPYIRRKAIRHLQKKRVVIFAAGTG
PYRH_OCEIH      ATIMNSLALQDGLETI-DVETRVQTSIE--MRQVAEPYIRRKAIRHLEKKRVVIFAAGTG
PYRH_LISMF      ATIMNSLSLQDSLENI-GVATRVQTSID--MRQIAEPYIRRKAIRHLEKGRVVIFAGGTG
PYRH_STAS1      ATVMNALALQDSLEQL-ECDTRVLTSIE--MKQVAEPYIRRRAIRHLEKNRVVIFAAGIG
PYRH_LACJO      ATIMNGLALQDGLENL-GVPTRVQTSIE--MRQIAEPYIRRKAVRHLEKGRVVIFGGGTG
PYRH_LACH4      ATIMNGLALQDGLEKV-GVPTRMQTSIE--MRQIAEPYIRRRALRHLEKGRVVIFGGGTG
PYRH_LACDB      ATIMNGLALQDGLETA-GVQTRLQTSIS--MRQVAEPYIRRVAISHMEKNRVVIFGGGTG
PYRH_LACPL      ATIMNALALQDNLESI-GVPTRVQTSIE--MRQIAEPYIRRKAMRHLEKRRIVIFAGGTG
PYRH_LACBA      ATIMNALALQDNLESI-GVPTRVQTSIE--MRQIAEPYIRRKAIRHLEKERVVIFAGGTG
PYRH_PEDPA      GTVMNALALQDSLESL-GVPTRVQTSIE--MRQIAEPYIRRKAVRHLEKNRIVIFAAGTG
PYRH_LACRE      ATIMNALSLQDALESL-DVPTRVQTSIE--MRQIAEPYIRRKAIRHLEKDRIVIFAGGTG
PYRH_LACS1      GTVMNALALQDSLESV-GVPTRVQTAIE--MRQVAEPYIRRKAIRHLEKGRIVIFAAGTG
PYRH_LACP3      ATVMNALALQDNLESQ-GVPTRVQTSIE--MRQIAEPYIRRKAIRHLEKGRVVIFAGGTG
PYRH_LACSS      ATVMNALALQDNLESI-GVPTRVQTSIE--MRQIAEPYIRRKAVRHLEKGRVVIFAGGTG
PYRH_ENTFA      ATVMNALALQDTLENL-GVPTRVQTSIE--MRQIAEPYIRRRAERHLEKGRVVIFAGGTG
PYRH_LACLM      ATIQNGLFIQSALENI-GVDTRVMTAIE--MKAVAEPYIRRRAERHLEKGRVVIFAGGTG
PYRH_STRS2      GTVMNALVMADSLKQL-GVDTRVQTAIA--MQSVAEPYIRGRALRHLEKGRIVIFGAGIG
PYRH_STRA3      GTVMNALVMADSLQQY-GVDTRVQTAIP--MQTVAEPYVRGRALRHLEKDRIVVFGAGIG
PYRH_STRT2      GTTMNALVMADSLKQL-GVDTRVQTAID--MKSVAEPYIRGRALRHFEKGRIVIFAAGIG
PYRH_STRGC      GTVMNALVMADSLQRV-GVDTRVQTAIA--MQQVAEPYIRGRALRHLQKGRIVIFGAGIG
PYRH_STRMU      GTVMNALVMADALQHA-GVDTRVQTAIA--MQQVAEPYIRGRALRHLQKGRIVIFAAGVG
PYRH_LEUMM      GTTMNALVLQDSLERA-GVQTRVQTAIT--MQQIAEPYIRGRAIRHLEKGRIVIFAAGTG
PYRH_OENOB      GTVMNALSLADALEQA-GVVTRVLTAIE--MRQIAEPYIRGRAIRHLEKGRIVIFGAGTG
PYRH_ONYPE      GTIMNSLALQDALEQT-NTITRVMTAFP--VSSVAEPYIRRKAIRHLEKDRVVILGAGAG
PYRH_SYMTH      ATVMNALALQDAIEKL-QVDTRVMTAVE--MRQVAEPFIRRRAIRHLEKGRVVIFAAGTG
PYRH_CARHZ      ATVINSLALQDALEKL-GIDTRVQTAIE--MRQIAEPYIRRRAIRHLEKGRVVIFAAGTG
PYRH_DESRM      ATVINSLALQDALEKI-EVDTRVQTSFE--MRAVAETYIRRRAIRHMEKGRVVIFAAGTG
PYRH_MOOTA      ATVINSLALQDALENQ-GVDTRVQTAIE--MRQIAEPYIRRRAIRHLEKGRVVIFAAGTG
PYRH_SYNWW      ATVINALALQDALEQE-GMGTRVMSAIE--MKEVCEPYIRRRAIRHLEKGRVTIFAAGTG
PYRH_DESHY      ATVMNALALQDAMEKA-GAATRVLSAIE--MRQVAEPYIRRRAIRHLEKGRVVIFAAGTG
PYRH_CALS4      ATVINALALQDALEQR-GVPTRVQTAIE--MRAIAEPYIRRRAIRHLEKGRVVIFAAGTG
PYRH_HUNT2      ATVINALGLQDALESQ-GMPTRVQTAIE--MRQIAEPYIRRKAVRHLEKKRIVIFACGTG
PYRH_CLOPS      ATSINALALQDSLESL-GVDTRVQTAIE--MKEIAEPYIRRRAMRHLEKGRVVIFGAGTG
PYRH_CLOBL      ATCINALALQDSLEQL-GVNTRVQTAIE--MKEIAEPFIRRRAMRHLEKERVVIFASGTG
PYRH_CLONN      ATCINALALQDSLENI-GVKTRVQTAIE--MKEVAEPFIRRRAMRHLEKKRVVIFAAGTG
PYRH_CLOAB      ATCINALALQDSLENM-DVDTRVQTAIE--MKQVAEPFIRRRAMRHLEKGRVVIFAGGTG
PYRH_CLOTE      ATCINAMALQDSLEQL-GVDTRVQTAIE--MKEVAEPFIRRRAMRHLEKGRVVIFAAGTG
PYRH_ALKOO      ATVINALALQDSLENL-DVLTRVQSAIE--MRQIAEPYIRRRAVRHLEKNRVVIFAAGTG
PYRH_ALKMQ      ATVINALALQDALENI-EILTRVQTAIE--MRQIAEPYIRRRAVRHLEKNRVVIFAAGTG
PYRH_CLOD6      ATVMNAMALQDALENI-DVATRVQTAID--MRQIAEPYIRRRAVRHLEKERVVIFGAGTG
PYRH_CALS8      ATVINSLALQSILEKR-GIPTRVQSAIE--MRQIAEPYIRRRAIRHLEKGRVVIFACGTG
PYRH_MYCSJ      GTVMNSLALQDFLEKE-GIDTRVQTAIT--MGQVAEPYIPLRAVRHLEKGRVVIFGAGMG
PYRH_MYCS2      GTVMNSLALQDFLQKE-GIDTRVQTAIT--MGQVAEPYIPLRAVRHLEKGRVVIFGAGMG
PYRH_MYCPA      GTVMNSLALQDFLEKE-GIVTRVQTAIT--MGQVAEPYLPLRAVRHLEKGRVVIFGAGMG
PYRH_MYCLE      GTVMNSLALQDFLEKE-GIATRVQTAIT--MGQVAEPYLPLRAVRHLEKGRVVIFGAGMG
PYRH_MYCBO      GTVMNSLALQDFLEKE-GIVTRVQTAIT--MGQVAEPYLPLRAVRHLEKGRVVIFGAGMG
PYRH_NOCFA      GTVMNSLALQDFLQKQ-GVDTRVQTAIT--MGQVAEPYLPLRAKRHLEKGRVVIFGAGMG
PYRH_RHOJR      GTVMNCLALQDFLEKE-GIDSRVQTAIT--MGQVAEPYIPLRAQRHLEKGRVVIFGAGMG
PYRH_CORDI      GTVMNCLALQDFLEQE-GIDCRVQTAIN--MAQVAEPYLPLRAKRHLEKGRVVIFGAGMG
PYRH_CORJK      GTVMNCLALQDFLEQE-GVDCRVQTAIQ--MTQVAEPYLPLRASRHLEKGRVVIFGAGMG
PYRH_COREF      GTVMNCLALQDFLGQH-GVECRVQTAIN--MAQVAEPYLPLRAERHLEKGRVVIFGAGMG
PYRH_SACEN      GTVMNCLALQDFLEREHGIDTRVMTAIT--MGQVAEPYIPRRAARHMEKGRVVIFGAGTG
PYRH_ACIC1      GTVMNCLALQDFLEKL-GVDTRVQTAIT--MGQVAEPYIPRRAIRHMEKGRVVIFGAGLG
PYRH_STRCO      GTVMNCLALQDFLEKE-GVDCRVQTAIT--MGQVAEPYIPLRAVRHLEKGRVVIFGAGMG
PYRH_CUTAK      GTVMNCLALQDFCEKA-GVDTRVQTAIT--MGQVAEPYIPRKAERHMEKGRVVIFGAGSG
PYRH_NOCSJ      GIVMNCLALQDFLEKL-GVETRVQTAIT--MGQVAEPYIPRRAIRHMEKGRVVIFGAGMG
PYRH_CLAM3      GTVMNALALQDFLEQA-GAATRVQSAIS--MTQVAEPYIPRRAVRHLEKGRIVIFGAGAG
PYRH_LEIXX      GTVMNSLALQDFLEQA-GAETRVQSAIE--MIQVAEPYIPLRAERHLEKGRIVIFGAGAG
PYRH_PAEAT      GTVMNCLALQDFLEQA-GVETRVQSAIT--MGQVAEAYIPRRAIRHMEKGRVVIFGAGAG
PYRH_TROW8      GTVINALALQDFLEQA-GGDTRVQSAIS--MSQVAELYVPRRAERHLTKGRVVIFAAGAG
PYRH_BIFAA      GTVMNCLALQDFLEQE-GQATRVQTAIT--MGQVAEPYIPLKAIRHLEKGRVVIFGAGAG
PYRH_THEFY      GTVINCLALQDFLERL-GIETRVQTAIH--MSQVAEAYIPRRAIRHLEKGRVVIFGAGLG
PYRH_DEHM1      ATIINALTLQDALERE-GIVTRTQSALA--VQQVAEPYICRRAIRHLEKGRVVIFAGGTG
PYRH_LEPIC      ATIQNALALQDACEKK-GLYTRVQSAIE--INSIAESYIRRRAVRHLEKRRIVIFAGGTG
PYRH_DEIRA      GTVMNAMALQDAMEAA-GKPTRIMSAIH--MQQVAEPYIRRRAMRHLEKGRVVIFGGGNG
PYRH_DEIGD      GTVMNAMALQDAMEAA-GQPTRVMTAIQ--MAAVAEPYIRRRAIRHLEKGRVVIFGGGNG
PYRH_THET2      ATIMNALALQDALESL-GVPTRVQTALT--ITQVAEPYIRRRALRHLEKERIVIFGGGTG
PYRH_RUBXD      GTVINALALQAALERR-GVPTRVQSAIE--IKEVAEPYIRRRAIRHLEKGRVVIFASGTG
PYRH_ROSS1      ATIINALALQDALERR-GIFTRAMTAIK--MDEVAEPYIRRRATRHLEKGRVIILAAGTG
PYRH_RHOBA      ATVINSLALQDALDSI-GLQTRVMSALP--VDRVAEQFIRRRAIRHLEKGRVIILSGGIG
PYRH_GEOSL      ATMINSLAMQDALEKV-GVDTRVQSAIA--MQEVAEPYIRRRAIRHLEKGRIVIFGAGTG
PYRH_PELPD      ATMINSLAMQDALEKI-GVATRVQSAIV--MQQVAEPYIRRRAIRHLEKGRVVIFGAGTG
PYRH_PELCD      ATIMNSLALQDALEQA-GVPTRVQTAIE--MREVAEPYIRRRAIRHLEKKRVVIFGGGTG
PYRH_BDEBA      ATCINALALQDALEKQ-GVPTRVQTAIE--MAEIAEPYIRRRAIRHLEKNRLVIFGAGTG
PYRH_ANADF      ATVINAMALQDALEKI-GVNTRVQSAIE--MHQVAEPYIRRRAIRHLEKGRVVIFAAGTG
PYRH_MYXXD      ATCINSMAMQDALEKK-GLHTRVLSAIK--MEQIAEPYIRRRAVRHLEKGRVVIFAAGTG
PYRH_KORVE      ATVMNSLAVQDALEKQ-NVQCRVMSAIE--IFQVAEPFIRRRAMRHLEKGRVVIFAAGTG
PYRH_SYNAS      ATVINSLALQSAFERI-GIDTRVQSAIA--MREIAEPFIQRKAMSHLEKRRVMIFAAGTG
PYRH_SOLUE      ATVINSLALSDALEQM-GIPTRVMSAIE--MHQVAEPYIRRRAIRHLEKGRIVIFAAGTS
PYRH_CHLPD      ATVINAIAFQDALERK-GVFTRLQTAIK--MEQMAEPFIRRRAIRHLEKGRVVIFGAGTG
PYRH_PELLD      ATVINSIAFQDALERL-GVYTRLQTAIK--MEQMAEPFIRRRAIRHLEKGRVVIFGAGTG
PYRH_CHLCH      ATVINSLAFQDALERK-GVFTRLLTAIS--MEQIAEPFIRRRAIRHLEKGRVVIFGAGTG
PYRH_CHLTE      ATVINSLALQDALERK-GIFTRLVTAIK--MEQIAEPFIRRRAVRHLEKGRVVIFGAGTG
PYRH_SALRD      ATMINGMALQDAFEQV-DLVTRLQSSIK--MEEIAEPFIRRRAIRHLEKGRVVIFGAGTG
PYRH_GRAFK      ATVINGLALQSALEDA-NIQTRLQSAIK--INEVAEPFIRRKAIRHLEKGRVVIFGGGTG
PYRH_FLAPJ      ATVINGMALQGALEEK-GMLTRLQTALK--IEAIAEPYIKRRAVRHLEKNRIVIFGAGTG
PYRH_CYTH3      ATVINCMALQSALENI-GLDTRLMSGIK--IEQVCESFIRRRAIRHLEKGRIVMFGAGTG
PYRH_BACV8      ATVINSLGLSSALGAA-GVKARVLTAIR--MEPIGEFYNKWKAIEAMENGEVVIMSAGTG
PYRH_PARD8      ATVINSLALSSALVAQ-GVNAKVLTAIR--MEPIGEFYNKWRAIELLEQGNVVIMSGGTG
PYRH_PORGI      ATVINSLALSSALEGV-GVKTKVLTAVR--MEPIGEFYNKWHAIELLEQGYVTIFSCGTG
PYRH_FUSNN      ATVINSLALQNSIEKL-GVPTRVQTAIE--MPKVAEPFIKRRAQRHLEKGRVVIFGAGTG
PYRH_ALKEH      ATVMNGLALQDALEHE-GVYCRVMSAVK--INQVCEDYIRRRAIRHLEKGRVVVFAAGTG
PYRH_HALHL      ATVMNALAIQDALERR-SVFCRVMSAIK--INQVCEDYIRRRAVRHLEKGRVVIFAAGTG
PYRH_METCA      ATVINALAMQDALENL-GRPVRVMSALK--INQVCEDYIRRRAVRHLEKGRVVVFAAGTG
PYRH_XANC8      ATVINALAMQDALEKL-GAKVRVMSAIK--INDVCEDFIRRRAIRHLEKGRIAIFAAGTG
PYRH_XYLFT      ATIINALAMQDALEKL-GTKVRVMSAIK--INNVCEDFIRRRAIRHLEKSRITIFAAGTG
PYRH_NITOC      ATVMNALALQDALERL-GVFCRVMSAIR--INEVCEDYLRRRAIRHLEKGRLVIFAAGTG
PYRH_DICNV      ATLMNSLAMQDALEQI-GVPVRTVSALR--VDEICEPYIRRRAIRHLEKGNVVISAAGTG
PYRH_METFK      ATVMNALALQDAMRHI-GLVSRVQSALN--IEQVAEPYIRGKAIRYLEEGRVVIFGAGTG
PYRH_NITMU      ATVMNALALQDAMRRA-GLVSRVQSALR--IDQVVEPYIRGKAIRYLEEGKIVIFAAGTG
PYRH_CHRVO      ATVMNALALKDAMTKA-GLIARVQSALT--MQQIAEPYVRGKAMQYLEEGKVVIFAAGTG
PYRH_NITEU      ATTMNALALHDAMRRN-GVVSRVQSALR--IDQVVEPYVRGKALRYLDERKVVVFAAGTG
PYRH_POLNA      ATVMNALALGDTMDKA-GLVARVMSAIG--IERVVEPYVRPKALQYLEEGKVVVFAAGTG
PYRH_METPP      ATVMNALALADTMRQE-GMTARVMSAIG--IEQVVEPYVRPKALQYLEEGKVVIFAAGTG
PYRH_VEREI      ATVMNALALADAMNKQ-ALVARVMSAIA--IEQVVEPYVRPKALQYLEEGKVVIFAAGTG
PYRH_RHOFT      ATVMNALALGDTMNKA-GLTARVMSAIA--IEQVVEPYVRPKALQYLEEGKVVIFAAGTG
PYRH_HERAR      ATVMNSLALADAMRQV-GITARVMSAIA--IEQVVEPYVRPKALQYLEEGKIVVFAAGTG
PYRH_BORA1      ATIMNALALQDALKHK-GLDTRVQSALN--IDQVVEPYIRPKTLRYLEEGKVVIFAAGTG
PYRH_CUPNH      ATMMNALALQDAMRHA-NIEGRVQSALR--MDQVVEPYIRPRAIRQLEEGKVVIFAAGTG
PYRH_AROAE      ATVMNAMALADAFRRA-QVEARVQSALR--IDQVVEPYIRGRAIRHMEEGRVVIFAAGTG
PYRH_DECAR      ATVMNAMALSDAFRQC-GLNARVQSALN--IEQVVEPYIRGKAIRYLEEGKIVIFGAGTG
PYRH_NEIMF      ATVMNALALKDAFETL-GIKARVQSALS--MQQIAETYARPKAIQYLEEGKVVIFAAGTG
PYRH_THIDA      ATVMNALALKDALQQA-GVAARVQTAVH--IAHVGEGFERDAAVRELEAGRVVIFGGGTG
PYRH_RHILO      ATVINSLALRTSLHKI-GVDAVVLSAIA--MPELCESFSQRQADAYMNQGRVVIFAGGTG
PYRH_CHESB      ATVINSLALRTSLAKI-GVEAVVLSAIA--MPELCESFSQRQALAYMDAGKVVIFAGGTG
PYRH_OCHA4      ATVINSLALRTSLHKI-GVDSVVLSAIA--MPEICESFSQRQATAYMDEGKVVIFAGGTG
PYRH_AGRFC      ATVINALALATSLRKL-SIDTVVLSAIA--MPEICESFSQRAALHHLAQGRVVIFAGGTG
PYRH_RHIEC      GTIINALALATSLRKL-NIDTVVLSAIS--MPEICESFSQRATLYHLSMGRVVIFAGGTG
PYRH_BARBK      ATAINSLALRTSLTKL-GVETVVLSAIT--MPQICESFSQRKAMSYMNQGKVVIFAGGTG
PYRH_NITHX      ATVMNCLALEAALERR-GQSARALSAFV--MPEVCELFTRNAAHKYLSEGRIVLLGGGTG
PYRH_RHOP5      ATVMNCLALEAAIERR-GVSARTLSAFV--MPQVCELFTRATAHRYLAEKRIVLLGGGTG
PYRH_BRASB      ATVMNCLALEAAIQRK-GAPAQALSAFV--MPQVCELFTRAAAHKALAEGRIVVLGGGTG
PYRH_BRADU      ATMMNCLALEAAIERK-GTPARTLSAFV--MPEISELFTRTAAHKYLAEGRIVLLGGGTG
PYRH_RHOP2      ATVMNCLALGEALRRH-GQPARTFSALL--MPEVCDLYTRAAAQQTLAEGGIALLAGGTG
PYRH_RHOPA      ATVMNCLALAEALQRH-GQKARTLAALM--MPEVCELYTRAAAEQTLREGGIALLAAGTG
PYRH_AZOC5      ATVMNCLALEAAVEAA-GQPARTMSAIP--MPTVCEPYARQPAQRHLRRGRVVLLAGGTG
PYRH_MAGMM      ATVINGLALQSALMLS-GTEAVVQTALE--MPRVAEPFDHDSAKSHMKQGRVVIFVAGTG
PYRH_PARUW      ATLLNGIALQQALISL-EVKTCVMSALD--CPKVAESYQWSKALQYLEEGVVVIFVGGTG
PYRH_MYCPU      ATVMNGLALKSGFEKEGL-VARVYSSLN-LDPKVAENYINEKATKNLENNEIVIFAGGTG
PYRH_MYCS5      ATEMNALALQSGFEKAGL-KARVQSSIN-IDQKVAENYINEKTLKYLNNGEVVIFAGGTG
PYRH_MYCMO      ATTMNALALQSGFESVGL-KARVQSSLS-IDGKVAENYITEKAKHYLSNGEIVIFAGGTG
PYRH_MYCH7      GTVMNGLALDSVFRDLGI-KTRVLSSMS-LDPRICEYFVREKAMKYLEDNNVLIFVGGTG
PYRH_MYCGE      ATVVNGYFLKAKLDAHNL-KSALLSAIS-CPSLAVQILSQQTIDKAFEENDFVIFSGGTG
PYRH_MYCPN      ATVINGAFLKAKFDSHKL-NSTLLSAVS-CPSLATHIVSQTTIDDAFKNHDIVIFAGGTG
PYRH_MYCGA      ATVINSTLLESKLQSLGL-KTKVLSALE-VKGLTNEINPK-SLAEVFSDCQIAFFSGGTG
PYRH_UREPA      ATIINGLALENALNHLNV-NTIVLSAIK-CDKLVHESSAN-NIKKAIEKEQVMIFVAGTG
PYRH_MYCPE      ATVMNSLALQSLLTNINV-KSRIFSTIE-MEKIADSYIIR-NLEESLNNNEIAILSCGTG
PYRH_MESFL      ATVMNGLALESTIKRLGYDKVNVYSSLP-IETVTDDYNFK-RARLKMNEGYISIFVGGTG
PYRH_MYCCT      ATVMNGLALESTITKMGYDKIKVYSSLP-IKTVTDDYNFK-KARIKMNEGFISIFVGGTG
                .   *   .               :                     :      .   * .

PYRH_FRACC      QPFLTTDYPAVQRALELNADAVLAAKDGVDGVYDSDPKINPGA--RLFSHLSYDE----V
PYRH_ORITB      QPFITTDYTAAQRALELRCDAMLVAKHGVNGVFDSNPKEDTNA--RQYCTLAYDD----F
PYRH_CHLFF      SPYLTTDTGAALRACELKADLLLKATMHVDGVYDKDPREFSDA--VKYNRISYKE----V
PYRH_CHLPN      SPYLTTDTGAALRACELNVDVLIKATMHVDGVYDKDPRLFPDA--VKYDFVSYKD----F
PYRH_CHLMU      APYLTTDTGAALRACELKVDVLLKATMHVDGVYDRDPREFADA--VRYDHISYRD----F
PYRH_FERNB      NPFFTTDTGAALRAVEMKAELLIKGTK-VCGIYDKDPKKYSDA--KKYNVITYDE----A
PYRH_THEM4      NPFFTTDTAAALRAVEMKADILIKGTK-VDGIYDKDPKKFTDA--RKFDTLTYDE----A
PYRH_PSELT      NPFFTTDTAAALRAVEMGANLLIKATK-VDGIYDSDPKKNKSA--RKLDKISYYD----A
PYRH_THEMA      NPFFTTDTAAVLRAQEMRAKLVVKATK-VDGVYDKDPKKFPDA--KKIPHLTFSE----A
PYRH_FRATF      NPFVTTDTTASLRAVEIGADALLKATT-VNGVYDKDPNKYSDA--KRFDKVTFSE----V
PYRH_ECOLI      NPFFTTDSAACLRGIEIEADVVLKATK-VDGVFTADPAKDPTA--TMYEQLTYSE----V
PYRH_PHOLL      NPFFTTDSAACLRGIEIEADVVLKATK-VDGVYSADPAKDSEA--VLFDKLSYQQ----V
PYRH_ALIF1      NPFFTTDSAACLRGIEIEADVVLKATK-VDGVFTADPVSNPDA--ELYDKLSYSS----V
PYRH_PHOPR      NPFFTTDSAACLRGIEIEADIVLKATK-VDGVYTDDPVKNPDA--VLCDKLGFQD----V
PYRH_AERHH      NPFFTTDSAACLRGIEIEADVVLKATK-VDGVFTDDPVKNPDA--VLCHELSYDE----V
PYRH_SHELP      NPFCTTDSAACLRGIEIEAEVVLKGTK-VDGVYSDDPVKNPEA--VKYDEMGYGE----V
PYRH_IDILO      NPFFTTDSAACLRGIEIEAEVVLKGTK-VDGVYSDDPVSNPDA--TLYKHINYDD----I
PYRH_COLP3      NPFFTTDSAACLRGIEIEADAVLKATK-VDGVYSEDPAKNPEA--ELYSELSYDE----V
PYRH_PSEA6      NPFFTTDSAACLRGIEIEADAVLKGTK-VDGVYDSDPAKNPDA--VLYKKLSYSE----V
PYRH_PSEHT      NPFFTTDSAACLRGIEIEADTVIKATK-VDGVYSDDPVKNPDA--TLYRHLSYNE----I
PYRH_PSYIN      NPFFTTDSAACLRGIEIEADAVLKGTK-VDGVFDADPAKNPDA--KLYKEIDYQL----V
PYRH_ACTSZ      SPFFTTDSAACLRGIEIEADVVLKATK-VDGVYNCDPAKNPGA--ELFNTLTYAD----V
PYRH_HAEDU      SPFFTTDSAGCLRGIEIEADVVLKATK-VEGVYDKDPSKFNDA--KLYNTLTYAE----V
PYRH_HAES1      SPFFTTDSAACLRGIEIEADVVLKATK-VDGVYDCDPVKNPNA--VLYHKLSYAE----V
PYRH_HAEIN      NPFFTTDSTACLRGIEIEADVVLKATK-VDGVYDCDPAKNPDA--KLYKNLSYAE----V
PYRH_BLOPB      NPLFTTDSAACLRGIEIKADVVLKATK-VDGVFSTDPIQHPDA--TLYEQLSYQD----V
PYRH_BLOFL      NPFFTTDSAACLRGIEISANAVFKATK-VDGVFAHDPIQYPNHNIALYEQLSYQD----V
PYRH_BAUCH      NPFFTTDSAACLRGLEIGADVVLKATK-VDGVFSADPKIDPDA--ILYDQLNYKD----I
PYRH_BUCAI      NPFFTTDSAACLRGIETESDIILKGTK-VDGVYSKDPNKDSHA--FLYRRLTYKD----V
PYRH_BUCAP      NPLFTTDSAACLRGIEIKSDIILKGTK-VDGVYSKDPKKYSQA--VFYKRLTYKD----V
PYRH_BUCBP      NPFFTTDSAACLRAIEMRADIVLKGTK-VNGVYSSDPKKSSNS--ILYKNISYNE----V
PYRH_WIGBR      HTLFTTDSAACLKAIEIDANLLLKITN-VDGVFSEDPAKNPNA--TLYKKISYDY----A
PYRH_BUCCC      IPFFTTDSAACIYGTEIKANILLKATK-VDGVYSSDPILNKSA--ILYKNLSYKD----I
PYRH_RUTMC      SPCFTTDTGAALRAIEIDADAVFKATK-VDGIYTSDPIKNSDA--KRYDSLSFDG----A
PYRH_VESOH      NPCFTTDTGAALRAIEIGADAIFKATK-VDGIYTDDPVKNPNA--KRYNSLSFDE----A
PYRH_HYDCU      SPFFTTDTAAALRGIEIDADIVLKATK-VDGIYTADPAKDSSA--QRLAELTYDD----V
PYRH_PSEU5      NPFFTTDSAACLRAIEIQADVVLKATK-VDGVYTADPFKDPNA--EKFAELTYDE----V
PYRH_PSEPF      NPFFTTDSAACLRAIEIDADVVLKATK-VDGVYTADPFKDPHA--EKFDHLTYDE----V
PYRH_SACD2      NPFFTTDSAACLRGIEVNAELVLKATK-VDGVYSADPMKDPTA--VRYSKLTYEK----V
PYRH_HAHCH      NPFFTTDSAACLRGIEIDADVVLKATK-VDGVYSDDPMKVADA--VKYDRLTYDE----V
PYRH_MARHV      NPFFTTDSAACLRGIEIEADAVLKATK-VDGVYSADPHLDPTA--VKYDHLTYDE----V
PYRH_CHRSD      NPFFTTDSAACLRGIEIDANVVLKATK-VDGVYDKDPVKHADA--AKYERLTYDD----V
PYRH_ALCBS      NPFFTTDSAACLRGIEISADVVLKATK-VDGVYNDDPVKNPDA--VKYDALTYDE----V
PYRH_PSYWF      NPFFTTDTAACLRGIEIEAGVILKATK-VDGVYDKDPSEHADA--KKYDALTFDE----V
PYRH_ACIBT      NPFFTTDTAACLRGIEIEANLILKATK-VDGVYNKDPSKYEDA--VKYDHLTFDQ----V
PYRH_LEGPA      NPFFTTDTAACLRAIEIGADIVLKATK-VDGVYSADPLKNPDA--KRYDYLTYKE----V
PYRH_COXBU      NPLVTTDSAASLRGIEINADVVLKATN-VDGVYSDDPAKNPQA--KLYKHLSYQE----A
PYRH_HELAH      NPFFTTDTAATLRAIEIGSDLIIKATK-VDGIYDKDPNKFKDA--KKLDTLSYND----A
PYRH_WOLSU      NPFFTTDTAATLRAIEIGANMIIKATK-VDGVYDKDPNKFSDA--KKLDTLSYEE----A
PYRH_HELHP      NPFFTTDSAATLRAVEIGADVIIKATK-VDGVYDKDPHKFSDA--KMLESISYDE----A
PYRH_CAMC1      NPFFTTDTAATLRAIEIGSDMIIKATK-VDGVYDKDPKKFKDA--KLLKSLNYEK----A
PYRH_CAMC5      NPFFTTDTAATLRAIEIGSDMIIKATK-VDGVYDKDPNKFKDA--KLLKSLSYEK----A
PYRH_CAMFF      NPFFTTDTAATLRAIEIDANMIIKATK-VNGVYDRDPMKFEDA--VLLNEISYER----A
PYRH_CAMJD      NPYFTTDTTAILRAVEIDADMVIKATK-VNGVYDKDPKQFDDA--VFLNTLSYDE----A
PYRH_CAMHC      NPFFTTDTAATLRAIEIESDMIIKATK-VNGVYDKDPNKFEEA--VLLNSLTYDE----A
PYRH_SULNB      NPYFTTDTAATLRASEIEAELLIKATK-VDGVYDKDPNKFDDA--VKLDTLTYEQ----A
PYRH_SULDN      NPFFTTDTAATLRAVEIGAEVIIKATK-VDGVYDKDPNKFSDA--IKLQELSYEQ----A
PYRH_ARCB4      NPYFTTDTGATLRATEIGASMLIKATK-VNGVYDKDPMKYPDA--QKLETLSYDR----A
PYRH_NITSB      NPFFTTDTAATLRAVEIGANMIIKATK-VDGVYDKDPHKYPDA--KKLDRLTYDE----A
PYRH_DESPS      NPYFTTDSAGVLRALEIDADIVVKATK-VDGVYDKDPMIHDDA--VKFEHLTYDD----V
PYRH_DESVV      NPYFTTDTAAALRGMELKCEAIIKATK-VDGVYDKDPMKHDDA--VLFPRLTYVE----T
PYRH_DESAG      NPYFTTDTAAALRGMELKCDVIIKATK-VDGVYDKDPMQHDDA--VMYRQLSYIE----V
PYRH_LAWIP      NPYFTTDTAAALRCMELKCDALIKATR-VDGVYDKDPLKFDDA--EMFKHLTYEE----T
PYRH_PARL1      NPFFTTDTAAALRAVEMGCDALLKGTQ-VDGVYSADPHKVANA--ERYDRLTYMD----V
PYRH_MARMM      NPFFTTDTAAALRAAEMGCDALLKGTQ-VDGVYSDDPRTNPDA--ERFDQLDYLD----V
PYRH_CAUVC      NPFFTTDTAAALRAAEMQCDALFKGTS-VDGVYTADPKKDPTA--QRYDRLSYMD----V
PYRH_SPHAL      APYFTTDSGAALRAAEMKCDALLKGTS-VDGVYNADPKQDANA--VRYDRLSYDR----V
PYRH_NOVAD      APYFTTDSGAALRAAEMKCDALLKGTS-VDGVYNADPKKDPAA--KRYETVDYDT----V
PYRH_ERYLH      APYFTTDSGAALRAAEMNCDALLKGTS-VDGVYDSDPKTNPDA--KRYDTVGYGK----V
PYRH_ZYMMO      NPFFTTDSGAALRAAEMKCDALFKGTS-VDGVYDADPKKVKEA--RRYDCVSFNR----V
PYRH_SPHWW      NPYFTTDSAAALRAAEMGCDALFKGTS-VDGVYNADPKKDPTA--IRYETVTFNR----V
PYRH_HYPNA      NPFFTTDTGAALRAIEMNCDALLKGTQ-VDGVYTADPKLDATA--TRYHQVAYQE----I
PYRH_MAGSA      NPFFTTDTAAALRAVEMGCDALLKATQ-VDGVYSADPKKVKDA--VRYDRLTFNE----V
PYRH_RHORT      NPFFTTDTAAALRAVEMNCDAILKATQ-VDGVYSADPNKVPDA--VRFESLTFTD----V
PYRH_GRABC      NPFFTTDTAAALRAAEMGCNVLLKGTQ-VDGVYAADPRKNPDA--ERYNELTYLD----V
PYRH_ACICJ      NPFFTTDTAAALRAVEMKCDVLLKGTQ-VDGVYSADPRKVADA--ERYAELTYHE----V
PYRH_GLUOX      NPFFTTDTAAALRANEMECDALFKGTQ-VDGVYSADPRRNPDA--ERYDQLTYLE----V
PYRH_RICBR      NPFCTTDSAAVLRAIEMNCDVLLKATQ-VDGVYDSDPKKNPNA--KKYFTINYKD----V
PYRH_RICAH      NPFCTTDSAAVLRAIEMNCDMLLKATQ-VDGVYDADPKKNPDA--KKYCTINYKD----V
PYRH_WOLPM      NPFFTTDTAAALRAVEMNCDVILKGTQ-VNGVYSADPKKNEDA--VMYDRLSYTD----L
PYRH_WOLTR      NPFFTTDTAAALRAVETNCDAILKGTQ-VNGVYSADPKKNEDA--VMYDRLSYMD----L
PYRH_EHRCJ      NPFFTTDTAAALRGIEMGCDAIFKGTQ-VDGVYSADPKKTVDA--VRYDRISYRD----L
PYRH_EHRRW      NPFFTTDTAAALRGIEMGCNVIFKGTQ-VDGVYSADPKKVADA--VRYDKISYRE----L
PYRH_ANAMM      SPFFTTDTAAALRGIEMRCDAIFKGTQ-VDGVYSSDPKKDGSA--VRYDRISYHD----L
PYRH_ANAPZ      SPFFTTDTAAVLRSIEMRCDAIFKGTQ-VDGVYSSDPKKDCSA--TRYDKISYHD----L
PYRH_NEOSM      NPFFTTDTAAVLRSVEMGCDVMLKGTL-VDGIYSDDPRTNINA--ERITKLSYTD----V
PYRH_RHOS4      NPYFTTDTAATLRANEMACQAIFKGTK-VDGVYDKDPRKFADA--KRYETVSYDE----C
PYRH_ROSDO      NPYFTTDTAATLRANEMSCEAIFKGTK-VDGVYDKDPAKFADA--KRYDTVTYDD----V
PYRH_PARZE      NPYFTTDTAATLRASEMNCEAIFKGTK-VDGVYDKDPVKHADA--KRYGDVSYDE----V
PYRH_PARDP      NPYFTTDTAATLRANEMNCEAIFKGTK-VDGVYDKDPNKFPDA--KRYDDVTYDE----V
PYRH_JANSC      NPYFTTDTAATLRASEMDCEAIFKGTK-VDGVYDKDPAKHADA--KRYETVTYDE----V
PYRH_RUEST      NPYFTTDTAATLRANEMNCEAIFMGKNGVDGVYDKDPKTNEDA--KRYDSVSYDD----V
PYRH_RUEPO      NPYFTTDTAATLRANEMACEAIFMGKNGVDGVYDKDPALHDDA--VRYDEISYDE----V
PYRH_AQUAE      NPFFSTDTAAALRAAEIGAEVLIKATK-VGGIYDKDPEKYPDA--VLIKEISYLE----V
PYRH_SYNFM      LPFFTTDTTAALRAIEMGAEVLMKATK-VDGIYASDPKKNPSA--LRYDRISFSE----V
PYRH_SYNP6      NPFFTTDTTAALRAAEINADVVFKATK-VDGVYDSDPKLNPQA--RRFTTLNYNY----V
PYRH_SYNY3      NPFFTTDTTAALRAAEIDAEVVFKATK-VDGVYDSDPKTNPNA--RRFTTLTYSH----V
PYRH_THEEB      NPFFTTDTTAALRAAEIDAEVIFKATK-VDGVYDADPHTHPNA--RRYRSLTYTH----A
PYRH_NOSS1      NPFFTTDTTAALRAAEIDAEVIFKATK-VDGVYDADPEIYPNA--KRYNSLTYAH----V
PYRH_TRIEI      NPFFTTDTTAALRAAEIEAEVIFKATK-VDGVYDSDPHKNQEA--KRYESLSYGE----V
PYRH_SYNJA      NPFFTTDTTAALRAAEIDAEVIFKATK-VDGVYDADPKTHPQA--RRYDVLSYQD----V
PYRH_SYNPW      NPFFTTDTTAALRAAEISADVVFKATK-VDGVYDKDPHKYADA--VRYDTLTFQQ----V
PYRH_SYNS9      NPFFTTDTTAALRAAEINADVVFKATK-VDGVYDKDPAKHPDA--VKHDHLSYQD----V
PYRH_SYNR3      NPFFTTDTTAALRAAEINAHVVLKATK-VDGVYDKDPVRFPDA--VRYEHLTFQD----V
PYRH_PROM1      NPFFTTDTTAALRAAEINAEVVFKATK-VDGVYDRDPKKFTDA--VKYDNLTFQD----V
PYRH_PROMA      NPFFTTDTTSALRAAEINADVIFKATK-VDGVYNQDPKEYPEA--IKYESLTFQE----V
PYRH_PROM9      NPFFTTDTTAALRAAEINAEVVMKATK-VDGVYNCDPNKFQDA--KKYTNLSYQQ----V
PYRH_GLOVI      NPFFTTDTTAALRAAEIDAQVIFKATR-VDGIYDSDPKFNPQA--VRFEKITFHE----V
PYRH_BACLD      NPYFSTDTTAALRAAEIEADVILMAKNNVDGVYNADPRTDETA--VKYEKLSYLD----V
PYRH_BACAN      NPYFSTDTTAALRAAEIEADVILMAKNNVDGVYNADPSIDPTA--TKYETLTYLD----V
PYRH_GEOTN      NPYFSTDTTAALRAAEIEADVILMAKNNVDGVYSADPNIDASA--VKYDELSYLD----V
PYRH_BACHD      NPYFSTDTTAALRAAEIEAEVILMAKNKVDGVYNAEPSVDVNA--KKYTSISYLD----V
PYRH_BACSK      NPYFSTDTTAALRAAEIEAEVILMAKNNVDGVYNADPRVDDKA--QKFDTITYMD----V
PYRH_OCEIH      NPYFSTDTTAALRAAEIEAEVILMAKNNVDGVYTDDPKLNKSA--KKYESLTYLE----M
PYRH_LISMF      NPYFSTDTAAALRAAEIEADVILMAKNNVDGVYNADPKLDENA--KKYEELSYLD----V
PYRH_STAS1      NPYFSTDTTAALRAAEVEADVILMGKNNVDGVYSADPKVDPNA--IKYEHLTHIQ----M
PYRH_LACJO      NPYFSTDTTAALRAAEINADVILMAKNGVDGVYSADPKVDPNA--KKYSELTQLD----L
PYRH_LACH4      NPYFSTDTTAALRAAEIGADVILMAKNGVDGVYSADPKTDPTA--TKFTELTQLD----L
PYRH_LACDB      NPYFSTDTTAALRAAEINADVILMAKNGVDGVYTADPNLDPSA--KKFAELTQLD----M
PYRH_LACPL      SPYFSTDTTAALRAAEINADAILMAKNGVDGVYSADPNKDASA--VKFDTLTHLD----I
PYRH_LACBA      SPYFSTDTTAALRAAEINADAILMAKNGVDGIYSADPKKDPAA--VKFDQLTQLD----I
PYRH_PEDPA      SPYFSTDTTSALRAAEIGAEAILMAKNGVDGIYSADPNVDPDA--VKFDELTHMD----I
PYRH_LACRE      SPYFSTDTTAALRAAEINADAILMGKNGVDGVYNADPNKDASA--VKFDHLTHMD----L
PYRH_LACS1      SPYFSTDTTAALRASELNAEVILMAKNGVDGIYNADPKVDPTA--KKYTKLTHMD----I
PYRH_LACP3      NPYFSTDTTAALRAAEIGADVILMAKNNVDGVYSADPNKDTHA--VKYESLTHMD----I
PYRH_LACSS      NPYFSTDTTAALRAAEIDADVILMAKNNVDGVYSADPNTDPSA--VKFDTLTHLD----I
PYRH_ENTFA      NPYFSTDTTAALRAAEVDADVILMAKNNVDGVYSADPRVDETA--TKFEELTHLD----V
PYRH_LACLM      SPYFSTDTTSALRAAEINADVILMAKNGVDGVYNADPKLVADA--IKFEHLTHMD----V
PYRH_STRS2      SPYFSTDTTAALRAAEIEADAILMAKNGVDGVYNADPKKDANA--VKFNELTHRE----V
PYRH_STRA3      SPYFSTDTTAALRAAEIEAEAILMAKNGVDGVYNADPKKDANA--VKFDELTHVE----V
PYRH_STRT2      SPYFSTDTTAALRAAEIESDAILMAKNGVDGVYNDDPRKNADA--VKFDKLTHVE----V
PYRH_STRGC      SPYFSTDTTAALRAAEIEADAILMAKNGVDGVYNADPKKDKTA--VKFDELTHRD----V
PYRH_STRMU      SPYFSTDTTSALRAAEIEADAILMAKNGVDGVYNDDPRKNADA--IKFNELTHME----V
PYRH_LEUMM      SPYFSTDTTAALRANEINADAILMGKNGVDGIYDSDPNKNANA--VKFTELTHLD----I
PYRH_OENOB      SPYFSTDTTAALRAAEINADAILMGKNGVDGVYDSDPRKNNEA--IKFAELTYDE----V
PYRH_ONYPE      SPYFSTDTAAALRAAELNIDVILMAKNNIEGVYNKDPKKHQDA--VLIKHMKHQQ----I
PYRH_SYMTH      NPYFTTDTAAALRAAEIEAEAILMGKQGVQGVYDSDPRINRHA--VKYDEVTYQE----V
PYRH_CARHZ      NPYFSTDTTAALRAAEIEAEVILMAKR-VDGVYDSDPLKNPNA--QKFDELEYIE----V
PYRH_DESRM      NPYFSTDTTAALRAAEVEAEIILMAKQ-VDGVYDADPLKHPGA--KRFDELTYID----V
PYRH_MOOTA      NPYFSTDTTAALRAAELEADVILMAKR-VDGVYDSDPEINPEA--KRLKDLDYLT----V
PYRH_SYNWW      NPYFSTDTAAALRSAEIEAEVILMAKK-VDGVYDADPVKNPAA--LKFDRLNYID----V
PYRH_DESHY      NPYFSTDTTAALRAAEIEAEAILMAKR-VDGVYDSDPLKNPEA--KKYDRLTFLD----V
PYRH_CALS4      NPFFSTDTAASLRAAEIDAEVILLAKK-VDGVYDKDPLKHKDA--VKFKELSYLD----V
PYRH_HUNT2      NPFFSTDTTAALRAAEIDAEVILLAKK-VDGVYDSDPNINPNA--KKFDKLSFMD----V
PYRH_CLOPS      NPYFSTDTAAALRAAEIEADVILLAKK-VDGVYDKDPHKYDDA--KKYDELSYIE----V
PYRH_CLOBL      NPYFSTDTAAALRAAEIEADVILLAKK-VDGVYDKDPHKYDDA--KKYNKLSYIE----V
PYRH_CLONN      NPYFSTDTTAALRAAEIEADAILLAKK-VDGVYDKDPNKYDDA--KKFDKLTYIE----V
PYRH_CLOAB      NPYFSTDTTAALRAAEIEADVILLAKK-VDGVYDKDPHKYDDA--IKFDNLTYME----V
PYRH_CLOTE      NPYFSTDTTAALRAAEIEADIILLAKK-VDGVYDKDPHKHEKA--QKFETLTYID----V
PYRH_ALKOO      NPYFSTDTTAALRAAEIEADVILLAKN-VDGVYSADPSIDKTA--TKFNELTYID----V
PYRH_ALKMQ      NPYFSTDTTAALRAAEIEAEVILLAKN-VDGVYDSDPNINPNA--QKLQELTYLD----V
PYRH_CLOD6      NPYFTTDTTAALRAAEMEAEVILLAKN-VDAVYDKDPKVHADA--KKFTELSYME----V
PYRH_CALS8      NPFFSTDTAAALRAAEIDAEAILLAKK-VDGVYDSDPKKNPNA--KKYDFITYLD----V
PYRH_MYCSJ      LPYFSTDTTAAQRALEIGAEVVLMAK-AVDGVYTADPRKDPDA--QLLTAITHRE----V
PYRH_MYCS2      LPYFSTDTTAAQRALEIGAEVVLMAK-AVDGVFTDDPRTNPDA--ELITAISHRE----V
PYRH_MYCPA      LPYFSTDTTAAQRALEIGAEVVLMAK-AVDGVFSADPRQYPEA--ELITAISHRE----V
PYRH_MYCLE      LPYFSTDTTAAQRALEIGADVVLMAK-AVDGVFVEDPRVNPEA--ELLTAISHRE----V
PYRH_MYCBO      LPYFSTDTTAAQRALEIGADVVLMAK-AVDGVFAEDPRVNPEA--ELLTAVSHRE----V
PYRH_NOCFA      MPYFSTDTTAAQRALEIGADVVLMAK-AVDGVFDADPRVVQTA--TMYTEITHKE----V
PYRH_RHOJR      MPYFSTDTTAAQRALEIGAEVVLMAK-AVDGVFTADPNLDPTA--TMYAQITHRE----V
PYRH_CORDI      MPYFSTDTTAAQRALEIDCEVLLMAK-AVDGVYDDDPRTNPDA--QLFHQITPRE----V
PYRH_CORJK      MPYFSTDTTAAQRALEIGCEVLLMAK-AVDGVYSDDPRTNPEA--ELFHEITPRE----V
PYRH_COREF      MPYFSTDTTAAQRALEIGCDVLLMAK-AVDGVYSADPRTNPDA--ELFTEITPKE----V
PYRH_SACEN      MPYFSTDTTAAQRALEIGCEVVLMAK-GVDGVYTADPKTTPSA--TLFETITHRE----V
PYRH_ACIC1      APYFSTDTTAAQRALEIGAEVVLMAK-AVDGVYDSDPKTNADA--VRFDHLDYDE----V
PYRH_STRCO      MPYFSTDTTAAQRALEIDAEALLMGKNGVDGVYDSDPKTNPDA--VKFDALGYGE----V
PYRH_CUTAK      MPYFSTDTVAAQRALEIGADALLMGKQGVDGVYDSDPKTNPNA--HKFDELTYDE----F
PYRH_NOCSJ      MPFFSTDTVAVQRALESRCDVVLVAKNGVDGVYTADPHKDPTA--TKFDDLTYDE----A
PYRH_CLAM3      LPYFSTDTVAAQRALEIQAVEVLVAKNGVDGVYTGDPRTDPSA--TLLDTVTYQD----A
PYRH_LEIXX      LPYFSTDTVAAQRALEIIADVVLVAKNGVDGMYDDDPRTNPDA--RKIDQISHQE----A
PYRH_PAEAT      LPYFSTDTVAAQRALEVHADVVLMAKSGVDGVYTADPKKDPTA--EKLDVLSYDD----A
PYRH_TROW8      MPYFSTDTVAVQRALEIKADIVLIAKNGVDGVYTDDPQINPNA--KKIYKITYRE----A
PYRH_BIFAA      MPYFSTDTVSIQRSLEIHCDEVLMGKNGVDGVYTADPRKDENA--KRFATLSYNR----A
PYRH_THEFY      APFFSTDTAAAQRALEIGAQAVLKGT-QVDGVYDSDPRKNPAA--VRFDRLDYNE----V
PYRH_DEHM1      NPYMTTDTAAALRAIEIEADVLLMAKNKVDGVYTADPKKHPEA--TLFQHLTHME----A
PYRH_LEPIC      NPYFTTDTTASLRAVEVGCDVILKA-TKVDGVYTADPKKDNGA--KRYSQISFME----S
PYRH_DEIRA      APFFTTDTTSTLRALEIGADVVLMAKNAVDGVYDSDPRKNPDA--KRYEQLTHMD----V
PYRH_DEIGD      APFFTTDTTATLRALEIGADVVLMAKNKVDGVYDSDPRKNPDA--RRLDSLTHIE----V
PYRH_THET2      NPFFSTDTAAALRALEVGAEVVLMAKNKVDGVYSDDPRKNPEA--VRFDELTYLE----V
PYRH_RUBXD      NPFFTTDTGAALRALEINADALLMAKNRVDGIYDKDPRVHGDA--RIVPRLDYME----L
PYRH_ROSS1      NPYFTTDSAAALRAAEVHAEVILMAKNGVDGVYSADPRRYPDA--KRFEYISYME----A
PYRH_RHOBA      SPFVTTDTAAAQRALEIEADVILKATR-VDGVYSDDPEKNPHA--VLYEQLSYNE----V
PYRH_GEOSL      NPYFTTDTAASLRAMEIGADVILKGTK-VDGVYSADPKKDPTA--IKYPRLTYLE----V
PYRH_PELPD      NPYFTTDTAASLRAMEISAQAILKGTK-VDGVYTADPKKDATA--TKLPRLAYID----V
PYRH_PELCD      NPYFTTDTAASLRAMEIDADVILKATK-VDGVYSADPCKDKNA--VKFDNLKYLD----V
PYRH_BDEBA      NPFFTTDTAASLRAMEINAQVIMKATK-VDGIYDKDPAKHADA--KKFDKISYID----V
PYRH_ANADF      NPYFTTDTAASLRAMEIHADVLLKATK-VDGVYTDDPKKNPAA--TKFKQLSYID----V
PYRH_MYXXD      NPYFTTDTAASLRAMEINAQVILKATK-VDGVYSADPKKDPTA--RRYRSLTYMD----V
PYRH_KORVE      NPYFSTDTAASLRAAEIKADVIMKATK-VDGIYDADPHKVADA--TMFAQITYMD----V
PYRH_SYNAS      NPYFTTDTAAVLRAMEIKADVIMKATK-VDGVYDKDPVAYSDA--VMYKNITYSD----V
PYRH_SOLUE      NPYFSTDTAATLRALEIKADVIAKATR-VDGVYDKDPLKHPDA--VKFPEISYLE----V
PYRH_CHLPD      NPYFTTDTAASLRAIEIEAELIVKGTR-VNGVYDSDPEKNPDA--VFYPKISYQD----V
PYRH_PELLD      NPYFTTDTAASLRAIEIEADVIVKGTR-VDGVYDSDPETNPSA--EFFPKISYLD----V
PYRH_CHLCH      NPYFTTDTAASLRAIEIEADIIVKGTR-VDGIYDSDPEKNANA--QFFPDISYLD----V
PYRH_CHLTE      NPYFTTDTAASLRAIEIEADVIVKGTR-VEGVYDSDPEKNPNA--EFFPKISYVD----V
PYRH_SALRD      NPYFTTDTAAALRGLEIDADVILKGTR-VDGIFTADPEEDASA--ERFKQIHGQE----V
PYRH_GRAFK      NPYFTTDSAAVLRAIEIKADVILKGTR-VDGIYTSDPEKNKEA--TKFDFITFED----V
PYRH_FLAPJ      NPYFTTDTAAVLRGVEVDADVILKGTR-VDGIYNVDPEKNKDA--VKFDNISFED----V
PYRH_CYTH3      NPYFTTDTAASLRAIEIEAEVVLKGTR-VDGVYTADPEKDPTA--TRYTTITFDE----A
PYRH_BACV8      NPFFTTDTGSSLRGIEIEADVMLKGTR-VDGIYTADPEKDPTA--TKFDDITYDE----V
PYRH_PARD8      NPFFTTDTGSSLRGIEIEADVMLKGTR-VDGIYTADPEKDPTA--TKFSDITYDE----I
PYRH_PORGI      NPFFTTDTGSSLRGIEIEADAMLKGTR-VDGIYTADPEKDPSA--TKFDRITYDE----I
PYRH_FUSNN      NPYFTTDTAAALRAIEMETDVVIKATK-VDGIYDKDPVKYPDA--KKYQTVTYNE----V
PYRH_ALKEH      NPFFTTDSAASLRAIEVGADIMLKGTK-VDGVYSADPTRDPDA--RRYELLTYDQ----V
PYRH_HALHL      NPFFTTDSAASLRAVEVGAELLLKGTK-VDGVYSSDPVRDPEA--KRYQQLTYDE----V
PYRH_METCA      NPFFTTDSAASLRAIEIGADLLIKATK-VDGVYSADPVKNPEA--KFYTRLTYDE----A
PYRH_XANC8      NPFFTTDSGAALRAIEIGADLLLKATK-VDGVYDKDPKKHSDA--VRYDSLTYDE----V
PYRH_XYLFT      NPFFTTDSGAALRAIEIGADLLLKATK-VDGIYNKDPQKHCDA--VKYSTLSYDE----V
PYRH_NITOC      NPFFTTDTAASLRAIEIGAELLIKATK-VDGVYSADPLVNSDA--QFISRLSYDQ----V
PYRH_DICNV      NPFFTTDSAASLRAIELEVDAMFKATK-VDGIYTKDPNRYDDA--VKYHDLSYQK----A
PYRH_METFK      NPFFTTDTAAALRGMEINAEIVLKATK-VDGVYTDDPKRNPEA--MRYKTLTFDE----A
PYRH_NITMU      NPFFTTDTAAALRGMEMNVDIVLKATK-VDGVYTTDPKINPDA--ERYQRLSFDT----A
PYRH_CHRVO      NPFFTTDTAAALRGMEMNVDIMLKATK-VDGVYTDDPKKNPDA--VRYQSVTFDE----A
PYRH_NITEU      NPFFTTDTAAALRGMEMNANIVLKATK-VDGIYTSDPLKNKDA--QRFQSLTFDE----A
PYRH_POLNA      NPFFTTDTAAALRGAEIGAEIVLKATK-VDGVYSADPKKDPEA--TRYTSITFDE----V
PYRH_METPP      NPFFTTDTAAALRGAEIGAQIVLKATK-VDGVYSADPKKDPGA--TRYAKISFDE----A
PYRH_VEREI      NPFFTTDTAAALRGAEIGAEVVLKATK-VDGVYTADPQKDPTA--TRYAKLSFDE----A
PYRH_RHOFT      NPFFTTDTAAALRGAEIGAEVVLKATK-VDGVYTADPKKDPQA--TRYSKISFDD----A
PYRH_HERAR      NPFFTTDTAAALRGAEIGAEIVLKATK-VDGVYSADPNKDPDA--TRYSTITFDE----A
PYRH_BORA1      NPFFTTDTAAALRGAEIGAEIVLKATK-VDGIYSADPNKDPTA--TRYARISFDE----A
PYRH_CUPNH      NPFFTTDTAAALRGSEIGAEVVLKATK-VDGVYTADPKKDPSA--TRYTTISFDE----A
PYRH_AROAE      NPFFTTDTAAALRGSEMAAQIVLKATK-VDGVYTADPKKDPQA--QRYHRISFDE----A
PYRH_DECAR      NPFFTTDTAAALRGSEIGAEIVLKATK-VDGIYSADPKKDPSA--TRYDKISFNE----A
PYRH_NEIMF      NPFFTTDTAAALRGAEMNCDVMLKATN-VDGVYTADPKKDSSA--TRYETITFDE----A
PYRH_THIDA      NPFFTTDTAAALRAAEIDADLLLKATK-VDGVYTADPNKDPDA--RRYDTLSFDE----A
PYRH_RHILO      NPFFTTDSAAALRAAEIGADALFKGTQ-VDGVYSADPKKDPNA--TRFERISHAE----V
PYRH_CHESB      NPFFTTDSAAALRAAEIGADALFKGTQ-VDGVYSADPRKDANA--VRYDHITHDQ----V
PYRH_OCHA4      NPFFTTDSAAALRAAEIEADALLKGTQ-VDGIYSADPKKDPNA--TRFDSLTHKE----V
PYRH_AGRFC      NPFFTTDSAAALRAAEMGAEAIFKGTQ-VDGIYSADPKKDPTA--TRFDELTHSE----V
PYRH_RHIEC      NPFFTTDSAAALRAAEMGAQAIFKGTQ-VDGIYTADPKKYPDA--TRFDRLTHQE----V
PYRH_BARBK      NPFFTTDSAATLRAAEIGADVLLKGTQ-VDGIYSADPKINSTA--KRFDQLTHVE----I
PYRH_NITHX      NPYFTTDTTAVLRAAEIGAQAVLKATN-VDGVYSSDPKKDPSA--TRFERLSHSQ----A
PYRH_RHOP5      NPFFTTDTTAVLRAAEIGAQAVLKATN-VDGVYSADPKKDPSA--QRFERLTHSQ----A
PYRH_BRASB      NPYFTTDTTAVLRAAEIGAQAVLKATN-VDGVYSADPKKDPAA--KRFDRLTHSQ----A
PYRH_BRADU      NPFFTTDTTAVLRAAEIGAQAVLKATN-VDGVYSADPKKDPTA--TRFDRLTHSQ----A
PYRH_RHOP2      NPFFTTDTTAVLRAAEIDAGAVLKATN-VDGVYTADPKRDPNA--KRFERLTHSE----A
PYRH_RHOPA      NPYFTTDTAAVLRAAEIGAGAVLKATN-VDGVYSADPKLDPNA--KRFEKLTHSE----A
PYRH_AZOC5      NPYFTTDTGAVLRAAELDCDAVLKATN-VDGVYTADPKTDPTA--TRYERITHDQ----A
PYRH_MAGMM      NPFFTTDTAAALRACEIEADLLLKATK-VDGVYDSDPVKNPKA--KRFETLTYHE----V
PYRH_PARUW      NPYFTTDTAAALRASEIQANLLLKATK-VDGIYNQDPLKNTQA--VKYDRISYSQ----V
PYRH_MYCPU      RPYFTTDTAATLFASEIGADAIIMGKNGVNGVYSDDPKKNKDA--KKFDTITYDE----V
PYRH_MYCS5      RPYFTTDTAATLFAAEIKAEVILMGKNKVDGVYDSDPKKNENA--KHFSKITYDQ----I
PYRH_MYCMO      RPFFTTDTAATLVASEMQCDVLLMAKNGVNGVYDADPKVSPSA--IKFDSLSYDELLHIV
PYRH_MYCH7      RPFFTTDSAATLFASEMGANIILVGKNNVNGIFDSDPKINPNA--LRYDKITYNQ----V
PYRH_MYCGE      NPYFSTDTALALRAVQTKAVAILIGKNGVDGVYTADPKKDKNA--TFLPTLNYDH----A
PYRH_MYCPN      NPYFSTDTAVALRATQMQADIILIGKNGVDGVYTADPKKDKHA--KFLASLTYAE----A
PYRH_MYCGA      NSHFTTDTATVLRAIQINAQLVLIGKDGVDGVYTDDPKKNKKA--KFIEQITYQQ----A
PYRH_UREPA      FPYFTTDSCAAIRAAETESSIILMGKNGVDGVYDSDPKINPNA--QFYEHITFNM----A
PYRH_MYCPE      RPYFTTDTGVAVSAAELGASYIMMGKNNVDGVYDSDPNKNPNA--KFYKHLTYSK----A
PYRH_MESFL      FSYFTTDTNSVIRAIEIGADAVLMAKNGVKGVYDSDPNLNPNA--KFYKKLTHRE----I
PYRH_MYCCT      YSYFTTDTNATIRAIEIGAEAILMAKNGVKGVYDKDPKQHKDA--KFIKKISHQE----I
                 .  :**        :     :      : .::  :*             :         

PYRH_FRACC      ISRGLRVMDQSAFILARDFGMPLHIFDIE--QRGAMTAICRGE--HRGTVISSSPEKSEE
PYRH_ORITB      LINQLNIMDHSAVLLAKQHNLPIHIFNFD--QELAAKNICLGK--NIGTYISSNTKM--Q
PYRH_CHLFF      LSRGLGIMDASAISLCMDSHIPIRVFSFV--KH-SLEQAIFDE--HIGTLICEDA-----
PYRH_CHLPN      LSNQLGVMDASAISLCMDSHIPIRVFSFL--QH-SLEKALFDP--TIGTLVSEDVNHVCS
PYRH_CHLMU      LSQGLGAIDPSAVSLCMEAGIPIRMFSFT--KH-SLEEAIFN---TVGTVISSTEGGQL-
PYRH_FERNB      IEKNLKIMDTEAFSICKRYNMKILVMNFF-ENGN-LLKAIKGE--NVGTLVVPKV-----
PYRH_THEM4      IDKGLKIMDTEAFSICKRYDMKILVMDFF-KESN-LLSAVREE--NVGTLVVPK------
PYRH_PSELT      ISRGLKVMDMEAFSICGRYKLPIVILNFF-EDGS-LLRAVRGE--DVGSIIMPD------
PYRH_THEMA      MKMGLKVMDAEAFALCKKLGITVKVINFF-EPGT-LLKALKGE--DVGSTVVPD------
PYRH_FRATF      VSKELNVMDLGAFTQCRDFSIPIYVFDLT-QPNA-LVDAVLDS--KYGTWVTLD------
PYRH_ECOLI      LEKELKVMDLAAFTLARDHKLPIRVFNMN-KPGA-LRRVVMGE--KEGTLITE-------
PYRH_PHOLL      LERELKVMDLAAFTLARDHSLPIRVFNMN-KPGA-LRRVVMGE--NEGTLIFHE------
PYRH_ALIF1      LEKELKVMDLAAFTLARDHNMPIRVFNMN-KPGA-LRRVVMGE--TEGTLISNAE-----
PYRH_PHOPR      LEKELKVMDLAAFTLARDHKMPIRVFNMT-KPGS-LRRVVMGE--QEGTLIS--------
PYRH_AERHH      LEKELKVMDLAAFTLARDHDLPIRVFNMN-KPGA-LRRVIMGE--PEGTLIHHVSK----
PYRH_SHELP      LEKELKVMDLAAFTLARDHDMPILVFNMN-KPGA-LRRVIMGD--HEGTLIRSSRKTAE-
PYRH_IDILO      LEKQLKVMDLAAFTLARDHALPIRVFNMN-KPGA-LRAVIMGE--EEGTLIS---KNAE-
PYRH_COLP3      LDKELKVMDLAAFTLARDHNIPIRVFNMN-KPGA-LKSVIMGN--TEGTVISHKKRTET-
PYRH_PSEA6      LDKELKVMDLAAFTLARDHNIPIRVFNMN-TPGC-LRAVVLGE--DVGTVICHPEKQDN-
PYRH_PSEHT      IEKELKVMDLAAFTLARDHNMPLSVFNMN-KSGA-LKRVIMGE--EEGTLISSQASDEVI
PYRH_PSYIN      LEKELKVMDLAAFTLARDHSLPIRVFNMN-KPGA-LNRVVLGE--DEGTTIKHCETIIEK
PYRH_ACTSZ      IERELKVMDLAAFTLARDHGMPIRVFNMG-KPGA-LREVVTGL--TEGTIIS--------
PYRH_HAEDU      IDQELKVMDLAAFTLARDHNMPIRVFNMG-KPGA-LREVVMGT--TEGTTIS--------
PYRH_HAES1      IEKELQVMDLAAFTLARDHNMPIRVFNMS-KTGA-LRNVILGK--TEGTLICD-------
PYRH_HAEIN      IDKELKVMDLSAFTLARDHGMPIRVFNMG-KPGA-LRQVVTGT--EEGTTIC--------
PYRH_BLOPB      LERELKVMDLTAFTLAREHNLPIRIFNIN-KLGA-LKRIIMGY--KEGTLITK-------
PYRH_BLOFL      LQRELKVMDLTAFALARDHNLPIHIFNIN-KVGA-LKRIIMGY--REGTVITK-------
PYRH_BAUCH      LKQELKIMDLTALTLAHDNHLPIRVFNIN-KPGA-LWRVVMGK--KEGTLIYTPKINKVN
PYRH_BUCAI      LKKELKIMDLAAFTLARDYHMPIRVFNIH-TPGS-LYRIIMGD--DEGTLITR-------
PYRH_BUCAP      IQKELKVMDLSAFSLARDHNLPIRVFNIN-KPKS-LYRIVKGY--DEGTLIK--------
PYRH_BUCBP      LQKELKVMDLAAFALARDHKLPICIFNIN-KPNA-LYYIVTGQ--KEGTLIR--------
PYRH_WIGBR      LKKNLKIMDFTAFAIAKEHKLPIRIFNIK-EPNS-LYKAIIGK--DIGTLIN--------
PYRH_BUCCC      LRKELKVMDYTSLILAYENKLPILVFNMY-DPEI-LYKIIIEKS-NIGTLIK--------
PYRH_RUTMC      IEKNLQIMDVSAFALCREHDLEICVFSML-ENTN-TLSDILKGK-PLGTIVRK-------
PYRH_VESOH      IEKNLQIMDVSAFALCRKHDLEICVFSML-ENTN-TLSDLLKGK-LLGTIVRK-------
PYRH_HYDCU      IQKNLQVMDMTAFVLCRDHKMPIRVFDMF-KKDA-VIR-IVKGE-DEGTLVH--------
PYRH_PSEU5      LDRKLGVMDLTAICLCRDHSMPLRVFNMN-KPGA-LLNIVLGG--AEGTLIE--ESNE--
PYRH_PSEPF      LDRKLGVMDLTAICLCRDHKMPLRVFNMN-KPGA-LLNIVHGG--AEGTLIE--EVQQ--
PYRH_SACD2      LTEQLGVMDLTAICLCQDHNMPVRVFQMD-KQGA-LLNIVVGG--DEGTLIQGKETEEA-
PYRH_HAHCH      LERKLGVMDLTAICLCRDHGMPVRVFDMN-KASA-LINIVVGM--EEGTLIERG------
PYRH_MARHV      LDKKLGVMDLTAICLARDHGMPLRVFDMN-RPGV-LTRIVTGE--REGTLIE--------
PYRH_CHRSD      LDQKLGVMDLTAICLVRDHDMPVRVFDMT-KPGA-LLNLVVGG--KEGTLVDRG------
PYRH_ALCBS      LEKKLGVMDLTAICLCRDHSMPLRVFDMN-KKGA-LLNLMLGG--KEGTLVEAAQ-----
PYRH_PSYWF      LEQKLGVMDLTAIALCREHNVPLQVFDMN-KPNS-LLNVIMGE--NEGTRVFH-------
PYRH_ACIBT      LDEKLGVMDLTAICLCRDHNVPLQVFDMN-KSGA-LLSVVMGE--KEGTRVTK-------
PYRH_LEGPA      LTKGLEVMDSTAICLCQDQGMPLQVFDMA-APNA-LKRIVTGE--QVGTIVGANHDQ---
PYRH_COXBU      LKKELAVMDLAAFCQCRDYNMPLRVFNIN-KPGA-LLSVIMNQ--EEGTLVDQGQ-----
PYRH_HELAH      LIGDIEVMDDTAISLAKDNKLPIVVCNMF-KKGN-LLQVIKHQ-QGVFSMVK--------
PYRH_WOLSU      LDDRIKVMDDTAIALAKDNRLPIVVCNMF-KPGN-LLKIIQGD-NGLCSVVGQRQ-----
PYRH_HELHP      LRDHIKVMDDTAIALAKDNKLPILVCNMF-REGN-LLDLLKYK-KGICSIVK--------
PYRH_CAMC1      MSDDIKVMDDTAIALAKDNALPILVCNMF-KAGN-LLKIINEEEAALYSVVK--------
PYRH_CAMC5      MSDDIKVMDDTAIALAKDNSLPILVCNMF-KQGN-LLKIISEDAKALYSIVK--------
PYRH_CAMFF      MEDNIKVMDDTAIALAKDNKLPIVVCNMF-EEGN-LLKIANGD-YTNCSVVKN-------
PYRH_CAMJD      MQDNIKVMDDTAIALAKDNKLPIVVCNMF-EEGN-LLKIIQGD-TSLCSIVKNN------
PYRH_CAMHC      LKDNIKVMDDTAIALAKDNHLPIVVCNMF-KSGN-LCKIADDD-LSFCSIVK--------
PYRH_SULNB      LTKDIKVMDDTSIALARENSLPIVVCNMF-EEGN-LLAIMK-GDMSLCSIVK--------
PYRH_SULDN      LNDNIKVMDDTSIALAKDNSLPILVCDMF-KKGN-LLDILQNGNMKNCSIVK--------
PYRH_ARCB4      LEDQIKVMDDTAIALAKDNKLPIAVTNMN-EKGN-LLRIVK-GDYSKCSIVK--------
PYRH_NITSB      LQDNIKVMDDTAIALAKDNALPIIVCNMF-EEGN-LYDIIVNNNLEKCSIVTDKKENE--
PYRH_DESPS      LRKGLKVMDAAGIALAKDDDKPIMVLNMS-VAGN-MKKAALGERVGTLITA---------
PYRH_DESVV      LQRKLGVMDSTAITLAMENEVPIIVCNM--FKGS-IKRVVCGE--EVGTIVQGG------
PYRH_DESAG      LQKNLRVMDSTAISLCMENNVPIIVCNM--YKGG-IKRAVMGE--DVGTIVQGG------
PYRH_LAWIP      LRRHIKIMDSTAITLAQENNIPIIVCNM--FNGS-IKRAILGQ--NPGTTVEGE------
PYRH_PARL1      LARDLKVMDASAIALARENAIPIIVYSID-EPGG-FAEVLTGA--GRCTII----SDAA-
PYRH_MARMM      LTRDLRVMDASAVTLMRENAIPIVVFDIH-KTNG-LARVLAGE--GKCTMIGKMKSDAAA
PYRH_CAUVC      LAKDLRVMDASAVALMRDSNIPIVVFSIK-GRGN-LLTVLRGE--GTHTVVA---EDRAA
PYRH_SPHAL      LADNLKVMDASAVALCRDNHIPIVVFNIR-EPGN-LARVLAGE--GVSTVVGDGAV----
PYRH_NOVAD      LADNLKVMDASAVALCRDNNIPIVVFSIR-ERGN-LARVLAGE--GTQTTVKKEA-----
PYRH_ERYLH      LADNLKVMDASAVALCRDNDIPIIVFSIR-EKGN-LARVLAGE--GVQTVVQN-------
PYRH_ZYMMO      LADDLKVMDASATALCRDNNIPIVVFNIR-EQGN-FSRVLKGD--GVSTIVCNEEE----
PYRH_SPHWW      LADDLKVMDASAVALCRDNNIPIVVFNIR-EQGN-LARVLAGS--GTATTVQN-------
PYRH_HYPNA      LAKDLKVMDSSAVSLMRDNNIPIVVFSLK-EEGS-LLNVLYGR--GTSTTITKEGAEKP-
PYRH_MAGSA      LARDLAVMDTSAIALCRENKVPIVVFDLH-RPGA-FAETVSGR--GLFTIIAND------
PYRH_RHORT      LTRDLRVMDTSAIALARDNNIPIVVFSLH-TPGA-LADVLDRR--GRFTEILCDSHQE--
PYRH_GRABC      LSRDLSVMDAAAISLCRENHLPIIVFNIH-ETGA-FGRVIRGE--GRFTRIVETQ-----
PYRH_ACICJ      LARDLSVMDAAAISIARENDLPIIVFNIH-APGA-FASVMRGE--GKFTRIVEQR-----
PYRH_GLUOX      LARDLNVMDAAAISLARENKLPIVVFNMH-APGS-FGAVMRGE--GLFTKIIEAD-----
PYRH_RICBR      ITNNLQVMDLATIAIARENKLPIRVFSIK-EQGN-IAKVVQDQ--GEYTTIEE-------
PYRH_RICAH      ITNNLQVMDTAAIAVARENKLPIRIFSIK-EQGN-FARVIQDK--GEYTTIEESVV----
PYRH_WOLPM      LTRDLKVMDASAISLARENSIPIIVFSL--KGEK-IVNIIKGQ--GTYTIVSDCKQ----
PYRH_WOLTR      LTRDLKVVDASAISLARENSIPIIVFSL--KEEK-IVNIVKGH--GTYTIVSDCE-----
PYRH_EHRCJ      LSLDLKIMDVAAVSLAREHSVPIIVFNLG-KRGS-FADIIRGR--GLYTTICN-------
PYRH_EHRRW      LSLDLKIMDVAAVSLARDHSIPIIVFNLG-KRGA-LADIICGG--GLYTTIYN-------
PYRH_ANAMM      LSSNLKIMDAAAISLARENSVPIIVFDLG-RDGA-FFEAVHGR--GLFTTISD-------
PYRH_ANAPZ      LASDLKIMDAAAVSLARENSIPIIVFDLG-KENA-FSEVMKGR--GTFTTISG-------
PYRH_NEOSM      LSKKLRVLDSSAVSIARDNGMPVVIFSLD-SEMA-FYEVINKQ--GNYSTIEGE------
PYRH_RHOS4      LQKHLGVMDASAIALARDNDLPIIVFSLD-EPGG-FCGILRGE--GTYTRVQG-------
PYRH_ROSDO      LAKRLGVMDASAIALARDNNLPIIVFSLD-EPGG-FRGILAGE--GTYTRVQD-------
PYRH_PARZE      LQKHLGVMDASAIALARDNKLPIIVFSLD-APGG-FRSILAGS--GTYTRVHV-------
PYRH_PARDP      LQKHLGVMDASAIALARDNDLPIIVFSLD-EPGG-FRGILAGS--GTYTRVHG-------
PYRH_JANSC      LAQHLGVMDASAIALARENKLPIMVFSLD-EPGG-FRSILDGT--GTYTKVVE-------
PYRH_RUEST      LAKRLKVMDASAIALARDNNLPLIVFGLD-EPGG-FRGVLAGE--GTYTKVHG-------
PYRH_RUEPO      LAKRLKVMDASAIALARDNNLPLIVFSLD-TAGG-FRGILAGE--GTYTKVQG-------
PYRH_AQUAE      INMGLKVMDHTALTLCKENEIPIIVLNVK-EKGN-LRRAVLGE--EVGSVVRG-------
PYRH_SYNFM      LQKDLKVMDATAISLAKDQNMRIVVFNLR-KKGN-IKKIVLGK--CIGTVVEGCDHAQ--
PYRH_SYNP6      LNHELGVMDSTAIALCKDNSIPIVVFDLF-GEGN-IRRAVQGE--DIGTTVGGSCEVS--
PYRH_SYNY3      LAEDLKVMDSTAIALCKDNNIPIMIFDLG-VPGN-IVRAIKGE--AVGTLVGENCEVS--
PYRH_THEEB      LTHNLAVMDSTAIALCKDNDIPIIVFSLE-TAGN-IYRALTGE--PIGTMVGGSCEIS--
PYRH_NOSS1      LAQDLRVMDSTAIALCKENNIPILVFDLT-TRGN-IRRAVLGE--SIGTLVGGSCEIS--
PYRH_TRIEI      LTLDLRVMDSTAIALCKENNIPIIVFNLS-VSGN-ICKAVMGE--KIGTIVGGFHESKRS
PYRH_SYNJA      LTRDLRVMDSTAIALCKENQLPIVVFDLT-TPGN-IYRVVQGE--PIGTWIGQTTPKSNG
PYRH_SYNPW      LSGELAVMDSTAIALCKDNNIPIVVFNLF-EAGN-IGRAVAGE--PIGSRISN-------
PYRH_SYNS9      LSGELGVMDATAISLCKENNIPIVVFDLF-EPGN-IGKAVAGE--PIGSRIGNPV-----
PYRH_SYNR3      LANELGVMDATAIALCKDNTIPIVVFDLF-GSGN-ISRAVAGE--PIGTRITSAA-----
PYRH_PROM1      LANEIGVMDSTAIALCKDNKIPIVVFNIF-QPGN-IAKAISGE--PIGSRISNSS-----
PYRH_PROMA      LSKEIAVMDSTAIALCKDNKIPIVVFNIF-QPGN-INKAVAGE--KIGSRISNSG-----
PYRH_PROM9      LSDEIAVMDSTAIALCKDNNIPIMVFDIF-KKGN-ISKAVAGE--AIGSLIS--------
PYRH_GLOVI      LVQNLRVMDSTAIALCRENNIPILVFNVF-EKNS-IYRAVQGE--AVGTYVC--------
PYRH_BACLD      LKDGLAVMDSTASSLCMDNDIPLIVFSIM-EEGN-IKRAVLGE--QIGTIVRGK------
PYRH_BACAN      LKEGLGVMDSTASSLCMDNDIPLIVFSVM-EKGN-IKRAVLGE--NIGTVVRGK------
PYRH_GEOTN      IQQGLGVMDSTASSLCMDNNIPLIVFSIT-EEGN-IKRAVLGE--NIGTIVRGK------
PYRH_BACHD      LKEGLAVMDSTASSLCMDNNIPLIVFSIM-EEGN-IKKAVLGE--EIGTVVRGSN-----
PYRH_BACSK      LKDGLQVMDSTASSLCMDNDIPLIVFSIM-EEGN-IKRAVLGE--KIGTTVRGK------
PYRH_OCEIH      LNEGLGVMDSTASSLCMDNNIPLIVFSIM-EEGN-IKRVVQGE--TIGTTIRGK------
PYRH_LISMF      IKEGLEVMDTTASSLSMDNDIPLIVFSFT-EQGNNIKRVILGE--KIGTTVRGKK-----
PYRH_STAS1      LQEGLQVMDSTASSFCMDNNIPLNVFSIT-EEGN-IKRAVMGE--KIGTLITK-------
PYRH_LACJO      ISKNLKVMDSTASSLSMDNNIPLVVFNVN-KPGN-IKKVVMGE--NIGTVIKGDK-----
PYRH_LACH4      ISKNLKVMDRTASSLSMDTEIPLIVFNVN-TPGN-IKKVVVGE--NIGTVIRGDK-----
PYRH_LACDB      ISKGLQVMDRTASSLSMDTHIPLIVFNVN-TPGN-IKRVVEGE--NIGTIIRGDK-----
PYRH_LACPL      INKGLQVMDTTASSLSMDNDIPVVVFNLN-EPGN-IRKVVAGE--HIGTTVRGK------
PYRH_LACBA      INKGLNVMDTTASSLSMDNDIPFVVFNLN-ESGN-IRKVVEGE--NIGTTVRGK------
PYRH_PEDPA      IDKGLNVMDTTASSLSMENNIPLVVFNLN-QAGN-IKKVVAGE--NIGTTVRGEE-----
PYRH_LACRE      IEKNLHVMDTTASSLSMDNHIPLVVFNLN-TPGN-IMKVVKGQ--EVGTTIEGD------
PYRH_LACS1      INKGLRVMDTTASSLSMDNNIALVVFNMN-NRGN-IKKVVEGE--EIGTTVEGK------
PYRH_LACP3      INKDLKVMDSTASTLSMDNDIDLVVFNLN-EPGN-IKRVVEGQ--KIGTTIEGRS-----
PYRH_LACSS      INKGLQVMDSTASTLSMDNDIPLVVFNLN-EADN-IKKVVEGA--NIGTTIEGEE-----
PYRH_ENTFA      ISKGLQVMDSTASSLSMDNDIPLVVFNLN-EAGN-IRRAILGE--NIGTTVRGK------
PYRH_LACLM      ITKGLQVMDSTASTMSMDNHIPLVVFNMN-EAGN-ITRVVRGE--EIGTTVE--------
PYRH_STRS2      ISRGLKIMDATASTLSMDNDIDLVVFNMN-EPGN-IKRVVFGE--PIGTTVSNSSEEK--
PYRH_STRA3      IKRGLKIMDATASTISMDNDIDLVVFNMN-ETGN-IKRVVLGE--QIGTTVSNKASE---
PYRH_STRT2      IKRGLKIIDATASTLSMDNDIDLVVFNMN-EPGN-IKRVIFGE--QIGTTVSNKAELRK-
PYRH_STRGC      ISKGLRIMDSTASTLSMDNDIDLVVFNMN-EAGN-IKRVVFGE--QIGTTVSNNL-----
PYRH_STRMU      LKRGLKIMDSTASSLSMDNDIDLVVFNLN-ESGN-IKRVIFGE--QIGTTVTSRISDSE-
PYRH_LEUMM      LQKGLKVMDSTASSLSMDNNMPLVVFNLN-TPGN-LKRVVLGE--AIGTTVTGEK-----
PYRH_OENOB      LRKDLKVMDSTAGAMAKDTDMPLVVFNLN-EAGN-IQKAIEGQ--DIGTVIKGSK-----
PYRH_ONYPE      LSQRLAVMDITAASLCLENNIDILVFNML-KKGN-IKKVVLKEG-NIGTVISSKGE----
PYRH_SYMTH      LAKNLQVMDATATALCMDNRIPIVVFDMM-GPDH-IVKVVLGED-VGQTFVRGNNQ----
PYRH_CARHZ      LNRGLGVMDSTATSLCMDNNIPLIVFNLE-VPGN-IKRVILGE--NIGTIVGGERK----
PYRH_DESRM      LNRGLQVMDSTAVSLCMDNKIPLLVFDLN-TEGN-IKRAILGE--RIGTFVGGDLNG---
PYRH_MOOTA      LNGGLGVMDSTATSLCMDNHIPIIVFGIK-EKGN-ILKAILGE--PIGTYVGRLE-----
PYRH_SYNWW      LSRGLGVMDSTAASLCMDNGIPIIVFDLT-REGN-ILKAVLGE--EIGTYVGR-------
PYRH_DESHY      LSQGLGVMDSTAASLCMDNNIPLIVFDLN-KKGN-IRKGIMGE--SIGTYVGRDK-----
PYRH_CALS4      LNKGLGVMDSTATSLCMDNKIPIIVFDLT-TYGN-IKKVVMGN--DIGTIVKEG------
PYRH_HUNT2      INKGLGVMDSTAASLCKDNNIPIIVFGLN-EPGN-IVKAVMGE--KIGTIVM--------
PYRH_CLOPS      LEQGLQVMDSTATSLCMDNNIPILVFALD-NPEN-IKKVVLGE--NIGTIVSKK------
PYRH_CLOBL      LDQGLQVMDSTATSLCMDNDIPILVFGLD-EPCN-IIKAVTGE--EIGTLVSNSK-----
PYRH_CLONN      LEKGLQVMDSTATSLCMDNNIPILVFGLD-KPNN-IKKVIMGE--QIGTIVSK-------
PYRH_CLOAB      LEKNLQVMDSTATSLCMDNNIPIIVFGLD-VSGN-IRKAVLGE--KIGTIVSK-------
PYRH_CLOTE      LDQGLQVMDSTATSLCMDNNIPILVFALD-APGN-IRKAISGE--KIGTIVCKE------
PYRH_ALKOO      LKMGLKVMDSTAISLCMDNSIPIKVFGLE-DPEN-IKKVIYGD--KIGTYIYS-------
PYRH_ALKMQ      LQQGLKVMDSTATSLCMDNKIPIKVFGLK-QSQN-IKKVILGE--KIGTHIYS-------
PYRH_CLOD6      IQKELKVMDSTATSLCMDNKIPIKVFELT--TEN-IIRAVKGE--NIGTTVK--------
PYRH_CALS8      INQRLEVMDSTATSMCMDNQIPIVVFELA--KGN-IIKAVMGE--NIGTLVNVKEER---
PYRH_MYCSJ      IDRGLAVADATAFSLCMDNGMPILVFNLL-VDGN-IARAVAGE--KIGTLVTT-------
PYRH_MYCS2      IDRGLKVADATAFSLCMDNGMPILVFNLL-TSGN-IARAVAGE--KIGTLVTT-------
PYRH_MYCPA      IDRGLRVADATAFSLCMDNGMPILVFNLL-TNGN-IARAVGGE--KIGTLVTT-------
PYRH_MYCLE      IDRGLRVADATAFSLCMDNGMPILVFNLL-TNGN-IARAVAGE--KIGTLVTT-------
PYRH_MYCBO      LDRGLRVADATAFSLCMDNGMPILVFNLL-TDGN-IARAVRGE--KIGTLVTT-------
PYRH_NOCFA      IERGLKVADATAFSLCMDNQMPILVFNLL-TKGN-IARAVAGE--KIGTLVRS-------
PYRH_RHOJR      IEQGLKVADATAFSLCMDNEMPIMVFNLL-TEGN-IARAVSGE--KIGTLVKS-------
PYRH_CORDI      IEKGLKVADATAFSLCMDNKMPILVFNLL-TEGN-IARAVAGE--QIGTLVQS-------
PYRH_CORJK      IEKGLKVADATAFSLCMDNKMPILVFNLL-TDGN-IARAVAGE--RIGTLVDGNVSTR--
PYRH_COREF      IEKSLKVADATAFSLCMDNNMPILVFNLL-TDGN-IARAVNGE--RIGTLVQS-------
PYRH_SACEN      LERGLKVADATAFSLCMDNQMPILVFNLL-TEGN-IARAVGGE--KIGTLVSTPASGVA-
PYRH_ACIC1      LARDLKFADATAISLCRDNGMPIIVFNLL-EEGN-IARAVHGE--KIGTIVSSGDGVPPR
PYRH_STRCO      ITRDLKVADATAVTLCRDNSLPIVVFELL-KEGN-IARAVKGE--KIGTLVGDQGSRD--
PYRH_CUTAK      LSRDLKVADATAVAMARDNDLTMVFFNLE-MPGN-ISRVINGE--DIGTTVHR-------
PYRH_NOCSJ      IARGLRIMDQTAFALCGENKLPMVVFGME-PEGN-ILRVVQGE--RIGTLVTAG------
PYRH_CLAM3      LQRGLKVVDSTAFSLCMDNDMKMVVFGME-PGGN-VTRAIRGE--RIGTIVSN-------
PYRH_LEIXX      LKQNLKAVDSTALSLCMDNGMPMRIFGME-PAGN-VTAALLGA--EIGTLLG--------
PYRH_PAEAT      LRRDIRVMDQTAMTMCKDNSLSMVVFGME-GEGN-VTRAILGE--TLGTLVTP-------
PYRH_TROW8      LERGLRVVDSAALGLCMEHGLPMRVFGME----S-LRDAVSGL--KVGTELSQ-------
PYRH_BIFAA      LVDNLAVMDAAALSMARDNKQRIRVFGLE-GAGN-VTQALLGE--EIGTMVSTAESTLAE
PYRH_THEFY      LTRGLKVMDATAVSLCMDNGLPIVVFDLM-GKGN-ILRAVQGE--KIGTIVCPPDV----
PYRH_DEHM1      INKRLQVMDATALSLCLDNKLPIIVFDLQ-SSES-LVSAISGQ--PIGTLIS-SES----
PYRH_LEPIC      INRRLKVMDSTALSLCMENNMSIIVFDIF-KRGN-LKDLVTGK--NIGTLISNSEDIQID
PYRH_DEIRA      VEQRLEVMDATALTLCMDKGLPIVVFDIF-EEGN-LARLLRGE--RVGTLIQSRG-----
PYRH_DEIGD      VERRLEVMDATALTLCMDKGLPIVVFDLF-QPGN-LRRLLEGE--RVGTLIESERRPERL
PYRH_THET2      LNRGLQVMDTTAITLCMEAGLPIVVFDIF-KPGA-LVGIIQGE--KVGTLIH--------
PYRH_RUBXD      LSRNLAVMDHTAATLCSGEGLPIIVFDIL-KSGN-LRRILQGE--KVGSLVWREPPER--
PYRH_ROSS1      LSRGLTVMDSTALTFCMDNNIPIIVFDPL-TPGN-IERIVMGE--HVGTLVSSHPSQ---
PYRH_RHOBA      IQKKLRVMDATAIALCNEHRKPILVFNFK-QDGN-IVRAVRGE--SVGTWIGDPQDTQTN
PYRH_GEOSL      LKKGLQVMDATATSLCMDNNLPIIVFDIT-TYGN-IKKVVCGE--EIGTIVKGE------
PYRH_PELPD      LKRGLQVMDATATSLCMDNNLPIIVFDLT-TEGN-IIKVINGE--EIGTIVQGE------
PYRH_PELCD      LKKGLKVMDATATSLCMDNDLPIVVFQLS-RPGN-IKKVVLGE--AIGTIVKGE------
PYRH_BDEBA      LNRGLQVMDSTAISMCMDNKLPIITFDLT-VPGN-ILKAVQGE--TIGTLVH--------
PYRH_ANADF      LKKNLKVMDSTAISLCMDNDLPIIVFDST-LRGN-VRRVVLGE--QIGTTVGRLEEK---
PYRH_MYXXD      LKQNLNVMDSTAISLCMDNKLPIIVFDLT-QRGN-IRRAVLGEG-DIGTLVGGSETVWA-
PYRH_KORVE      LKKGLRVMDATAISLCQENRLPIVVFNLN-ERGN-IQRVVMGE--AVGSLVSA-------
PYRH_SYNAS      LAQNLKVMDATAISLCRDNHLPILVFNLQ-KPGN-IVRCISGI--PIGTLVGD-------
PYRH_SOLUE      LSRGLGVMDATSIAMCRDNKLPIIVFNLN-TIGN-IMRMSMGE--TIGTVIH--------
PYRH_CHLPD      IRKNLRVMDMTAITLCRENLLPIVVMNMN-ESGN-FSRLLCGE--EIGTLVHA-------
PYRH_PELLD      IRKNLRVMDMTAITLCRENTLPIVVMNMN-EKGN-LSRLIRGE--HVGSLVHA-------
PYRH_CHLCH      FHKKLGVMDMTAITLCSENSLPIVVMNMN-EKGN-LSRLLRGE--KVGSLVHHEGV----
PYRH_CHLTE      IRKNLRVMDMTAITLCRENTLPIVVMNMN-IKGN-FTRLLKGE--PIGTLVHVGEE----
PYRH_SALRD      IDRDLRVMDMTALTLCQESKMPIVVFNMG-TSNN-LRRLLEGE--TVGTHVHWDEAKAST
PYRH_GRAFK      IKKGLKVMDTTAFTLSQENELPIIVFDMN-KPGN-LLKVATGE--RVGTKVNL-------
PYRH_FLAPJ      LKKGLNVMDTTAFTLSQENKLPIIVFDMN-KEGN-LLKICKGE--NIGTVVNI-------
PYRH_CYTH3      YAKGLNIMDMTAFTLCKENELPIIIFDMN-RPGN-LLKVLEGE--SVGTLVKL-------
PYRH_BACV8      LKRGLKVMDLTATCMCKENNLPIIVFDMD-TVGN-LKKVMTGE--NIGTLVHN-------
PYRH_PARD8      YTRGLKVMDLTATTMCKENNLPIIVFDMD-TNGN-LKKVMSGE--NIGTLVHN-------
PYRH_PORGI      YARGLKVMDLTATAMCMENNLPIVVFDMD-TPGN-LLKVLRGE--KIGTYVSNTSA----
PYRH_FUSNN      LAKDLKVMDATAISLCRENKLPIIVFNSL-DEGN-LKKVVMGE--HIGTTVVAD------
PYRH_ALKEH      LEDRLMVMDATAVVLCRDQNMRIMVFDIT-SPGA-LVDVITGQ--RTGTIVERG-----D
PYRH_HALHL      LSKRLEVMDATAIVLCRDQAMRIMVFDIT-SPGT-MVAAARGE--PVGTVVDPGLPSAQE
PYRH_METCA      LDQRLNVMDTTALVLCRDYKMPLRVMNVF-RQGA-VMRLIRGD--DIGSLLVTG------
PYRH_XANC8      IMQGLEVMDTAAFALARDSDLPLRIFGMS-EPGV-LLRILHGA--QIGTLVQGRS-----
PYRH_XYLFT      ISQNLEVMDTAAFALARDSNLPLRIFDIE-QPGV-LLRILHGE--EIGTLVKERNSKS--
PYRH_NITOC      IERKLAVMDTTAIIMCRDHSLPLRVFDMH-KVGA-LTHIIKGE--DVGTLVSRE------
PYRH_DICNV      LTDNLGVMDATSIVMCRDNHMPLIVFDMT-KAGE-IIRAVFGE--DVGTIVHA-------
PYRH_METFK      IVKNLKVMDATALTLCRDQKLPISVFSIF-RQGA-LKRVVLGE--DEGTRVLP-------
PYRH_NITMU      IAENLKVMDATALTLCRDQKLPLKVFSIF-KAEA-LRRVVMGE--EEGTLVEV-------
PYRH_CHRVO      ISRNLKVMDATAFALCRDQHLNIKVFSIF-KNGA-LRRVVLGE--DEGTLVHC-------
PYRH_NITEU      ISKNLQVMDATALTLCRDQKLPINVFSIF-KTGA-LKRVIMGE--DEGTSVFV-------
PYRH_POLNA      IGKNLEVMDATAFALCRDQKLPIKIFSIF-KLGA-LRRVVMGE--DEGTLVHV-------
PYRH_METPP      ISKNLQVMDATAFALCRDQKLPIKVFSIF-KPGA-LRRVVTGE--DEGTLVHV-------
PYRH_VEREI      MARNLGIMDATAFALCRDQRLPVRVFSII-KHGA-FKRVVMGE--DEGTLVYV-------
PYRH_RHOFT      MTQNLGIMDATAFALCRDQKLPIKVFSIL-KHGA-LKRVVMGQ--DEGTLVYA-------
PYRH_HERAR      ISKHLQVMDATAFALCRDQKLPIKVFSIV-KPGA-LKRVVMGE--DEGTLVHV-------
PYRH_BORA1      IVRRLEVMDATAFALCRDQKLPIKVFSIN-KSGA-LKRVVGGE--DEGTLVHV-------
PYRH_CUPNH      ISRNLQVMDATAFALCRDQKLPIRVFSIV-KPGA-LKRIILGE--DEGTLVHV-------
PYRH_AROAE      IGRNLAVLDATAFALCRDQKLPINVFSIF-KPGA-LKRVVLGE--DEGTLVHS-------
PYRH_DECAR      ISKNLAVMDATAFALCRDQKLPINVFSIF-KTGA-LKRVVCGE--DEGTLVYC-------
PYRH_NEIMF      LLKNLKVMDATAFALCRERKLNIVVFGIA-KEGS-LKRVVTGE--NEGTLVHC-------
PYRH_THIDA      IAKQLGVLDTAAFALCREQKLSLVVFNVF-KPGA-LKRVVMGE--DEGTRVSNH------
PYRH_RHILO      INRGLSIMDTAAIALARENNIPIIVYSIH-EKGG-FGDILRGG--GRCTVVADD------
PYRH_CHESB      IRDGLAIMDTAAIALARENNIPIIVFSIH-EAGG-FGAILRGG--GHCTIVDDDPAAQQQ
PYRH_OCHA4      LDRGLAVMDTAAVALARENNIPIIVYSIH-ENGG-LAEILQGK--GRCTIVSDN------
PYRH_AGRFC      LGKGLAVMDIAAVALARENHIPIIVFSIH-EKGG-FAQILTGG--GRKTIVHDK------
PYRH_RHIEC      LDRGLAVMDVAAVALARENSIPIIVFSIH-EKGG-FAEILTGG--GLKTIVSDN------
PYRH_BARBK      LRLGLSIMDTTAVTLARENNIPIIVYSIH-EKGG-LTKVLNGT--GRFTVVSE-------
PYRH_NITHX      LEGGYKVMDATAFALARETSLPIIVFSIA-EPGS-IGAILKGT--GRGTIVAS-------
PYRH_RHOP5      LDGGYKVMDATAFALARDTLLPIIVFSIA-EPGS-VGAILSGT--GRGTIVAG-------
PYRH_BRASB      IEGGYKVMDATAFALARETSLPIIVFSIA-EPGA-IGAMLRGE--GRGTIVAG-------
PYRH_BRADU      IEGGYKVMDATAFALARETSLPIIVFSIA-EPGS-IGAILRGI--GHGTIVAG-------
PYRH_RHOP2      LAGGYKVMDATAFALARETSLPIIVFSIA-EPGS-IGAVLGGA--GRATVVAG-------
PYRH_RHOPA      LAGGYKVMDATAFALARETSLPIIVFSIA-EPGS-IGAVLSGA--GRATVVAG-------
PYRH_AZOC5      LAYDLKVMDAAAFALAREASLPIIVFSIR-DPGA-IVAAAQGE--GRVTVVSP-------
PYRH_MAGMM      LTKNLKVMDMTAITLCRENHIPIGVFSI--FERGALTAVLRGE--PKATIIEERKE----
PYRH_PARUW      LAEKLQVMDATAIALCRNHQIPIFVFNMKRLFENRLDHVLTDY--SHGTLVDDGEIGHEA
PYRH_MYCPU      LNMNLQIMDLTAISMAKENKIELIVFDIT--EKNSIYNSILGK--INHTKVVN-------
PYRH_MYCS5      LEKKLQVMDLTATSMARDNNINLIVFNLL--EDNSIIKALEGK--ITHTEVTR-------
PYRH_MYCMO      LTNGLKIMDSTSVTMAKENNIKILVFDIQ--EKDSILKVLEGN--AEHTKVE--------
PYRH_MYCH7      IEKNLKVMDSTAFSMARDNKIKLLIFDIK--EKNSISKLIKRQ--IKHTEVY--------
PYRH_MYCGE      IKNDLKIMDITAFTMCKENNLKIIIFNIN--AENALLDALNKK--GRFTIIENN------
PYRH_MYCPN      IKNDLQIMDITAFTMCKENNLKVIIFNIN--AEHAIIKALSKQ--GKYTLIEK-------
PYRH_MYCGA      LNDQLRVMDLTAFSLAKDHNLKLLIFNIE--AEQSIIKTIENK--NKHTKITN-------
PYRH_UREPA      LTQNLKVMDATALALCQENNINLLVFNID--KPNAIVDVLEKK--NKYTIVSK-------
PYRH_MYCPE      IELGLEVMDITAATICKQSNIKTIVFKMN--EKNGILNAFENK--SKFTLVSEDEKDLDA
PYRH_MESFL      AENQLRVMDLTAATLAKDAKLPIEVFDMQ--GQNNIIKVMEGS--LESTIIEE-------
PYRH_MYCCT      VDKQLRIMDLTAATLAKDANLKIEVFDMS--GDNNIIKVLENK--LESTIIE--------
                        *                                                   

PYRH_FRACC      FGNEVLASPAESTA----------------------------------------------
PYRH_ORITB      FSN---------------------------------------------------------
PYRH_CHLFF      ------------------------------------------------------------
PYRH_CHLPN      PRH---------------------------------------------------------
PYRH_CHLMU      ------------------------------------------------------------
PYRH_FERNB      ------------------------------------------------------------
PYRH_THEM4      ------------------------------------------------------------
PYRH_PSELT      ------------------------------------------------------------
PYRH_THEMA      ------------------------------------------------------------
PYRH_FRATF      ------------------------------------------------------------
PYRH_ECOLI      ------------------------------------------------------------
PYRH_PHOLL      ------------------------------------------------------------
PYRH_ALIF1      ------------------------------------------------------------
PYRH_PHOPR      ------------------------------------------------------------
PYRH_AERHH      ------------------------------------------------------------
PYRH_SHELP      ------------------------------------------------------------
PYRH_IDILO      ------------------------------------------------------------
PYRH_COLP3      ------------------------------------------------------------
PYRH_PSEA6      ------------------------------------------------------------
PYRH_PSEHT      K-----------------------------------------------------------
PYRH_PSYIN      E-----------------------------------------------------------
PYRH_ACTSZ      ------------------------------------------------------------
PYRH_HAEDU      ------------------------------------------------------------
PYRH_HAES1      ------------------------------------------------------------
PYRH_HAEIN      ------------------------------------------------------------
PYRH_BLOPB      ------------------------------------------------------------
PYRH_BLOFL      ------------------------------------------------------------
PYRH_BAUCH      YNI---------------------------------------------------------
PYRH_BUCAI      ------------------------------------------------------------
PYRH_BUCAP      ------------------------------------------------------------
PYRH_BUCBP      ------------------------------------------------------------
PYRH_WIGBR      ------------------------------------------------------------
PYRH_BUCCC      ------------------------------------------------------------
PYRH_RUTMC      ------------------------------------------------------------
PYRH_VESOH      ------------------------------------------------------------
PYRH_HYDCU      ------------------------------------------------------------
PYRH_PSEU5      ------------------------------------------------------------
PYRH_PSEPF      ------------------------------------------------------------
PYRH_SACD2      ------------------------------------------------------------
PYRH_HAHCH      ------------------------------------------------------------
PYRH_MARHV      ------------------------------------------------------------
PYRH_CHRSD      ------------------------------------------------------------
PYRH_ALCBS      ------------------------------------------------------------
PYRH_PSYWF      ------------------------------------------------------------
PYRH_ACIBT      ------------------------------------------------------------
PYRH_LEGPA      ------------------------------------------------------------
PYRH_COXBU      ------------------------------------------------------------
PYRH_HELAH      ------------------------------------------------------------
PYRH_WOLSU      ------------------------------------------------------------
PYRH_HELHP      ------------------------------------------------------------
PYRH_CAMC1      ------------------------------------------------------------
PYRH_CAMC5      ------------------------------------------------------------
PYRH_CAMFF      ------------------------------------------------------------
PYRH_CAMJD      ------------------------------------------------------------
PYRH_CAMHC      ------------------------------------------------------------
PYRH_SULNB      ------------------------------------------------------------
PYRH_SULDN      ------------------------------------------------------------
PYRH_ARCB4      ------------------------------------------------------------
PYRH_NITSB      ------------------------------------------------------------
PYRH_DESPS      ------------------------------------------------------------
PYRH_DESVV      ------------------------------------------------------------
PYRH_DESAG      ------------------------------------------------------------
PYRH_LAWIP      ------------------------------------------------------------
PYRH_PARL1      ------------------------------------------------------------
PYRH_MARMM      V-----------------------------------------------------------
PYRH_CAUVC      ------------------------------------------------------------
PYRH_SPHAL      ------------------------------------------------------------
PYRH_NOVAD      ------------------------------------------------------------
PYRH_ERYLH      ------------------------------------------------------------
PYRH_ZYMMO      ------------------------------------------------------------
PYRH_SPHWW      ------------------------------------------------------------
PYRH_HYPNA      ------------------------------------------------------------
PYRH_MAGSA      ------------------------------------------------------------
PYRH_RHORT      ------------------------------------------------------------
PYRH_GRABC      ------------------------------------------------------------
PYRH_ACICJ      ------------------------------------------------------------
PYRH_GLUOX      ------------------------------------------------------------
PYRH_RICBR      ------------------------------------------------------------
PYRH_RICAH      ------------------------------------------------------------
PYRH_WOLPM      ------------------------------------------------------------
PYRH_WOLTR      ------------------------------------------------------------
PYRH_EHRCJ      ------------------------------------------------------------
PYRH_EHRRW      ------------------------------------------------------------
PYRH_ANAMM      ------------------------------------------------------------
PYRH_ANAPZ      ------------------------------------------------------------
PYRH_NEOSM      ------------------------------------------------------------
PYRH_RHOS4      ------------------------------------------------------------
PYRH_ROSDO      ------------------------------------------------------------
PYRH_PARZE      ------------------------------------------------------------
PYRH_PARDP      ------------------------------------------------------------
PYRH_JANSC      ------------------------------------------------------------
PYRH_RUEST      ------------------------------------------------------------
PYRH_RUEPO      ------------------------------------------------------------
PYRH_AQUAE      ------------------------------------------------------------
PYRH_SYNFM      ------------------------------------------------------------
PYRH_SYNP6      ------------------------------------------------------------
PYRH_SYNY3      ------------------------------------------------------------
PYRH_THEEB      ------------------------------------------------------------
PYRH_NOSS1      ------------------------------------------------------------
PYRH_TRIEI      ------------------------------------------------------------
PYRH_SYNJA      IPARLAQESGS-------------------------------------------------
PYRH_SYNPW      ------------------------------------------------------------
PYRH_SYNS9      ------------------------------------------------------------
PYRH_SYNR3      ------------------------------------------------------------
PYRH_PROM1      ------------------------------------------------------------
PYRH_PROMA      ------------------------------------------------------------
PYRH_PROM9      ------------------------------------------------------------
PYRH_GLOVI      ------------------------------------------------------------
PYRH_BACLD      ------------------------------------------------------------
PYRH_BACAN      ------------------------------------------------------------
PYRH_GEOTN      ------------------------------------------------------------
PYRH_BACHD      ------------------------------------------------------------
PYRH_BACSK      ------------------------------------------------------------
PYRH_OCEIH      ------------------------------------------------------------
PYRH_LISMF      ------------------------------------------------------------
PYRH_STAS1      ------------------------------------------------------------
PYRH_LACJO      ------------------------------------------------------------
PYRH_LACH4      ------------------------------------------------------------
PYRH_LACDB      ------------------------------------------------------------
PYRH_LACPL      ------------------------------------------------------------
PYRH_LACBA      ------------------------------------------------------------
PYRH_PEDPA      ------------------------------------------------------------
PYRH_LACRE      ------------------------------------------------------------
PYRH_LACS1      ------------------------------------------------------------
PYRH_LACP3      ------------------------------------------------------------
PYRH_LACSS      ------------------------------------------------------------
PYRH_ENTFA      ------------------------------------------------------------
PYRH_LACLM      ------------------------------------------------------------
PYRH_STRS2      ------------------------------------------------------------
PYRH_STRA3      ------------------------------------------------------------
PYRH_STRT2      ------------------------------------------------------------
PYRH_STRGC      ------------------------------------------------------------
PYRH_STRMU      ------------------------------------------------------------
PYRH_LEUMM      ------------------------------------------------------------
PYRH_OENOB      ------------------------------------------------------------
PYRH_ONYPE      ------------------------------------------------------------
PYRH_SYMTH      ------------------------------------------------------------
PYRH_CARHZ      ------------------------------------------------------------
PYRH_DESRM      ------------------------------------------------------------
PYRH_MOOTA      ------------------------------------------------------------
PYRH_SYNWW      ------------------------------------------------------------
PYRH_DESHY      ------------------------------------------------------------
PYRH_CALS4      ------------------------------------------------------------
PYRH_HUNT2      ------------------------------------------------------------
PYRH_CLOPS      ------------------------------------------------------------
PYRH_CLOBL      ------------------------------------------------------------
PYRH_CLONN      ------------------------------------------------------------
PYRH_CLOAB      ------------------------------------------------------------
PYRH_CLOTE      ------------------------------------------------------------
PYRH_ALKOO      ------------------------------------------------------------
PYRH_ALKMQ      ------------------------------------------------------------
PYRH_CLOD6      ------------------------------------------------------------
PYRH_CALS8      ------------------------------------------------------------
PYRH_MYCSJ      ------------------------------------------------------------
PYRH_MYCS2      ------------------------------------------------------------
PYRH_MYCPA      ------------------------------------------------------------
PYRH_MYCLE      ------------------------------------------------------------
PYRH_MYCBO      ------------------------------------------------------------
PYRH_NOCFA      ------------------------------------------------------------
PYRH_RHOJR      ------------------------------------------------------------
PYRH_CORDI      ------------------------------------------------------------
PYRH_CORJK      ------------------------------------------------------------
PYRH_COREF      ------------------------------------------------------------
PYRH_SACEN      ------------------------------------------------------------
PYRH_ACIC1      RQAVSPAR----------------------------------------------------
PYRH_STRCO      ------------------------------------------------------------
PYRH_CUTAK      ------------------------------------------------------------
PYRH_NOCSJ      ------------------------------------------------------------
PYRH_CLAM3      ------------------------------------------------------------
PYRH_LEIXX      ------------------------------------------------------------
PYRH_PAEAT      ------------------------------------------------------------
PYRH_TROW8      ------------------------------------------------------------
PYRH_BIFAA      ------------------------------------------------------------
PYRH_THEFY      ------------------------------------------------------------
PYRH_DEHM1      ------------------------------------------------------------
PYRH_LEPIC      GK----------------------------------------------------------
PYRH_DEIRA      ------------------------------------------------------------
PYRH_DEIGD      SHDPSSHVPR--------------------------------------------------
PYRH_THET2      ------------------------------------------------------------
PYRH_RUBXD      ------------------------------------------------------------
PYRH_ROSS1      ------------------------------------------------------------
PYRH_RHOBA      QR----------------------------------------------------------
PYRH_GEOSL      ------------------------------------------------------------
PYRH_PELPD      ------------------------------------------------------------
PYRH_PELCD      ------------------------------------------------------------
PYRH_BDEBA      ------------------------------------------------------------
PYRH_ANADF      ------------------------------------------------------------
PYRH_MYXXD      ------------------------------------------------------------
PYRH_KORVE      ------------------------------------------------------------
PYRH_SYNAS      ------------------------------------------------------------
PYRH_SOLUE      ------------------------------------------------------------
PYRH_CHLPD      ------------------------------------------------------------
PYRH_PELLD      ------------------------------------------------------------
PYRH_CHLCH      ------------------------------------------------------------
PYRH_CHLTE      ------------------------------------------------------------
PYRH_SALRD      ERVPA-------------------------------------------------------
PYRH_GRAFK      ------------------------------------------------------------
PYRH_FLAPJ      ------------------------------------------------------------
PYRH_CYTH3      ------------------------------------------------------------
PYRH_BACV8      ------------------------------------------------------------
PYRH_PARD8      ------------------------------------------------------------
PYRH_PORGI      ------------------------------------------------------------
PYRH_FUSNN      ------------------------------------------------------------
PYRH_ALKEH      EL----------------------------------------------------------
PYRH_HALHL      ESS---------------------------------------------------------
PYRH_METCA      ------------------------------------------------------------
PYRH_XANC8      ------------------------------------------------------------
PYRH_XYLFT      ------------------------------------------------------------
PYRH_NITOC      ------------------------------------------------------------
PYRH_DICNV      ------------------------------------------------------------
PYRH_METFK      ------------------------------------------------------------
PYRH_NITMU      ------------------------------------------------------------
PYRH_CHRVO      ------------------------------------------------------------
PYRH_NITEU      ------------------------------------------------------------
PYRH_POLNA      ------------------------------------------------------------
PYRH_METPP      ------------------------------------------------------------
PYRH_VEREI      ------------------------------------------------------------
PYRH_RHOFT      ------------------------------------------------------------
PYRH_HERAR      ------------------------------------------------------------
PYRH_BORA1      ------------------------------------------------------------
PYRH_CUPNH      ------------------------------------------------------------
PYRH_AROAE      ------------------------------------------------------------
PYRH_DECAR      ------------------------------------------------------------
PYRH_NEIMF      ------------------------------------------------------------
PYRH_THIDA      ------------------------------------------------------------
PYRH_RHILO      ------------------------------------------------------------
PYRH_CHESB      ASA---------------------------------------------------------
PYRH_OCHA4      ------------------------------------------------------------
PYRH_AGRFC      ------------------------------------------------------------
PYRH_RHIEC      ------------------------------------------------------------
PYRH_BARBK      ------------------------------------------------------------
PYRH_NITHX      ------------------------------------------------------------
PYRH_RHOP5      ------------------------------------------------------------
PYRH_BRASB      ------------------------------------------------------------
PYRH_BRADU      ------------------------------------------------------------
PYRH_RHOP2      ------------------------------------------------------------
PYRH_RHOPA      ------------------------------------------------------------
PYRH_AZOC5      ------------------------------------------------------------
PYRH_MAGMM      ------------------------------------------------------------
PYRH_PARUW      NKLDR-------------------------------------------------------
PYRH_MYCPU      ------------------------------------------------------------
PYRH_MYCS5      ------------------------------------------------------------
PYRH_MYCMO      ------------------------------------------------------------
PYRH_MYCH7      ------------------------------------------------------------
PYRH_MYCGE      ------------------------------------------------------------
PYRH_MYCPN      ------------------------------------------------------------
PYRH_MYCGA      ------------------------------------------------------------
PYRH_UREPA      ------------------------------------------------------------
PYRH_MYCPE      FKFGIKNIKNNSEKSSNNWDNKVIDIKTIKEENSLNIDDIFENSIEELQKLKEDDIQKNQ
PYRH_MESFL      ------------------------------------------------------------
PYRH_MYCCT      ------------------------------------------------------------
                                                                            

PYRH_FRACC      ----------------
PYRH_ORITB      ----------------
PYRH_CHLFF      ----------------
PYRH_CHLPN      ----------------
PYRH_CHLMU      ----------------
PYRH_FERNB      ----------------
PYRH_THEM4      ----------------
PYRH_PSELT      ----------------
PYRH_THEMA      ----------------
PYRH_FRATF      ----------------
PYRH_ECOLI      ----------------
PYRH_PHOLL      ----------------
PYRH_ALIF1      ----------------
PYRH_PHOPR      ----------------
PYRH_AERHH      ----------------
PYRH_SHELP      ----------------
PYRH_IDILO      ----------------
PYRH_COLP3      ----------------
PYRH_PSEA6      ----------------
PYRH_PSEHT      ----------------
PYRH_PSYIN      ----------------
PYRH_ACTSZ      ----------------
PYRH_HAEDU      ----------------
PYRH_HAES1      ----------------
PYRH_HAEIN      ----------------
PYRH_BLOPB      ----------------
PYRH_BLOFL      ----------------
PYRH_BAUCH      ----------------
PYRH_BUCAI      ----------------
PYRH_BUCAP      ----------------
PYRH_BUCBP      ----------------
PYRH_WIGBR      ----------------
PYRH_BUCCC      ----------------
PYRH_RUTMC      ----------------
PYRH_VESOH      ----------------
PYRH_HYDCU      ----------------
PYRH_PSEU5      ----------------
PYRH_PSEPF      ----------------
PYRH_SACD2      ----------------
PYRH_HAHCH      ----------------
PYRH_MARHV      ----------------
PYRH_CHRSD      ----------------
PYRH_ALCBS      ----------------
PYRH_PSYWF      ----------------
PYRH_ACIBT      ----------------
PYRH_LEGPA      ----------------
PYRH_COXBU      ----------------
PYRH_HELAH      ----------------
PYRH_WOLSU      ----------------
PYRH_HELHP      ----------------
PYRH_CAMC1      ----------------
PYRH_CAMC5      ----------------
PYRH_CAMFF      ----------------
PYRH_CAMJD      ----------------
PYRH_CAMHC      ----------------
PYRH_SULNB      ----------------
PYRH_SULDN      ----------------
PYRH_ARCB4      ----------------
PYRH_NITSB      ----------------
PYRH_DESPS      ----------------
PYRH_DESVV      ----------------
PYRH_DESAG      ----------------
PYRH_LAWIP      ----------------
PYRH_PARL1      ----------------
PYRH_MARMM      ----------------
PYRH_CAUVC      ----------------
PYRH_SPHAL      ----------------
PYRH_NOVAD      ----------------
PYRH_ERYLH      ----------------
PYRH_ZYMMO      ----------------
PYRH_SPHWW      ----------------
PYRH_HYPNA      ----------------
PYRH_MAGSA      ----------------
PYRH_RHORT      ----------------
PYRH_GRABC      ----------------
PYRH_ACICJ      ----------------
PYRH_GLUOX      ----------------
PYRH_RICBR      ----------------
PYRH_RICAH      ----------------
PYRH_WOLPM      ----------------
PYRH_WOLTR      ----------------
PYRH_EHRCJ      ----------------
PYRH_EHRRW      ----------------
PYRH_ANAMM      ----------------
PYRH_ANAPZ      ----------------
PYRH_NEOSM      ----------------
PYRH_RHOS4      ----------------
PYRH_ROSDO      ----------------
PYRH_PARZE      ----------------
PYRH_PARDP      ----------------
PYRH_JANSC      ----------------
PYRH_RUEST      ----------------
PYRH_RUEPO      ----------------
PYRH_AQUAE      ----------------
PYRH_SYNFM      ----------------
PYRH_SYNP6      ----------------
PYRH_SYNY3      ----------------
PYRH_THEEB      ----------------
PYRH_NOSS1      ----------------
PYRH_TRIEI      ----------------
PYRH_SYNJA      ----------------
PYRH_SYNPW      ----------------
PYRH_SYNS9      ----------------
PYRH_SYNR3      ----------------
PYRH_PROM1      ----------------
PYRH_PROMA      ----------------
PYRH_PROM9      ----------------
PYRH_GLOVI      ----------------
PYRH_BACLD      ----------------
PYRH_BACAN      ----------------
PYRH_GEOTN      ----------------
PYRH_BACHD      ----------------
PYRH_BACSK      ----------------
PYRH_OCEIH      ----------------
PYRH_LISMF      ----------------
PYRH_STAS1      ----------------
PYRH_LACJO      ----------------
PYRH_LACH4      ----------------
PYRH_LACDB      ----------------
PYRH_LACPL      ----------------
PYRH_LACBA      ----------------
PYRH_PEDPA      ----------------
PYRH_LACRE      ----------------
PYRH_LACS1      ----------------
PYRH_LACP3      ----------------
PYRH_LACSS      ----------------
PYRH_ENTFA      ----------------
PYRH_LACLM      ----------------
PYRH_STRS2      ----------------
PYRH_STRA3      ----------------
PYRH_STRT2      ----------------
PYRH_STRGC      ----------------
PYRH_STRMU      ----------------
PYRH_LEUMM      ----------------
PYRH_OENOB      ----------------
PYRH_ONYPE      ----------------
PYRH_SYMTH      ----------------
PYRH_CARHZ      ----------------
PYRH_DESRM      ----------------
PYRH_MOOTA      ----------------
PYRH_SYNWW      ----------------
PYRH_DESHY      ----------------
PYRH_CALS4      ----------------
PYRH_HUNT2      ----------------
PYRH_CLOPS      ----------------
PYRH_CLOBL      ----------------
PYRH_CLONN      ----------------
PYRH_CLOAB      ----------------
PYRH_CLOTE      ----------------
PYRH_ALKOO      ----------------
PYRH_ALKMQ      ----------------
PYRH_CLOD6      ----------------
PYRH_CALS8      ----------------
PYRH_MYCSJ      ----------------
PYRH_MYCS2      ----------------
PYRH_MYCPA      ----------------
PYRH_MYCLE      ----------------
PYRH_MYCBO      ----------------
PYRH_NOCFA      ----------------
PYRH_RHOJR      ----------------
PYRH_CORDI      ----------------
PYRH_CORJK      ----------------
PYRH_COREF      ----------------
PYRH_SACEN      ----------------
PYRH_ACIC1      ----------------
PYRH_STRCO      ----------------
PYRH_CUTAK      ----------------
PYRH_NOCSJ      ----------------
PYRH_CLAM3      ----------------
PYRH_LEIXX      ----------------
PYRH_PAEAT      ----------------
PYRH_TROW8      ----------------
PYRH_BIFAA      ----------------
PYRH_THEFY      ----------------
PYRH_DEHM1      ----------------
PYRH_LEPIC      ----------------
PYRH_DEIRA      ----------------
PYRH_DEIGD      ----------------
PYRH_THET2      ----------------
PYRH_RUBXD      ----------------
PYRH_ROSS1      ----------------
PYRH_RHOBA      ----------------
PYRH_GEOSL      ----------------
PYRH_PELPD      ----------------
PYRH_PELCD      ----------------
PYRH_BDEBA      ----------------
PYRH_ANADF      ----------------
PYRH_MYXXD      ----------------
PYRH_KORVE      ----------------
PYRH_SYNAS      ----------------
PYRH_SOLUE      ----------------
PYRH_CHLPD      ----------------
PYRH_PELLD      ----------------
PYRH_CHLCH      ----------------
PYRH_CHLTE      ----------------
PYRH_SALRD      ----------------
PYRH_GRAFK      ----------------
PYRH_FLAPJ      ----------------
PYRH_CYTH3      ----------------
PYRH_BACV8      ----------------
PYRH_PARD8      ----------------
PYRH_PORGI      ----------------
PYRH_FUSNN      ----------------
PYRH_ALKEH      ----------------
PYRH_HALHL      ----------------
PYRH_METCA      ----------------
PYRH_XANC8      ----------------
PYRH_XYLFT      ----------------
PYRH_NITOC      ----------------
PYRH_DICNV      ----------------
PYRH_METFK      ----------------
PYRH_NITMU      ----------------
PYRH_CHRVO      ----------------
PYRH_NITEU      ----------------
PYRH_POLNA      ----------------
PYRH_METPP      ----------------
PYRH_VEREI      ----------------
PYRH_RHOFT      ----------------
PYRH_HERAR      ----------------
PYRH_BORA1      ----------------
PYRH_CUPNH      ----------------
PYRH_AROAE      ----------------
PYRH_DECAR      ----------------
PYRH_NEIMF      ----------------
PYRH_THIDA      ----------------
PYRH_RHILO      ----------------
PYRH_CHESB      ----------------
PYRH_OCHA4      ----------------
PYRH_AGRFC      ----------------
PYRH_RHIEC      ----------------
PYRH_BARBK      ----------------
PYRH_NITHX      ----------------
PYRH_RHOP5      ----------------
PYRH_BRASB      ----------------
PYRH_BRADU      ----------------
PYRH_RHOP2      ----------------
PYRH_RHOPA      ----------------
PYRH_AZOC5      ----------------
PYRH_MAGMM      ----------------
PYRH_PARUW      ----------------
PYRH_MYCPU      ----------------
PYRH_MYCS5      ----------------
PYRH_MYCMO      ----------------
PYRH_MYCH7      ----------------
PYRH_MYCGE      ----------------
PYRH_MYCPN      ----------------
PYRH_MYCGA      ----------------
PYRH_UREPA      ----------------
PYRH_MYCPE      KKLNEIIKSFYQDNKE
PYRH_MESFL      ----------------
PYRH_MYCCT      ----------------