CLUSTAL format seed alignment for MF_01224_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MOAC_BACHD       ---------------MRDFTHFNEQGRAKMVDISEKSITERTAVAKSSVEVNKEIYEKII
MOAC_BACSU       ---------------MNGFSHFNEQGRAQMVDISEKSSTVRTAAAVSSVHMKNEVYEKIQ
MOAC_STAAM       ---------------MTEFTHINQQGHAKMVDVSDKQITKRTAVAHSSITVNETIFKQIS
MOAC_STAAW       ---------------MTEFTHINQQGHAKMVDVSDKQITKRTAVAHSSITVNKTIFKQIS
MOAC_STACT       ---------------MSEFTHINEQGNAKMIDVSEKEITKRTATAHSSITVNQDIYQQIV
MOAC_CLOAB       --------------MSEVFTHINEEGRARMVDVSEKDNTIRQAIASGKISMEKDTLERIK
MOAC_CLOPE       --------------MDNKLTHFDNKGNAVMVDVSNKNETERIAIATGTVKASSETIELIK
MOAC_LISIN       -------------MDKDDLTHFNDEKRAKMVDVTSKSETKRRAIARATIHMNEETLARIH
MOAC_LISMO       -------------MEKDDLTHFNDEKRAKMVDVTSKSETKRRAIASATIHMNEETLARIH
MOAC_HELPY       ----------------MPLTHLNEENQPKMVDIGDKETTERIALASGRISMNKEAYDAII
MOAC_HELPJ       ----------------MPLTHLNEENQPKMVDIGDKETTERIALASGRISMNKEAYDAII
MOAC_CAMJE       ----------------MKLSHLDEKNHPKMVDVSDKNITLRIATASGIIYMSQEAFDVIK
MOAC_PAENI       ---------MRLESWSPGLTHLRTDGTAHMVDVSEKVESTREATLREQFVQLSEVLLLLT
MOAC_CORGL       ---------------MSELTHVRADGSAHMVDVTGKNETSRTAVAEGFVKMRGDVVKQLF
MOAC2_MYCTU      ----MARASGASDYRSGELSHQDERGAAHMVDITEKATTKRTAVAAGILRTSAQVVALIS
MOAC_STRCO       -MSTQDRPSGSGQDPQDRLTHIDEAGAARMVDVSGKDVTARTARASGRVLVAPRVVELLR
MOAC_DEIRA       --------MSDPQGDAPQLTHFVG-GQPRMVDVSAKAPTTRTARAEAWVLLPPESRAALL
MOAC_AGRFC       ------------MSDGQKLTHIDASGEAHMVDVGDKAETVRVAVAEGFVKMKPETLALIR
MOAC_RHIME       -------------MSGPALTHIDSAGEASMVDVGDKAETVRVAVAEGFVRMKPETLALIR
MOAC_BRUME       --------------MSGKLTHIDQTGAANMVDVGSKDETERQAVAEGAVRMKPETLALIL
MOAC_RHILO       --------------MTSALTHLGAQGEANMVDVGDKEETTRTAIAEGFVSMQPETLKTIL
MOAC_BRADU       MARKPSKTRPSKAKSGPALTHIGATGEARMVDVSDKPATERLAVAEGRVLMTRATLDLIV
MOAC1_MYCTU      -----------MIDHALALTHIDERGAARMVDVSEKPVTLRVAKASGLVIMKPSTLRMIS
MOAC3_MYCTU      -----------MNDHDGVLTHLDEQGAARMVDVSAKAVTLRRARASGAVLMKPSTLDMIC
MOAC_PASMU       ---------------MSTFTHINCQGEANMVDVSGKQESVREARAEALVTMSPETLNMII
MOAC_HAEIN       ---------------MTTFTHINSQGEANMVDVSAKAETVREARAEAIVTMSKETLSMIV
MOAC_VIBCH       --------------MMSQLTHINASGEANMVDVSNKADTVREARAEAYVRMAPETLQLIL
MOAC_SALTI       ---------------MSQLTHINAAGEAHMVDVSAKAETVREARAEAFVTMRSETLAMIV
MOAC_SALTY       ---------------MSQLTHINAAGEAHMVDVSAKAETVREARAEAFVTMRSETLAMIV
MOAC_ECOLI       ---------------MSQLTHINAAGEAHMVDVSAKAETVREARAEAFVTMRSETLAMII
MOAC_YERPE       ---------------MTQLTHINTAGEAHMVDVSAKNETVREARAEAFVDMQAATLAMII
MOAC_PSEAE       -----------------MLTHLDSQGRANMVDVTEKAVTSREATAEAVVRMRPETLQLIQ
MOAC_RALSO       ---------------MPHLTHFDTAGQAHMVDVGDKAVTHRVAVATGLIHMLPTTFALVR
MOAC_CAUVC       ---------------MSKLTHIDDQGRARMVDVSEKPATAREAVAAGFVRMSAETLALAI
MOAC_RHOS4       ---------------MSGLTHFDESGRAHMVDVSEKPVTARVAVARGAVKMSAETLALVT
MOAC_NOSS1       -------MQAPFPKNSANLTHLDGQGQAQMVDVSDKAQTIRQAVAAAQVRMLPATLEAIQ
MOAC_XANAC       ---------MPANSRSARLTHLDDAGLPTMVDVSDKAVTARSATAESRVRFPAAVAAQLR
MOAC_XANCP       ---------MPAKTTSARLTHLDDAGLPTMVDVSDKQVTARSATAESRVHFPAAVAAQLR
                                   ::*      . *:*:  *  : * *     .           

MOAC_BACHD       GGKI--RKGDVLAVAQIAGVMAAKNTSQWIPMCHPLSLTGVDISFEWEETRNH-YLLHIE
MOAC_BACSU       SHDI--GKGDVLAVAQVAGIMAAKQTSNIIPMCHPLSLSGVDISFDWKIKEAE-VILHIK
MOAC_STAAM       NNTN--TKGNVLNTAQIAGIMAAKNTSTIIPMCHPLPLTGIDVHFSWDETNAPLYTLNIQ
MOAC_STAAW       NNTN--TKGNVLNTAQIAGIMAAKNTSTIIPMCHPLPLTGIDVHFSWDETNAPLYTLNIQ
MOAC_STACT       DHTN--KKGNVLNTAQIAGIMAAKNTSTIIPMCHPLSLTGIDIAFEWDTTSS--YTLNIE
MOAC_CLOAB       EGTI--SKGDVLAVAQVGGIMGAKSTSQIIPMCHNILISNCDINFKFDFENSE---IEIV
MOAC_CLOPE       SGQI--GKGDVLGVARVAGIMAMKNTSNLIPMCHPVMITGSSIDFEIDSEKNE---IRIT
MOAC_LISIN       AGKI--AKGDVLAVAQVAGIMAAKKTSELIPMCHPIMTTKADISFDDD-GKTA---LTIT
MOAC_LISMO       AGKI--AKGDVLAVAQVAGIMAAKKTSELIPMCHPIMTTKADISFEDD-GKTA---LTIT
MOAC_HELPY       NHCV--KKGPVLQTAIIAGIMGAKKTSELIPMCHPIMLNGVDIDILEEKETCS---FKLY
MOAC_HELPJ       NHGV--KKGPVLQTAIIAGIMAAKKTSELIPMCHPIMLNGVDIDILEEKETCS---FKLY
MOAC_CAMJE       NNTA--KKGPVLQTAIVAAIMGVKKTSEIIPMCHPLMLSKVETNIVEFVKECA---FKLI
MOAC_PAENI       SDGL--PKGDALAVARISGILATKKTSELIPLCHPLPVSQATVDFVLGSD-RV---QTLC
MOAC_CORGL       SAGL--PKGDALPVARIAGIMGAKKTPDIIPLCHPLPLGKITVDFFELTD-GV---R-IE
MOAC2_MYCTU      TGGL--PKGDALATARVAGIMAAKRTSDLIPLCHQLALTGVDVDFTVGQL-DI---E-IT
MOAC_STRCO       GEGV--PKGDALATARIAGIMGAKRTPDLIPLCHPLSVSGVKLDLSVADD-AV---E-IT
MOAC_DEIRA       AGQT--PKGDPLSVARLAGLAGSKRTADLIFLCHPIPVTSAEVDVTLKDA-GI---H-IT
MOAC_AGRFC       DGNA--KKGDVIGTARLAGIMAAKQTANLIPLCHPLMLTKVAVDITEDTGLPG---LRVE
MOAC_RHIME       QGNA--KKGDVIATARLAGIMAAKQTSSLIPLCHPLMLTKVSVDITPDDALPG---LRVE
MOAC_BRUME       EGNA--AKGDVIGTARLAGIMAAKRTSDLIPLCHPLMLTKVAVEIEPDENLPG---LRVR
MOAC_RHILO       AGNA--KKGDVLGTARIAGIMAAKKTHELIPLCHPLLLTKISVDIEPDHALPG---LKVT
MOAC_BRADU       SGNA--KKGDVLGTARIAGIMAAKRTSELIPLCHPLALSKVTVDIEPDAKLPG---CLVR
MOAC1_MYCTU      DGAA--AKGDVMAAARIAGIAAAKRTGDLIPLCHPLGLDAVSVTITPCEP-DR---VKIL
MOAC3_MYCTU      HGTA--AKGDVIATARIAGIMAAKRTGELIPLCHPLGIEAVTVTLEPQGA-DR---LSIA
MOAC_PASMU       SGQH--HKGDVFATARIAGIQAAKRTWDLIPLCHPLLLSKVEVSLTPVVERNQ---VRIE
MOAC_HAEIN       EGKH--HKGDVFATARIAGIQAAKRTWELIPLCHPLLLSKVEVNLEPLLETNQ---VRIQ
MOAC_VIBCH       SGQH--HKGDVFATARIAGIQAAKRTWELIPLCHPLLLSKVEVQLEALPEQSS---VRIE
MOAC_SALTI       DGKH--HKGDVFATARIAGIQAAKRTWELIPLCHPLLLSKVEIQLQAEPEHNR---VRIE
MOAC_SALTY       DGKH--HKGDVFATARIAGIQAAKRTWELIPLCHPLLLSKVEIQLQAEPEHNR---VRIE
MOAC_ECOLI       DGRH--HKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKVEVNLQAEPEHNR---VRIE
MOAC_YERPE       DGSH--HKGDVFATARIAGIQAAKKTWELIPLCHPLLLTKVEVKLEAQPEHNR---VRIE
MOAC_PSEAE       DGGH--PKGDVFAVARIAGIQAAKRTHELIPLCHPLLLTSVKLELQAEAP-DA---VRIR
MOAC_RALSO       DGTA--KKGDVLGIARIAAIQGAKRTSDLIPLCHPLALTKVAVDFELDEADRT---VRCT
MOAC_CAUVC       SGSG--RKGDVRAVAELAGVMAAKKTSDLIPLCHPLALSKV--EVAVEPADGG---LSVT
MOAC_RHOS4       EGRA--EKGDVLGVARLAGIMGAKRTADLIPLCHPLPITKVALELTADPALPG---VVVE
MOAC_NOSS1       AGNT--PKGDVLATARLAGIMAAKQTANLIPLCHPLPLQKVAVEITPDPQLPG---YQIQ
MOAC_XANAC       ANGLRSAKGGIVETAVIAGTMAVKRTHELIPFCHPLPIDACRFGIDWAGEQV----LDIR
MOAC_XANCP       ANGLRSAKGGIVETAVIAGTMAVKRTHELIPFCHPLPIDGCRFEIDWAGAQV----LQIV
                        **     * :..  . * *   * :** :        .               

MOAC_BACHD       ASVKTTGRTGVEMEALTAASATALTVYDMCKAIDKGMVIGPTYLVKKTGGVHGDFERSSS
MOAC_BACSU       AQVKTKGSTGVEMEALTSASVCALTVYDMCKALDKGMVIGPTFLLEKTGGKNGDFKRELS
MOAC_STAAM       TTVSTTGKTGVEMEALTAASATALTIYDMTKAVDKGMIIGETYLESKSGGKSGDFQRQSG
MOAC_STAAW       TTVSTTGKTGVEMEALTAASATALTIYDMTKAVDKGMIIGETYLESKSGGKSGDFQRQSN
MOAC_STACT       ATVSTSGKTGVEMEALTAASATALTVYDMTKALDKGMVIGETYLLTKSGGKSGDYRRESK
MOAC_CLOAB       AMTKTVGKTGIEMEALTAVSAAALTIYDMCKAIDREMVISDIMLVKKSGGKSGDFERVGL
MOAC_CLOPE       ATSKVVHKTGVEMEALTGVSIAALTIYDMCKAVDKRMVIGDIHLVKKLGGKSGEFNF---
MOAC_LISIN       SEVVTVGKTGVEMEALTAVTIAALTIYDMCKAMDKGMQIEKTYLVEKTGGKSGTFKAEA-
MOAC_LISMO       SEVVTVGKTGVEMEALTAVTIAALTIYDMCKAMDKGMRIEKTYLVEKTGGKSGTFKAEA-
MOAC_HELPY       ARVKTQAKTGVEMEALMSVSIGLLTIYDMVKAIDKSMTISGVMLEHKSGGKSGDYNAKK-
MOAC_HELPJ       ARVKTQAKTGVEMEALMSVSIGLLTIYDMVKVIDKSMTISGVMLEHKSGGKSGDYNAKK-
MOAC_CAMJE       VTVKCEGKTGVEMEALSGVSIGLLTIYDMIKAIDKSMRITDIVLESKEGGKSGKFVRS--
MOAC_PAENI       KAVKTRGVTGVEMEALTAVSVAALNLYDMFKAIDKHAVLTDIRVLAKSGGKSGDWDLGTS
MOAC_CORGL       ASVKTRGVTGVEMEALTAVSTAALTVYDMIKAVDKMAVIDGIRVLSKTGGKSGDWSVQ--
MOAC2_MYCTU      ATVRSTDRTGVEMEALTAVSVAALTLYDMIKAVDPGALIDDIRVLHKEGGRRGTWTRR--
MOAC_STRCO       ATVRTTDRTGVEMEALTAVSVAALTVVDMVKAVDKGAVITDVRVEQKTGGKSGDWTRS--
MOAC_DEIRA       ALVKTTAPTGVEMEALTAVTVAALNVYDMLKATSKAIEVSGVRLLSKTGGKSGDYQAAER
MOAC_AGRFC       AMVKLSGKTGVEMEALTAVSIACLTIYDMAKAADKGMEIVNIRLLEKSGGKSGDFRRQES
MOAC_RHIME       AMAKLTGRTGVEMEALTAVSVACLTIYDMAKAADREMEIGGVRLVSKSGGRSGDYHRAGE
MOAC_BRUME       ALARLKGRTGVEMEALTAASVTCLTIYDMAKAVDRHMEIGSIRVIEKSGGKSGDWAVSDP
MOAC_RHILO       ALARVTGKTGVEMEALTAASVACLTIYDMAKAVDRAMLISGIRLVEKTGGKSGDYKVGA-
MOAC_BRADU       ASVKVTGPTGVEMEALTAVSVACLTIYDMIKAVERGVRIEGIHLVEKLGGKSGHYRA---
MOAC1_MYCTU      ATTTTLGRTGVEMEALTAVSVAALTIYDMCKAVDRAMEISQIVLQEKSGGRSGVYRRSAS
MOAC3_MYCTU      ATVTTVARTGVEMEALTAVTVTALTVYDMCKAVDRAMTITDIRLDEKSGGRSGHYRRHDA
MOAC_PASMU       SLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDIVIEQVRLLEKCGGKSGHFIAK--
MOAC_HAEIN       SLCKLTGKTGVEMEALTAASVAALTIYDMCKAVQKDIVIEHVRLLEKSGGKSGHFIAEEK
MOAC_VIBCH       SLCKLSGKTGVEMEALTAASVAALTIYDMCKAVQKDIVIENVRLLEKSGGKSGHFKVDA-
MOAC_SALTI       SLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDIVIGPVRLLAKSGGKSGDFKVDAH
MOAC_SALTY       SLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSGGKSGDFKVDAH
MOAC_ECOLI       TLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSGGKSGDFKVEAD
MOAC_YERPE       TCCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMIIGPVRLLTKSGGKSGDFKVDI-
MOAC_PSEAE       ARCRLAGQTGVEMEALTAASVAALTIYDMCKAVDRGMVIEQVQLLEKLGGKSGHYRKEEE
MOAC_RALSO       VRAETHGQTGVEMEALTAVQVGLLTIYDMCKAVDRGMVIGDVRLMEKRGGKSGEWVAQ--
MOAC_CAUVC       ARVKTTGPTGVEMEALTAASVACLTIYDMLKAAEKGMVIEAVRLLEKTGGKSGDWKADQP
MOAC_RHOS4       ATVKTGGQTGVEMEALTAVSVACLTIYDMVKAVEKGMEITGIRLLLKEGGKSGRFEASA-
MOAC_NOSS1       ATVKTKAETGVEMEALTAVSIAALTLYDMAKALEKSMQIESIRLVSKTGGKSGDYFPPAP
MOAC_XANAC       CTVRCVHRTGVEMEALTGASVAALTIYDMCKALSHSMSIGPTKLVSKRGGKRDIGAAQ--
MOAC_XANCP       CTVRCVHRTGVEMEALTGASVAALTVYDMCKALSHTMRIGPTKLLSKRGGKRDIGAAR--
                         **:***** ..    *.: ** *. .    :    :  * **  .       

MOAC_BACHD       QKS-----------
MOAC_BACSU       EYNLEDQK------
MOAC_STAAM       Q-------------
MOAC_STAAW       Q-------------
MOAC_STACT       --------------
MOAC_CLOAB       --------------
MOAC_CLOPE       --------------
MOAC_LISIN       --------------
MOAC_LISMO       --------------
MOAC_HELPY       --------------
MOAC_HELPJ       --------------
MOAC_CAMJE       --------------
MOAC_PAENI       EEKA----------
MOAC_CORGL       --------------
MOAC2_MYCTU      --------------
MOAC_STRCO       --------------
MOAC_DEIRA       PPQP----------
MOAC_AGRFC       --------------
MOAC_RHIME       MR------------
MOAC_BRUME       ASMR----------
MOAC_RHILO       --------------
MOAC_BRADU       --------------
MOAC1_MYCTU      DLACQSR-------
MOAC3_MYCTU      DVKPSDGGSTEDGC
MOAC_PASMU       --------------
MOAC_HAEIN       --------------
MOAC_VIBCH       --------------
MOAC_SALTI       D-------------
MOAC_SALTY       D-------------
MOAC_ECOLI       D-------------
MOAC_YERPE       --------------
MOAC_PSEAE       GQA-----------
MOAC_RALSO       --------------
MOAC_CAUVC       --------------
MOAC_RHOS4       --------------
MOAC_NOSS1       --------------
MOAC_XANAC       --------------
MOAC_XANCP       --------------