CLUSTAL format seed alignment for MF_01227

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PYRG_AZOBR      -----------MTRYIFITGGVVSSLGKGLASAALGALLQARGYKVRLAKLDPYLNVDPG
PYRG_RICCN      -----------MVHFIFVTGGVVSSLGKGLTAASLAMLLQAKGFRVSVRKLDPYLNIDPG
PYRG_BUCAP      ----------MTKNYIFITGGVVSSLGKGIAAASLGAVLEARNLKITIMKLDPYINVDPG
PYRG_ECOLI      ----------MTTNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPG
PYRG_NEIMB      -----------MTKFIFVTGGVVSSLGKGIAAASIAAILESRGLNVTMLKLDPYINVDPG
PYRG_RALSO      -----------MTKFVFVTGGVVSSLGKGIAAASLAAILESRGLKVTLLKLDPYINVDPG
PYRG_XYLFA      -----------MTPLIFVTGGVVSSLGKGIAAASLASILEARGLKVTMVKLDPYINVDPG
PYRG_PSEAE      -----------MTRYIFVTGGVVSSLGKGIASASLAAILEARGLKITMLKLDPYINVDPG
PYRG_HELPJ      ---------MDRAKFIFVTGGVLSSLGKGISSSSIATLLQHCNYQVSILKIDPYINIDPG
PYRG_CAMJE      ---------MKQTKYIFVTGGVLSSLGKGIAAASIATLLKNSGLKVSILKADPYINVDPG
PYRG_AQUAE      -----------MAKYIFITGGVLSSLGKGITSASIASILEEMGYRVTLQKLDPYLNVDAG
PYRG_CHLTE      ------MARPKNVKHIFVTGGVISSLGKGILSASLGLLLKSRGLRVAIQKYDPYINVDPG
PYRG_STRCO      -----MPPKSSTTKHIFVTGGVASSLGKGLTASSLGMLLKARGLRVVMQKLDPYLNVDPG
PYRG_DEIRA      ------------MKYIFVTGGVVSSLGKGVASASLGALLRARGYKVTAVKIDPYINIDAG
PYRG_STAAM      -----------MTKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPG
PYRG_STRPN      ----------MSTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPG
PYRG_CALS4      -----------MAKYIFVTGGVVSSLGKGITAASLGRLLKSRGLSVAMQKFDPYINIDPG
PYRG_SYNE7      -----------MTKFIFVTGGVVSSIGKGIVAASLGRLLKSRGYSVSILKLDPYINVDPG
PYRG_METJA      ---------MKIMKFIFITGGVISSLGKGITAASLGRLLKARGFKVNMIKIDPYLQIDAG
PYRG_AERPE      ---------MSPRKYVIVTGGVLSSVGKGLTTASLALLLSSRGYSVEAIKIDPYINVDAG
PYRG_PYRAE      -----------MPKLIIVTGGVMSGVGKGVVVASIGRILRARGLSVNAVKIDPYINVDAG
PYRG_SULTO      -----------MTKYIIITGGVLSSVGKGTVAASIGLLLKNRGYKITMVKVDPYLNVDAG
PYRG_METKA      ------------MKFVVITGGVVSGIGKGITTASIGRILRARELEVTAVKIDPYINVDAG
PYRG_METMA      ------------MKYIVVTGGVMSGLGKGITIASIGRNLKNKGYKVTAIKIDPYINIDAG
PYRG_ARCFU      ------------MKYIVVTGGVMSGLGKGITAASIGRLFVDMGYRVIPIKIDPYINIDAG
PYRG_HALSA      MPTETEYDPSLGSKFVFVTGGVMSGLGKGITAASLGRLLSNAGFDVTAVKIDPYLNVDAG
PYRG_PYRFU      -----------MTKYIFVTGGVVSGLGKGITSASIGLLMKARGYKTTNIKIDPYINYDAG
PYRG_THEVO      ------------MQYIVVTGGVISGLGKGTITSSIGHILKDSGFKVSSVKIDPYINYDAG
PYRG_THEMA      -----------MKKYVIVTGGVLSGIGKGIFSASLARLMKEHGVDVNVLKIDPYLNVDAG
PYRG_BORBU      --------MKKNLKILVITGGVISGIGKGVTSASIARLFR-YDFRVTPIKCDGYLNTDPG
PYRG_METTH      --------MVHLAKYIVVTGGVVSSIGKGITAASIGRILRSYGLSVTAIKIDPYLNWDSG
PYRG_SPICI      -----------MAKYIFVTGGVVSGLGKGITASSIGVLLKASGLNVFMQKFDPYLNVDPG
PYRG_MYCPU      -----MTLRSKMTKYIFVTGGVVSGLGKGVSAASIGNLLKHRGFKIFVLKLDPYLNIDPG
PYRG_CHLTR      ----------MSFKSIFLTGGVVSSLGKGLTAASLALLLERQDLKVAMLKLDPYLNVDPG
PYRG_CHLPN      ----------MPFKCIFLTGGVVSSLGKGLTAASLALILERQRLNVAMLKLDPYLNVDPG
                               :.:**** *.:***   :::.  :          * * *:: *.*

PYRG_AZOBR      TMSPYQHGEVYVTDDGAETDLDLGHYERFTGVAARRGDNITTGRIYSNVIAKERRGDYLG
PYRG_RICCN      TMNPHEHGEVYVTDDGAETDLDLGHYERFTGVSACKFDSITTGAIYSKLLKDERLGNYAG
PYRG_BUCAP      TMSPIQHGEVFVTEDGAETDLDLGHYERFIRTKMTCLNNFTTGSIYSEVLKKERRGDYLG
PYRG_ECOLI      TMSPIQHGEVFVTEDGAETDLDLGHYERFIRTKMSRRNNFTTGRIYSDVLRKERRGDYLG
PYRG_NEIMB      TMSPFQHGEVFVTDDGAETDLDLGHYERFIDSTMTRRNSFSTGQVYENVIAKERRGDYLG
PYRG_RALSO      TMSPFQHGEVFVTEDGAETDLDLGHYERFVSAKMRKANNFTTGQIYESVIRKERRGEYLG
PYRG_XYLFA      TMSPFQHGEVYVTDDGAETDLDLGHYERFVRTRLSRNNSVTTGRIYQNVICKERRGDYLG
PYRG_PSEAE      TMSPFQHGEVFVTQDGAETDLDLGHYERFVRTTMTQNNNFTTGRVYMDVLRKERRGDYLG
PYRG_HELPJ      TMSPLEHGEVFVTSDGAETDLDIGHYERFLNRNLTRLNNFTTGQIFSSVIENERKGEYLG
PYRG_CAMJE      TMSPFEHGEVFVTDDGAETDLDLGHYERFLDESLSQDNNFTTGRVYQSVIEKERRGEYLG
PYRG_AQUAE      TMSPYQHGEVYVTEDGAETDLDLGHYERFTNAVMTRDNNVTAGRIYYNVISKERKGDYLG
PYRG_CHLTE      TMSPYQHGEVYVTDDGAETDLDLGHYERFLDEPTSQACNLTMGRVYKSVIDKERRGEYLG
PYRG_STRCO      TMNPFQHGEVFVTNDGAETDLDIGHYERFLDRDLDGSANVTTGQVYSTVIAKERRGEYLG
PYRG_DEIRA      TMRPYEHGECFVTASGAETDLDIGNYERFLDLDIPAGSNITTGQVYQEVIRKERAGDYLS
PYRG_STAAM      TMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKFSNVTAGKVYSHVLKKERRGDYLG
PYRG_STRPN      TMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERRGEYLG
PYRG_CALS4      TMSPYQHGEVFVTEDGAETDLDLGHYERFIDVNLTKNSNVTAGKIYWSVITKERKGDYLG
PYRG_SYNE7      TMSPYQHGEVFVTADGAETDLDLGHYERFTDTPMSRLNSVTTGSIYQAVINKERRGDYNG
PYRG_METJA      TMSPYEHGEVFVTEDGGESDLDLGHYERFIDENLTKNNNITTGKIYWSVLTKERKGEYLG
PYRG_AERPE      TMNPYMHGEVFVTEDGGETDLDIGHYERFLGKNLSRKHNITTGQIYFSVISKERSGDYLG
PYRG_PYRAE      TMNPYAHGEVFVTYDGGETDLDLGHYERFLDVELSKRNNITSGQIYLTVIEKERRGEYLG
PYRG_SULTO      TMNPYMHGEVFVTDDGAETDLDLGHYERFVGINMYSYNNITAGKVYFEVIKNERQGKYLG
PYRG_METKA      TMNPFQHGEVFVTEDGVETDLDLGHYERFMDVTLSGAHNITTGKIYQRVIEKERRGDYLG
PYRG_METMA      TMSPYQHGEVFVLRDGGEVDLDLGNYERFLDTELTRDHNITTGKVYQEVIAKERRGDYLG
PYRG_ARCFU      TMNPFQHGEVYVLKDGTEVDLDLGHYERFIGEEVTGDHNITTGKIYKRVIEKERKGDYLG
PYRG_HALSA      TMNPYQHGEVYVLDDGGEVDLDLGNYERFLDEDMTSDHNVTTGKVYQDVIERERSGDYLG
PYRG_PYRFU      TMNPYQHGEVFVLDDGGEVDLDLGNYERFLDTELTFDHNITTGKVYSTVIEKERRGEYLG
PYRG_THEVO      TMNPYQHGEVFVLDDGSEVDLDLGNYERFMDINLSWKNNITTGKVYLEVIEKERHGDYLG
PYRG_THEMA      TMNPNQHGEVFVTEDGYEADLDLGHYERFLGRDMTRQNNMTAGQVYLRVIEKERQGKYLG
PYRG_BORBU      TINPVEHGEVFVLDDGGEVDMDFGHYERFLNLNAKSSWNITMGKIYKKILENERKGKYLG
PYRG_METTH      TLNPYQHGEVFVTDDGMETDLDLGHYERFLDSDLPGEANITTGKVYMSVINKERSGDYLG
PYRG_SPICI      TMSPYQHGEVFVTTDGAETDLDLGHYERFIDENLTKESNITSGRIYKNVIEKERRGEYDG
PYRG_MYCPU      VMSPYEHGEVYVTADGGETDLDLGHYERFIDVELSKDSNYTSGKIFSNLFTQERNGNFLG
PYRG_CHLTR      TMNPYEHGEVYVTDDGVETDLDLGHYHRFSSVQLSKYSTATSGQIYTKVLTKERNGEFLG
PYRG_CHLPN      TMNPFEHGEIYVTDDGVETDLDLGHYHRFSSAALSRHSSATSGQIYARVIKREREGDYLG
                .: *  *** :*  .* * *:*:*:*.**         . : * ::  ::  ** *.: .

PYRG_AZOBR      ATVQVIPHVTDQIKDFIGAETTDE-----DFILCEIGGTVGDIESTPFLEAIRQFGNEVG
PYRG_RICCN      VTVQVIPHVTNIIKDFILSNTKGF-----DFIICEIGGTVGDIEGLPFFEAIRQIGNKLK
PYRG_BUCAP      STIQVIPHITNAIKDRIILCSKNS-----DIILVEIGGTVGDIESLPFLEAIRQLAVDIG
PYRG_ECOLI      ATVQVIPHITNAIKERVLEGGEGH-----DVVLVEIGGTVGDIESLPFLEAIRQMAVEIG
PYRG_NEIMB      GTVQVIPHITDEIKRRIHEGAAGY-----DVAIVEIGGTVGDIESLPFLEAIRQMRSQLG
PYRG_RALSO      KTVQVIPHITNEIQAFIERGAKASHDGKADVAIVEIGGTVGDIESLPFLEAARQMSLRLG
PYRG_XYLFA      ATVQVIPHITDEIRRCIDEATASF-----DVALVEIGGTVGDIESLPFLEAIRQVRIERG
PYRG_PSEAE      ATVQVIPHITDEIKRRIIKGAGDA-----DVALVEIGGTVGDIESQPFLEAIRQLRVEIG
PYRG_HELPJ      KTIQIVPHVTDEIKRRIKSAAKGL-----DFLIVEVGGTVGDMEGMFYLEAIRQLKLELG
PYRG_CAMJE      KTIQVIPHIVGEIKDRIKKAGEGK-----DILIVEIGGTVGDIEGLPFLEAIRALRLEVG
PYRG_AQUAE      ATVQVIPHITEEIKESIKRVEKDN-----DIVIVEIGGTVGDIEGLPFLEAVRQLSLELG
PYRG_CHLTE      GTVQVVPHVIDEIKEKMGDLAKNGS---IDVLITEIGGTIGDIESLPFLEAMRQLKLELG
PYRG_STRCO      DTVQVIPHITNEIKHRIRRMA-TDE---VDVVITEVGGTVGDIESLPFLETVRQVRHEVG
PYRG_DEIRA      QTVQVIPHVTDEIKRRIRAAGESAG---AEIVLIEVGGTVGDIESLPFLEAIRQFRFDEG
PYRG_STAAM      GTVQVIPHITNEIKERLLLAGESTN---ADVVITEIGGTTGDIESLPFIEAIRQIRSDLG
PYRG_STRPN      ATVQVIPHITDALKEKIKRAALTTD---SDVIITEVGGTVGDIESLPFLEALRQMKADVG
PYRG_CALS4      ATVQVIPHITDEIKERVYRVAKEKN---VDVVITEIGGTVGDIESLPFLEAIRQVAIEQG
PYRG_SYNE7      GTVQVIPHITAEIRDRIHRVAQDTH---PDVVITEIGGTVGDIESLPFLEAIRQFRKDVG
PYRG_METJA      KTVQVIPHITNEIKDWIKNLGE--G---YDITIVEIGGTVGDIESLPFLEAIRQFKKDVG
PYRG_AERPE      QTVQVIPHITDEIKSRIKEVGDVSG---ADVVIVEIGGTVGDIEGLPFLEAARQMRLEEG
PYRG_PYRAE      QTVQLIPHVTDEIKRRIVEAS--GG---YDVTLVEIGGTVGDYEQLPFLEAARQLGLELG
PYRG_SULTO      QTVQIIPHVTDQIKSMIRYASNMAN---ADITIVEIGGTVGDIEGLPFLEAVRQLKLEEE
PYRG_METKA      ETVQVIPHITDEIKSWIREVGKASG---ADVVLVEIGGTVGDIEGMPFYEAVRQLQLEEG
PYRG_METMA      KTVQIIPHITNEIKNKIRKVAARSG---ADVCLIEIGGTVGDIESMPFLEAVRQMHREEP
PYRG_ARCFU      QTVQIIPHVTDEIKSWIRRVAKESN---AEICLVEIGGTVGDIEGMPFLEAIRQMHNEEK
PYRG_HALSA      KTVQIIPHVTDDIKRRVREAAE--G---SDVCLVEVGGTVGDIEGMPFLEALRQFSHEQD
PYRG_PYRFU      ATVQVIPHITDEIKRRIREIAK--D---YEVVVVEIGGTVGDIESMPFLEAARQMQLEEG
PYRG_THEVO      KTVQIIPHITDEIKRRIRDVATSSK---ADFVLIEVGGTVGDIESMPFLEAVRQLKREE-
PYRG_THEMA      NTVQIVPHLTEEIKDRIRALEA-------ELLVVEIGGTVGDIEGEVFLEAVRELQMEEG
PYRG_BORBU      RTVQLIPHVTDEIKSTIFQIASSEN---SDMLIIEIGGTVGDMENILFIETVRQIRQEIG
PYRG_METTH      SCVQIIPHITDEIKSMIRKIADKSG---AEVVLVEVGGTVGDIEGQPFLEALRQLRNEEG
PYRG_SPICI      GTVQVVPHVTNEIKKKVYHAASTSK---ADIIITEIGGTVGDIESLPFIEAIRQVRMEQG
PYRG_MYCPU      KTVQLIPHFTNEILNTIEKIATKHK---PDFMIVEIGGTIGDIESNSFIYAMAELALAK-
PYRG_CHLTR      STVQVIPHVTNEIINVIQSCADHHK---PDILIVEIGGTIGDIESLPFLEAVRQFRCEH-
PYRG_CHLPN      STVQVIPHITNEIIQVILDAAKEHS---PDVLIVEIGGTIGDIESLPFLEAIRQFRYDH-
                  :*::**.   :   :            :. : *:*** ** *   :  :   .     

PYRG_AZOBR      PENALFIHLTLLPYIPTAGELKTKPTQHSVKELLGMGIQANILLCRADRPIPENERKKIA
PYRG_RICCN      SENCLFIHLTLLPYVKTARELKIKPTQHSVKALRAIGISPNILVCRAERNISKGEIDKIS
PYRG_BUCAP      RKNVIYIHLTLVPYIKTAGEIKTKPTQHSVKELLSIGIQPDILICRSQKTVPINERKKIA
PYRG_ECOLI      REHTLFMHLTLVPYMAASGEVKTKPTQHSVKELLSIGIQPDILICRSDRAVPANERAKIA
PYRG_NEIMB      RNNTLFAHLSYVPYIAAAGEIKTKPTQHTVKEMLSIGLQPDILICRMDRTMPADERRKIA
PYRG_RALSO      RNQAAFVHLTLVPFIASAGELKTKPTQHSVQKLREIGVQPTALLCRADRPIPDDERAKIS
PYRG_XYLFA      AERTMFMHLTLVPYIAAAGELKTKPTQHSVKELRSIGIQPDVLLCRSEQVIPDSERRKIA
PYRG_PSEAE      AKRAMLMHLTLVPYIATAGETKTKPTQHSVKELRSIGLQPDVLVCRSDHPIDVSSRRKIA
PYRG_HELPJ      NEKVINVHVTLIPYIQTTNELKTKPTQHSVQELRRLGVTPQIILARSPKPLDKELKKKIA
PYRG_CAMJE      KNNAMNIHLTLVPFIKAAGELKTKPTQHSVGELRRIGISPDMIICRSEKALDRDLKDKIA
PYRG_AQUAE      RKNSMFIHLTYVPYIKAAGELKTKPTQHSVKELRAIGIQPDMIICRADRELPKGIKSKIA
PYRG_CHLTE      EHNLLNIHLTFVPYIKAASELKTKPTQHSVKMLLETGIQPDILVCRSEKPLSREIKNKVG
PYRG_STRCO      RDNVFVVHISLLPYIGPSGELKTKPTQHSVAALRNIGIQPDAIVLRCDREVPTAIKRKIS
PYRG_DEIRA      DDNVLYLHLTLVPYLGTSNEFKTKPTQHSVAALRSYGISPDIVMVRSKDKLPAEITRKIA
PYRG_STAAM      RENVMYVHCTLLPYIKAAGEMKTKPTQHSVKELRGLGIQPDLIVVRTEYEMTQDLKDKIA
PYRG_STRPN      ADNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPAGQGIKNKLA
PYRG_CALS4      RENVMFIHVTLVPHLGNTGELKTKPTQHSVKELRSIGIQPDMIVCRTELPLPQELREKIA
PYRG_SYNE7      RRDLAYIHVTLVPWIPSAGEMKTKPTQHSVKELRSIGIQPDILVCRCDRPLQAGMKEKMS
PYRG_METJA      KENVLYIHVSLLPYIRAAGELKTKPTQHSVKELRSIGIQPDILICRTEMPISDKIREKLA
PYRG_AERPE      FDNTFFIHVALSPYLPTTGEQKTKPVQHSIQELRRIGIQPDAVVVRSHQPLEQEGLRKIA
PYRG_PYRAE      -EDVVFIHVAWVPLLKITGEFKTKPLQHSVAELRRYGIQPDAVVVRSEKPIDANSIKKIA
PYRG_SULTO      EGNVVFVHVALVEFLKVTEEIKTKPLQHSVQELRRIGIQPDIIVARSVVPLDEETKKKIA
PYRG_METKA      RENVMFVHLTYVPYLEHVHELKTKPTQHSVKELRSLGIQPDAIVCRCERPLDDGVKRKIA
PYRG_METMA      SENIVFIHVTLVMEDLQ-GEQKTKPTQHSVKELRALGLSPEVIVTRSKTPLQESAKEKIA
PYRG_ARCFU      EEDFALVHVTLVPLDAG-GEQKTKPTQHSVKELRELGLHPDVIVGRCSERLKPATKKKIA
PYRG_HALSA      DEDILFTHVTLVPYSKN-GEQKTKPTQHSVKELRSIGLQPDILVGRCEDRLDPDVREKIA
PYRG_PYRFU      RDNVAFVHVTYVPKLKVVGEQKTKPTQHSVKELRSLGIQPDAIVARSEDPLEEAARKKIS
PYRG_THEVO      -NNVIFAHVTLVPEIGPTEEQKTKPTQHSVKALREIGIQPDIIFARSKNRLLEETKKRIS
PYRG_THEMA      KENFLFAHVTYVPYLRTTNEFKTKPTQQSVQLLRRIGITPDMVIVRSEFPLDVPSMNKVA
PYRG_BORBU      SGNISFIHLTYVPSPAGINEQKSKPTQQSVKTLNKAGIFPDLIIARSSQVLTDQIRKKVA
PYRG_METTH      HENVMFVHVTYVPYLRAAGEFKTKPTQHSTKELRSTGINPDMIICRSEMPIDSSLKRKIA
PYRG_SPICI      RENVIYMHVSLVPYIAASKESKTKPTQHSVRELLSLGIQPDIVVARTEQALDDNVLEKIA
PYRG_MYCPU      PDRFFLVHVTYVIFLEASNEFKSKPTQVSINSLRSFGISPNLVLLRNSKMVPDNIVEKIA
PYRG_CHLTR      PQDCLSIHMTYVPYLRAAKEIKTKPTQHSVQNLRSIGISPDVILCRSEAPLSTEVKRKIS
PYRG_CHLPN      SEDCLNIHMTYVPYLQAADEVKSKPTQHSVQTLRGIGIIPDAILCRSEKPLTQEVKSKIS
                       * :         * * ** * :   :   *: .  :. *           ::.

PYRG_AZOBR      LFCNIRPERVIAALDVD-SIYQVPVSYHEEGFDTQVLAYFGLP---TEGKPDLSR----W
PYRG_RICCN      LLCNIESEYVVPAIDQK-NIYLVPIAYHNSGLDNKVLKFFNIN---IM-PSKLDK----W
PYRG_BUCAP      LFCNVPVNAVISLKDVD-SIYTIPKLLKDQKLDNYICEYFKLN----VPQADLKE----W
PYRG_ECOLI      LFCNVPEKAVISLKDVD-SIYKIPGLLKSQGLDDYICKRFSLN----CPEANLSE----W
PYRG_NEIMB      LFCNVEERAIVGSYDVD-SIYECPEMLHDQGIDNIITEQLQLN----VQQADLTA----W
PYRG_RALSO      LFANMPQDAVISVWDVD-TIYKIPQMLNEQGLDRIICEELRID----APPADLSM----W
PYRG_XYLFA      LFTNVSERAVIGCPDID-VLYGMPLELRRQGLDEIVIDQFKLSG--TASLADLSE----W
PYRG_PSEAE      LFTNVEERAVIALEDVD-TIYRIPSVLHAQGLDDIVVERFGLE----CGQADLSE----W
PYRG_HELPJ      LSCDVEQDSVIVATDTK-SIYACPILFLQEGILTPIARRFNLN----KLHPKMAA----W
PYRG_CAMJE      ISCGVEKNCVIESVDAA-SIYQIPLNFLKQDILSPIAEILDLK----NLKPNMEN----W
PYRG_AQUAE      LFTNVKEEAVISAPDLE-FSYEVPLKLKEQGIDRIITERLNLEH----REVNLGK----W
PYRG_CHLTE      HFCNVHDLDVIGLNDCD-TIYEVPLMLLKEQLDLRVMKKLGLKKF---REPNLEY----W
PYRG_STRCO      LMCDVDEAAVVACPDAR-SIYDIPKVIHTEGLDAYVVRRMDLPFR----DVDWTT----W
PYRG_DEIRA      AFTSVRENRVFSSYDVE-HVYQVPLALEEQGLGKAVEELLGLEGT----HPRLGV----W
PYRG_STAAM      LFCDINKESVIECRDAD-SLYEIPLQLSQQNMDDIVIKRLQLNAKY---ETQLDE----W
PYRG_STRPN      QFCDVAPEAVIESLDVE-HLYQIPLNLQAQGMDQIVCDHLKLDAP----AADMTE----W
PYRG_CALS4      LFCNVSVEAVIENRDVE-SIYQVPLELERQKVDEYVIKRLNLPLG----QSDLKE----W
PYRG_SYNE7      EFCNVSPEAVITSQDAS-SIYEVPLMLEREGLAEQVLDILQLEQR----QPDLTQ----W
PYRG_METJA      LFCDVDKEAVIEARDAR-TIYEVPLNLEKEGLGKLVTKKLNLPDR----EPDLDE----W
PYRG_AERPE      LYATLPMENVINSYDIE-NIYRLPLLLEKQGLARLVERRLFGR----ETRPDLSR----W
PYRG_PYRAE      LFAHVPQWAIFNSYDVD-TIYRVPLILEQQGLGDFLTRRLRLP----SRSPEYRD----W
PYRG_SULTO      LFTNVKPEYIFSNYDVN-MTYEVPLILEKQGLASKILSKLNLP----DNQPNLSE----W
PYRG_METKA      LHTNVPREAVIDAHDVD-LVYKVPLLLERQGFGDYICERLGLD----ADEPDYSD----W
PYRG_METMA      LFCDVPQELVISAHDAG-DIYEVPLEIEEQGLTTQLMKHLR-----LESGVDDGG----W
PYRG_ARCFU      LFCDVPEEAVISNEDAE-DIYEVPLIFKREKLDEYLMRKLN-----LRAKESRKE----W
PYRG_HALSA      LFCDVPMDAVFSNPDVE-DIYHVPLTVEEEGLDQYVMEQFDMVEDALPAAQRSTE----W
PYRG_PYRFU      LFTNVPEEAVISAYDVE-DTYEVPLLLEREGLGKYLTKRLKLE----DREPDLKD----W
PYRG_THEVO      LFTDVPEGGIISVYDVE-NVYLLPEVMVNEGFISYLSKLSG------KEIKYRDS----W
PYRG_THEMA      LFSGVPRDFVINLPDTK-NVYEVPEILRDMGLHEKIASKLNV-----ELKK---------
PYRG_BORBU      MFCNVESTSIIDNVDVS-TIYEIPISFYKQGVHEILSSKLNI-----KVDPKIEELSKLV
PYRG_METTH      HFCDVEEEAVVNAPDAS-SIYEVPLVLDSERVGDYIVRRIELD---VDGEADLSE----W
PYRG_SPICI      LFCNIEKSNVLVATDVA-SILWSHKMYE-QNAQIVISKLLNLK----SLKTDMSE----W
PYRG_MYCPU      KKSVLNKDYVISVPDMK-NIYEAPLYFESQNIAQIILSHFKIK----DIEPDLSK----W
PYRG_CHLTR      LFCNVPEHAVFNAIDLERSIYEMPLLLAKENISDFLLNKLGFS----PKPLDLSD----W
PYRG_CHLPN      LFCNVPNRAVFNVIDVKHTIYEMPLMLAQEKIANFIGEKLKLA----TVPENLDD----W
                    :    :.   *                    :                        

PYRG_AZOBR      TSIVERVRKPQG-EVTIAVVGKYTSLLDSYKSLAEALTHGGIANNVKVKLDWIDSEIF-E
PYRG_RICCN      HDIINRLKDSNS-KVRIAIIAKYHKLKDAYKSVIEALDHAGIYYKYKIDLVWINAENL-T
PYRG_BUCAP      EKVIYEEKNASK-EIIIGIIGKYIKLPDAYKSVIEALKHAGLKNKIKVKIELINSQ---E
PYRG_ECOLI      EQVIFEEANPVS-EVTIGMVGKYIELPDAYKSVIEALKHGGLKNRVSVNIKLIDSQ---D
PYRG_NEIMB      KKIVHAIQNPKH-TVKIAMVGKYVDLTESYKSLIEALKHAGIHTETDVQITFVDSENI-E
PYRG_RALSO      SRMVHTLENPQH-EITIGMVGKYVDLTESYKSLIEALRHAGLHTSTRVNIEYIDSE---E
PYRG_XYLFA      EDVVDAIKHPLD-EVTIAVVGKYVDYQDAYKSVGEALKHGGLRQRTKVNLKWVEAQ---D
PYRG_PSEAE      DRVVDAKLNPER-EVTIAMVGKYMELLDAYKSLIEAMTHAGIQSRTKVNLRYIDSE---D
PYRG_HELPJ      NTLVEKIIAPKH-KVKIGFVGKYLSLKESYKSLIEALIHAGAHLDTQVNIEWLDSE----
PYRG_CAMJE      DSLVKRVIAPSN-EVKIAFVGKYVDLKESYKSLTEAIIHAGAALDTKVELKWVDSEKL-E
PYRG_AQUAE      KKIVNVLRNPEE-EVNVALVGKYVELKDSYKSVIEALIHGGIANKVKVNVILKNSE----
PYRG_CHLTE      KNFCEKVKHPKDGEITIGICGKYTEYPDAYKSIIESFIHAGASNDVRVLVKMLRAEDAED
PYRG_STRCO      DDLLDRVHNPEH-EIVMALVGKYIDLPDAYLSVTEALRAGGFANKARVKIKWVTSDDCKT
PYRG_DEIRA      TDAVRTIKHPKQ-QVTIAIAGKYTAMPDAYLSLMESLTHAGIANDARVNIKWVNAEQLAE
PYRG_STAAM      KQLLDIVNNLDG-KITIGLVGKYVSLQDAYLSVVESLKHAGYPFAKDIDIRWIDSSEVTD
PYRG_STRPN      SAMVDKVMNLKK-QVKISLVGKYVELQDAYISVVEALKHSGYVNDAEVKINWVNANDVTA
PYRG_CALS4      REYVEKEKNPEH-QVEVALVGKYVDLHDAYISVVEALKHAGVYHKTAVNIRWVNAEKVND
PYRG_SYNE7      QRWVHQLQNPSR-RVEVVIVGKYVRLNDAYLSVSESLRHAAASADADLQLRWVDAEDLEN
PYRG_METJA      RKFVDRVINPLN-EVTIGIVGKYVELKDAYLSITEALIHAGAKNDTKVNINWIHSERLES
PYRG_AERPE      EEFVALYEKASR-RVKVAMVGKYTKLRDSYISIVEALKHASAYEGVRPELLWVESTDIER
PYRG_PYRAE      EEFLSKLSAPKY-RISVGMCGKYVELPDAYLSIVEALKHAGAALDARPELVWINSVEVEK
PYRG_SULTO      IRFIDNLKTADK-EVKIALVGKYTKLKDSYISIKEAIYHAAAKLHIKPVLVWIESTDIEN
PYRG_METKA      LDFVTRIEEADD-EIRIAVVGKYVDLPDAYISIREALVHAGAHVGVGVDVAWVDSEALEA
PYRG_METMA      REMVARMKSTTD-EVKLAIVGKYTNLEDSYLSILEAVKHGGIDNACRVEVNMVEAETLEE
PYRG_ARCFU      EEMVKRMKTLYE-EASIAIVGKYVDVRDAYLSIKEALKHGGIEAGCKVNIVWVDSEDLEN
PYRG_HALSA      RDLVTRERT--G-EVDIALVGKYA-LEDAYMSIHEALKHASLEAGVEVNVLWVDSEKMHD
PYRG_PYRFU      EKMVAKYKALTE-TVEIAIVGKYVKLQDSYLSIKEALKHASVSNEVKVKIRWIEAEDVET
PYRG_THEVO      KAYTENIKHPKD-RVKIAIVGKYVDLHDAYISHKEAFSHVTGNTGIAVDIKWLDSEKVKD
PYRG_THEMA      STFNWSYPKAFK-PYRIALVGKYLGTDDAYKSIIESVFLTGIEKPTVVDSQMLEDMNDEE
PYRG_BORBU      GVIKSNFFVPKK-IINIAICGKYAELDDSYASIRESLVHVAAHLDLLIKSTLID--SNDL
PYRG_METTH      AGIVESLMIDEP-VVTVGIVGKYVELEDSYISIREALKHAAAHLRVRVDIEWISADDAVN
PYRG_SPICI      KRFVEKINQS-QQVIEIKLVGKYIELPDAYLSVSESLRIAGYENKVKIKIDWIKAEDVNK
PYRG_MYCPU      NKLVDSIKKPKAYKAKILMVGKYVEFLDAYKSIIEAFKVSSYEENIDLKMDWVDSSKLEL
PYRG_CHLTR      QDLVEALCDKERQHVRIGLVGKYLEHKDAYKSVFESLFHASVPANCSLELVPIAPE----
PYRG_CHLPN      RVLVNQLS-QDLPKVKIGVVGKYVQHRDAYKSIFEALTHAALRLGHAAEIIPIDAE----
                                : . .**    ::* *  *:.                       

PYRG_AZOBR      ----DESAVQRLENV------HGILVPGGFGSRGTEG-----KIRAAQFARERKVPYFGI
PYRG_RICCN      ----EENINKKLLDI------DGILVPGGFGERATKG-----TIIAIKYARTNNIPFFGI
PYRG_BUCAP      I---ENKNFKLLQNL------NGILIPGGFGDRGIIG-----KLLSVQYARENNIPYFGI
PYRG_ECOLI      V---ETRGVEILKGL------DAILVPGGFGYRGVEG-----MITTARFARENNIPYLGI
PYRG_NEIMB      K---NKGDVSMLKDM------DAILVPGGFGSRGVEG-----KIAAVRYARENNVPYLGI
PYRG_RALSO      L---ESGHTQVLESL------DAILVPGGFGKRGTEG-----KIRAIQYAREKTVPYLGI
PYRG_XYLFA      L---EGSDMGALKDI------DGILVPGGFGDRGFEG-----KVLASRYAREQRVPYFGI
PYRG_PSEAE      I---EQQGTSLLEGV------DAILVPGGFGLRGVEG-----KISTVQYARENKIPYLGI
PYRG_HELPJ      ----NFNEKTDLEGV------DAILVPGGFGERGIEG-----KICAIQRARLEKLPFLGI
PYRG_CAMJE      ----NMESSEVFKDV------SGILVAGGFGYRGVEG-----KIKAIQYARENKIPFLGI
PYRG_AQUAE      ----QLDISELQEDI------HGIMVPGGFGERGIRG-----KIEALNFGRENNIPTFGI
PYRG_CHLTE      P---KFDISSAFKGI------SGLLVAPGFGDRGIEG-----KVRFVQYARENNIPFFGI
PYRG_STRCO      PA--GARV--QLGDV------DAICIPGGFGERGVTG-----KVGAIQYARENGIPLLGL
PYRG_DEIRA      AG--AGELEGQFADV------DGILVPGGFGIRGIEG-----KVKAAEYARTHGVPYLGI
PYRG_STAAM      EN--AAEY---LADV------DGILVPGGFGFRASEG-----KISAIKYARENNVPFFGI
PYRG_STRPN      EN--VAEL---LSDA------DGIIVPGGFGQRGTEG-----KIQAIRYARENDVPMLGV
PYRG_CALS4      KT--VDEL---LKGA------DGILVPGGFGDRGIEG-----KIRAIQYARENKIPYLGL
PYRG_SYNE7      GD--PATY---LDGV------DGIVVPGGFGARGVDG-----KVAAIQFARDHQIPFLGL
PYRG_METJA      EE--FEEL---LDRYREDNQLDGILVPGGFGDRGVEG-----KINAIKYARENDIPFLGI
PYRG_AERPE      GVVDVDRV---FEEA------DGAIVLPGFGVRGVEG-----KIEAIRRFREGKKPMLGI
PYRG_PYRAE      NP-DILRK---LD-L------DAIVVLPGFGKRGTEG-----MIECIRHARMEKIPFLGI
PYRG_SULTO      SK-EAIDK---LKSV------DGIIVLPGFGSRGVEG-----KILAIKYARENNVPFLGI
PYRG_METKA      GDSEAWEE---VKDA------DGVLVPGGFGKRGVEG-----KIEAVRYARENDVPFLGI
PYRG_METMA      DL-VEVEK---LKQY------DGILIPGGFGGRGTEG-----KMLAIKFARENDIPFLGI
PYRG_ARCFU      ----VDDF---TLDV------DGILVPGGFGARGAEG-----KIRAIEYARENGVPFLGI
PYRG_HALSA      H---HERR---IADA------DGIVVAGGFGSRGTAG-----KIDAIQHAREHDVPFLGL
PYRG_PYRFU      H---GTKL---LEGV------DGIIIPGGFGARGAEG-----KIQAIRYARENDIPFLGI
PYRG_THEVO      ----DQSM---LSDV------DAILIPGGFGYRGVEG-----KIAATRFALENHIPFLGI
PYRG_THEMA      ----VKKV---LDEY------DALIIPGGFGRRGVEG-----KIKAIKYARENKKPILGI
PYRG_BORBU      ----NESC---LKEF------DGIIVPGGFGGKGYEG-----KIMAIKYARENNIPFLGI
PYRG_METTH      -----EED---LSRL------DSILIPGGFGERGIAG-----KLEAVRFALENRVPIFGI
PYRG_SPICI      K---NDQQ--LLKNA------KGILVPGGFDERGFEGRGFEGKILACQFARENNIPFFGI
PYRG_MYCPU      T---NLDE--FLKGY------DGVVILPGFGIRGWEQ-----KVRIAQYTRENKIPTFGI
PYRG_CHLTR      ----SEDLLEQLSQC------DGCLIPGGFGTRSWEG-----KISAARYCRERNIPCFGI
PYRG_CHLPN      ----DENLTMELSQC------DACLVPGGFGVRGWEG-----KIAAAKFCREQGIPYFGI
                                      .  :  **. :.         :   .       * :*:

PYRG_AZOBR      CFGMQMAVIESARNMAGIVDAGSTEL---GKP-GNPVVGLLGLMTEWMRGNSLEKRTEGT
PYRG_RICCN      CFGMQLATIEIAQNLIGIKDAVTEEF---KVD-GTKII-------EKINKNCEDSKITIE
PYRG_BUCAP      CLGMQIAIIEFAQNVIGIKEANSTEF---DPQCKFPVIDLIKTKKNDIKDTRQGKKNNKS
PYRG_ECOLI      CLGMQVALIDYARHVANMENANSTEF---VPDCKYPVVALITEWRD--ENGNVEVRSEKS
PYRG_NEIMB      CLGMQIALIEYARDVAGLKGANSTEF---DLKCAAPVVALIDEWQT--ADGSVETRDEST
PYRG_RALSO      CLGMQLAVIEFARHVAGMQDANSTEF---NLETEHPVVALITEWQD--RDGRVEKRSADS
PYRG_XYLFA      CYGMQAAVVDYARHVAGLEGANSTEN---DRQSPHPVIALITEWRT--TTGEVERRDEKS
PYRG_PSEAE      CLGMQVAVIEYARNVLGWSDANSTEF---DKSSGHPVVGLITEWQD--ATGATEIRTEAS
PYRG_HELPJ      CLGMQLAIVEFCRNVLGLKGANSTEF---NQRCEYPVVYLIEDFMD--QNHQKQVRTYNS
PYRG_CAMJE      CLGMQLALVEFARNVLKLKDVNSSEF---NEKCQNPVVYLIDEFMD--TNGEKQIRTAKT
PYRG_AQUAE      CLGMQLMAIEFARNVLGFSNANSTEF---DPDTPFPVIDIMEE------------QKKVD
PYRG_CHLTE      CLGMQCATIEFARNICDLPDANSTEF---NKRTRFPVIDLMEH------------QKKVK
PYRG_STRCO      CLGLQCIVVEAARNLAGVADANSTEF---DPATAHPVVSTMAE------------QLDIV
PYRG_DEIRA      CLGMQIAVIEYARHVAGIEDANSAEF---DEYAKNKVIDLMPE------------QLEVA
PYRG_STAAM      CLGMQLATVEFSRNVLGLEGAHSAEL---DPATPYPIIDLLPE------------QKDIE
PYRG_STRPN      CLGMQLTCIEFARHVLGLEGANSAEL---APETKYPIIDIMRD------------QIDIE
PYRG_CALS4      CLGMQCAVIEFARNVAGLKGANSTEF---DPNTPHPVIDLMPE------------QKDID
PYRG_SYNE7      CLGMQAAVIDWARNVAGLDGANSAEF---DPETPHPVIALLPE------------QQDVV
PYRG_METJA      CMGMQCAVIEFARNVCGLEGANSTEF---DENTKYPVVDLLPE------------QKEID
PYRG_AERPE      CFGMQLSVVEYARNVLGLKEAHTTEV---NPETPHPVVDLLPE------------QRGID
PYRG_PYRAE      CFGMQLAVVEFARNVLGLKGANSTEL---DPETPHPVVHLAPE------------QREVD
PYRG_SULTO      CYGMQLAVVEFARNVLGLEKAHTTEV---DPNTPHPVITLLDE------------QKKVV
PYRG_METKA      CLGFQLVVVEYARSVLGLEDAHSTEF---NPDTDHPVVDLLPE------------QRGVK
PYRG_METMA      CLGMQLAVIEFARNVANLENANSTEF---DEDTPYPVIDILPE------------QTGVA
PYRG_ARCFU      CFGFQLAVIEFARNVVGFSEANSTEL---DENTPHPVIDLLPE------------QKGID
PYRG_HALSA      CLGFQLAVVEYARNVLGMTGAHSAEI---DEDTEYPVIDLLPE------------QYDLE
PYRG_PYRFU      CFGFQLTVVEFARNVLGMKGAHSTEI---DPQTPYPVVDLMPE------------QRNLD
PYRG_THEVO      CLGFQVAVIEIARDIIGLQNANSTEF---DPATKYPVIDILPE------------QKGIK
PYRG_THEMA      CLGMQLMVIEFARNVFGYKEANSTEF---DPNTPYPVVDLMEE------------QKRIL
PYRG_BORBU      CLGLQLAVIEFARNVCGILDADTEENLARDKPLKSPVIHLLPE------------QKGIK
PYRG_METTH      CLGMQCMVIEFAR-LNGMEGANSTEF---DPETPYPVIDMMEE------------QKRIK
PYRG_SPICI      CFGMQAAVIEFARNVCHIQDANSSELTE-TKNA---IIDIIRG------------KDKTD
PYRG_MYCPU      CLGFQAMSVAHAR-MKGIKNANSREFAN-DKNDETYILDLIQG------------KAKDK
PYRG_CHLTR      CLGMQALVVEYARNVLDKPLANSMEI---NPETPDPVVCMMEG------------QD-SV
PYRG_CHLPN      CLGMQVLVVEYARNVLNLDQANSLEM---DPNTPHPIVYVMEG------------QDPLV
                * *:*   :  .: :     . : *           ::                 :    

PYRG_AZOBR      D----VGGTMRLGTYPAKLVPGSKVAEVYGT-T--DITERHRHRYEVNVY-YKDRLEK-V
PYRG_RICCN      N----VKKTMRLGSYPCSLVASTIAANAYKS-L--EINERHRHRYKFNNE-FQNIFEK-H
PYRG_BUCAP      N----FGGTMRLGSQPCKLIFNSLSRKLYKK-D--TIIERHRHRYEVNNF-LLKKIEK-N
PYRG_ECOLI      D----LGGTMRLGAQQCQLVDDSLVRQLYNA-P--TIVERHRHRYEVNNM-LLKQIED-A
PYRG_NEIMB      D----LGGTMRLGAQEVELKAGSLAAKIYGS-G--HIRERHRHRYEVNNN-YVPTLEQ-A
PYRG_RALSO      D----LGGTMRLGAQRVPVQTGTKASQIYGA----EVNERHRHRYEVNNH-YVPQLEK-S
PYRG_XYLFA      D----LGGTMRLGLQEQRLKAGTLVRELYGR-D--VVGERHRHRYEFNNR-YRTQLED-A
PYRG_PSEAE      D----LGGTMRLGAQECQLQTGTLVHDCYAK-D--VIVERHRHRYEVNNN-LLPQLEQ-A
PYRG_HELPJ      P----LGGTMRLGEYECEIMPNSLLEKAYKK-P--NIKERHRHRYEINPK-YRQEWEN-K
PYRG_CAMJE      P----LGGTMRLGAYKCDIKEKSLLAKVYNEVK--SVKERHRHRYEANPK-YRADFEK-Y
PYRG_AQUAE      K----LGGTMRLGAYPCKVKENTLAHRIYQK-D--LIYERHRHRYEFNNR-YRKDFES-K
PYRG_CHLTE      E----KGGTMRLGSYPCILKEGSKAHELYGK-F--LINERHRHRYEFNNQ-FRKLFEE-K
PYRG_STRCO      AGEGDMGGTMRLGMYPAKLAEGSIVREVYDGKE--YVEERHRHRYEVNNA-YRAELEKKA
PYRG_DEIRA      G----MGGTMRLGDWPMELRAGTKIAELYGVPQGGTVKERHRHRYEVNPA-YVEQLEA-A
PYRG_STAAM      D----LGGTLRLGLYPCSIKEGTLAQDVYGKAE--I-EERHRHRYEFNND-YREQLEA-N
PYRG_STRPN      D----MGGTLRLGLYPSKLKRGSKAAAAYHNQE--VVQRRHRHRYEFNNA-FREQFEA-A
PYRG_CALS4      E----KGGTMRLGVYPCKVIEGTKAYEVYKDEL--V-YERHRHRYEFNNQ-YRELLTS-K
PYRG_SYNE7      D----LGGTMRLGLCPCKIQSGSLAQRLYGEDI--I-YERHRHRYEFNNA-YRSLFLE-S
PYRG_METJA      A----KGGTMRLGAYPAILMEGTLAYKLYGRKE--V-YERHRHRYEVNPE-YHEILEN-H
PYRG_AERPE      K----LGGTMRLGARPVRIVEGTILWSLYG-RE--LASERHRHRYEVNPT-YVDRLVE-A
PYRG_PYRAE      V----LGGSMILGNREVEIVPGTLAASLYG-VS--VITERHRHRYEVNLS-YLPKFTE-A
PYRG_SULTO      Q----IGGTMRLGSQKVIVKEGTLAYRIYG-NI--EVYERHRHRYEVNPE-YVDLLQK-G
PYRG_METKA      R----KGGTMRLGAEPVVLEEGSLLRRLYDDRE--IVLERHRHRYEVNPS-YVRELED-H
PYRG_METMA      D----MGGTMRLGDYDAILKEGSFATKLYG-TN--YIVERHRHRYEVNPE-FVDRLES-F
PYRG_ARCFU      E----MGGTMRLGDIEVTIKPGTIAHKLYG-SE--KVVERHRHRYEVNPE-YIEKIES-K
PYRG_HALSA      D----LGGTMRLGAHETAIEPGTLAHDLYG-AT--SCTERHRHRYEVNPE-YIDDLTA-D
PYRG_PYRFU      R----LGGTMRLGAYPVKIKKGTLAYSLYN-KE--LVYERHRHRWEVNPN-YIEALEK-A
PYRG_THEVO      D----LGGTMRLGSKKVLIKDGTLAKRIYG-TD--TIYERHRHRYEVNPN-YISIIEK-A
PYRG_THEMA      K----LGGTMRLGAQKVKIFPKTKLYEVYGGVE--EVYERHRHRYEANEEAFPELFKK-P
PYRG_BORBU      D----KGATMRLGGYPVILKKNTIAFKLYGQ-D--RIIERFRHRYEVNND-YIDLFAK-N
PYRG_METTH      N----MGGTMRLGSYQCRIREGTLAHEAYG-TE--LVGERHRHRFELNNE-FREELES-K
PYRG_SPICI      A----LGGTLRLGNYKTTFVPNTLAHKLYGKKW--G-FRTSRHRYEVNND-YREQLAQ-A
PYRG_MYCPU      N----LGGTLRLGNYTTTIKENTLAKKIYQKDQ--V-IERHRHRYEINSK-YIDLLED-E
PYRG_CHLTR      V----KGGTMRLGAYPCRIAPGSLASAAY-KTD--LVQERHRHRYEVNPS-YIERLEE-H
PYRG_CHLPN      A----TGGTMRLGAYPCLLKPGSKAHKAYNESS--LIQERHRHRYEVNPD-YIQSLED-H
                        :: **     .   :     *         .  ***:: *            

PYRG_AZOBR      G----LLFSGLSPT-Q-----LPEIVEIPD--HPWFIGVQFHPELKSKPFDPHPLFTSFI
PYRG_RICCN      G----IVFSGFSKD-EE----IVEIIELPL--LRWFVGVQFHPEFKSKPFEAHPLFIQFI
PYRG_BUCAP      G----LKIAGRSKK-NN----IVEIIEIFD--HPWFIGCQFHPEFTSTPRDGHPLFIDFI
PYRG_ECOLI      G----LRVAGRSGD-DQ----LVEIIEVPN--HPWFVACQFHPEFTSTPRDGHPLFAGFV
PYRG_NEIMB      G----LVIGGVSAGRER----LVETIELPN--HPWFFACQFHPEFTSNPRKGHPLFTAFV
PYRG_RALSO      G----MIISARTPS-EN----LPEMMELPGAMHPWFVGVQFHPEFTSTPRDGHPLFKAYV
PYRG_XYLFA      G----LVIAAKSMD-DT----LVEMIELPREMHPWFLACQAHPEFLSTPRDGHPLFIGFV
PYRG_PSEAE      G----LKISGRSGD-GA----LVEVVEAPE--HPWFVACQFHPEFTSTPRDGHPLFSGFV
PYRG_HELPJ      G----LKVVGFGAN--H----LIEAIELED--HPFFVGVQFHPEFTSRLQSPNPIILDFI
PYRG_CAMJE      G----LIVSG-ESK--G----LIEAVELNC--HPFFLAVQFHPEFTSRLEHVNPVICSFI
PYRG_AQUAE      G----VVFSGTSPD-DK----LVEIMELKN--HMWYLGCQFHPEFKSKPFAPHPLFRDFI
PYRG_CHLTE      G----MIFSGTSPN-GD----LVEIVELKN--HRWFVAVQFHPELKSRVQKVHPLFDGFV
PYRG_STRCO      G----IVFSGTSP--DGK---LVEYVEYPRDVHPYLVATQAHPELRSRPTRPHPLFAGLV
PYRG_DEIRA      G----LTISGVTPGVEGRGAGLVETVEIAD--HPFFVALQAHPEFKSRPMRPSPPFAGFV
PYRG_STAAM      G----MVISGTSP--DGR---LVEMVEIPT--NDFFIACQFHPEFLSRPNRPHPIFKSFI
PYRG_STRPN      G----FVFSGVSP--DNR---LVEIVEIPE--NKFFVACQYHPELSSRPNRPEELYTAFV
PYRG_CALS4      G----LVISGLSP--DER---LVEIIELKD--HPYFVATQFHPEFKSRPLNPHPLFRDFV
PYRG_SYNE7      G----YCVSGTSP--DSH---LVEIVERPD--HPFFIACQFHPEFVSRPNHPHPLFQGLI
PYRG_METJA      G----LTISGKSP--DGR---LAEFIEISK--NRYFIATQAHPEFKSRPNKPHPLFDGLV
PYRG_AERPE      G----LVVSAWSQ--E----GYVEAVELRPRDHPFFLATQFHPEFKSRPLNPAPVFKGFV
PYRG_PYRAE      G----LVVSGWRR--DI---KRVEIIELP--GHPYFIATQFHPEFKSRPAKPRPVFLGLL
PYRG_SULTO      G----LVISGVSE--N----GLVEMIELK--NHKFFLGLQGHPEYKSRPLAPSPVFIGFL
PYRG_METKA      G----LRFSGHSP--D----GRMEALELP--DHPYFVGTQFHPEFKSRPGDPSPPFVGLI
PYRG_METMA      G----IVFSGKNK--N-----RMEIAEIP--GKRFFFASQFHPEFKSRPGRPSPPFKGLV
PYRG_ARCFU      G----LVFSAYSD--GG---RRMEIAELP--DHPFFFATQFHPEFKSRPYRPSPPFVGFV
PYRG_HALSA      G----LTFSGEAG--N-----RMEIVEHD--DHPFFFGTQFHPEYRSRPTRASPPFVGLL
PYRG_PYRFU      G----LVFSGVAG--DDE--RRMEILELP--DKRYFIATQFHPEFKSRPMRPAPVFHGLV
PYRG_THEVO      G----FVFSGTDE--DG---IRMEILEKK--GDESFIATQYHSEFKSRPLNPSRVHLHLV
PYRG_THEMA      GEEGYKLVVSAKS--DF---IEA--VELE--DHPFFVGVQFHPEYKSKVGAPHPIFVYLR
PYRG_BORBU      G----LIVSGFSS--DF---KMAKLIEIP--ENKFFVACQFHPELITRIENPAKLFLGLI
PYRG_METTH      G----LIISGTSP--DD---FLVEMVEIK--DHPWFLGCQFHPEFRSRPNRAHPLFVSFL
PYRG_SPICI      G----LVFSGLYV--EKN---LVEVIEIPK--YPFYLAAQYHPEFTSRPNKPNPLFNGFV
PYRG_MYCPU      E----FVFSGIWN--EGK---LAEICEVKN--HPFYLGVQYHPEFTSRPLKPNPLFTSFL
PYRG_CHLTR      G----LKIAGVCPLGE-----LCEIVEIPN--HRWMLGVQFHPEFLSKLAKPHPLFIEFI
PYRG_CHLPN      G----LRIVGTCPPQG-----LCEIIEVSD--HPWMIGVQFHPEFVSKLISPHPLFIAFI
                       . .                *         .. * *.*  :             

PYRG_AZOBR      KAAIEQSRLV---------------------
PYRG_RICCN      KAAIEYNKCN---------------------
PYRG_BUCAP      KSAKKNKKNNFKIKVKNV-------------
PYRG_ECOLI      KAASEFQKRQAK-------------------
PYRG_NEIMB      KAALNNKKA----------------------
PYRG_RALSO      EAALAHRQRQAQRAVA---------------
PYRG_XYLFA      KAARARKAGGKLLREVCV-------------
PYRG_PSEAE      NAALKYSGKA---------------------
PYRG_HELPJ      KSALHKS------------------------
PYRG_CAMJE      KAAINYEDN----------------------
PYRG_AQUAE      RACLEY---KRKFT-----------------
PYRG_CHLTE      HAAKEFAQGKRQLSLEVEMPRLSSTEMENAG
PYRG_STRCO      KAAVERKTSK---------------------
PYRG_DEIRA      KAALEHQQQ----------------------
PYRG_STAAM      EASLKYQQNK---------------------
PYRG_STRPN      TAAVENSN-----------------------
PYRG_CALS4      KAMLNLKINNAE-------------------
PYRG_SYNE7      KAALGSDLTLVDPAPLPAETV----------
PYRG_METJA      RASLGEKIK----------------------
PYRG_AERPE      TAVARLRG-----------------------
PYRG_PYRAE      KAALFAKR-----------------------
PYRG_SULTO      RAAAGV-------------------------
PYRG_METKA      KAAAGQGPD----------------------
PYRG_METMA      RAMCKYR------KEREVQ------------
PYRG_ARCFU      RAALKYR------REEEI-------------
PYRG_HALSA      DAVLERADVAPAGSDADVEVTN---------
PYRG_PYRFU      RAAKEYK------QEKNVTH-----------
PYRG_THEVO      QQALIYK------KNKDIGEAVKLRSSV---
PYRG_THEMA      KVLEGSQ------------------------
PYRG_BORBU      KACI---------------------------
PYRG_METTH      RAALERSR-----------------------
PYRG_SPICI      QAVIKNK------------------------
PYRG_MYCPU      RVLIKNN------------------------
PYRG_CHLTR      RAAKAYSLEKANHEHR---------------
PYRG_CHLPN      EAALVYSKDASHV------------------