CLUSTAL format seed alignment for MF_01228

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYM_MYCTU       ----------MKP------YYVTTAIAYPNAAPHVGHAYEYIATDAIARFKRLDRYDVRF
SYM_MYCLE       ----------MRP------YYITTAIAYPNAAPHIGHAYEYIATDAIARFKRLDGLDVRF
SYM_AGRFC       ----------MTDK---TPFYITTAISYPNGKPHIGHAYELIATDAMARFQRLDGMDVFF
SYM_RHIME       ----------MRDT---SPFYITTAISYPNGKPHIGHAYELIATDAMARFQRLDGREVFF
SYM_BRUME       ----------MSRE---K-YYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYF
SYM_BRUSU       ----------MSRE---K-YYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYF
SYM_RHILO       ----------MSRE---K-YYLTTPIFYPNGKPHIGHAYTVIATDALARFQRLDGKDVFF
SYM_GEOSE       ---------MEKK----T-FYLTTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYDVMY
SYM_ALKHC       -------MSKEQK----T-FYLTTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYNVMY
SYM_LISIN       -------MPEEKN----T-FYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFY
SYM_LISMO       -------MPEEKN----T-FYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFY
SYM_BACSU       -------MPQENN----T-FYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRY
SYM_STAAM       ---------MAKE----T-FYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRY
SYM_STAAW       ---------MAKE----T-FYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRY
SYM_STRP1       --------MMK-K----P-FYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFY
SYM_STRP3       ---------MK-K----P-FYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFY
SYM_STRP8       ---------MK-K----P-FYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFY
SYM_STRPN       --------MSE-K----N-FYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVFY
SYM_LACLA       --------MTENK----T-FYITTPIYYPSGKLHLGSSYTTIACDVLARYKRLMGFDTFY
SYM_OCEIH       --------MAREN----A-FYITTPIYYPSGKLHIGNAYTTIACDVMARYKRMRGFDVFY
SYM_CLOPE       ---------MCKK----P-YYITTPIYYPSTNLHIGNTYTTVAADAIARFKRLTGHEVMF
SYM_CALS4       ----------MKK----T-FYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVMF
SYM_CLOAB       --------MSEKK----K-FYITTPIYYPSAKLHIGNTYTTVASDALVRFKRLQGYDAFM
SYM_MYCGE       ----------MKR------CYITTPIYYASGKPHIGHAFTTILADVIKRFKIQNGYEAFL
SYM_MYCPN       ----------MKR------CYITTPIYYASGKPHIGHAFTTILADVIKRYKQQNGYEAYF
SYM_MYCPU       ----------MKK----T-IYITTPIYYPSGDLHLGHIYSTNIAWVLRNYKKIQGYETFF
SYM_UREPA       --------MLKQK----K-FFISTPIYYSSGNPHIGHAYTTIIADVLARYKRLFGYDVFF
SYM_FUSNN       ----------MKK----N-FFVSTPIYYVNGDPHVGSAYTTIAADVINRYNKAMGMDTHF
SYM_THEMA       ------------M----K-FYITTPIYYVNSEPHIGSAYTTIVADIIARYKRFMGYDVFF
SYM_HELPJ       ----------MQK------SLITTPIYYVNDIPHIGHAYTTLIADTLKKYYTLQGEEVFF
SYM_HELPY       ----------MQK------SLITTPIYYVNDIPHIGHAYTTLIADTLKKYYTLQGEEVFF
SYM_CAMJE       ----------MR--------YITTPIYYVNDVPHLGHAYTTIIADTLARFYRLQGHETRF
SYM_AQUAE       -------MTLMKK------FYVTTPIYYVNDVPHLGHAYTTIAADTIARYYRLRDYDVFF
SYM_THET8       ----------MEK----V-FYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFF
SYM_STRCO       -----MAATGTEKQGAKA-YYVSTPIYYVNDAPHLGHAYTTVAGDVLTRWHRQRGEKVWY
SYM_SYNY3       ------MLDSSVP----T-FSVTTPLYYVNDVPHLGSAYTTVVADTLARFKRLQGYDVLM
SYM_THEEB       ----------MSP----H-FSLTTPLYYVNALPHIGSAYTTIAADVLARFYRLQGYQVRF
SYM_NOSS1       ----MNLVNKAEK----T-FALTTPLYYVNDVPHIGSAYTTMAADAVARFQKLLGRDVLL
SYM_RICPR       ----------MKN----T-YYITTPIYYVNDVAHIGHAYTSVASDVIARFMRFCGKDVMF
SYM_RICCN       ----------MNN----T-YYITTPIYYVNDIPHIGHAYTSVASDVIARFMRLRGFDVMF
SYM_DEIRA       MQNPPQHPEAQSPETRDREFFITAAIDYANGTPHIGHVYEKILADAIARYQRLAGRDVTF
                                     :::.: * .   *:*  :       : .:       .  

SYM_MYCTU       LTGTDEHGLKVAQAAAAAGVPTAALARRNS-DV-FQRMQEALNISFDRFIRTTDADHHEA
SYM_MYCLE       LTGTDEHGLKVAQAAEAAGVPTAQLARRNS-GV-FQRMQEALHISFDRFIRTTDADHYKA
SYM_AGRFC       LTGTDEHGQKMQQTARAEGISPEELAQRNS-DQ-FREMGKLLNASNDDFIRTTEERHHET
SYM_RHIME       LTGTDEHGQKMQQTAKKEGISPQELAARNS-AE-FQNMARLLNASNDDFIRTTEQRHHEA
SYM_BRUME       LTGTDEHGIKMLQSARKEGITPRELADRNT-SA-FRRMAEVLNSSNDDYIRTSEERHYKA
SYM_BRUSU       LTGTDEHGIKMLQSARKEGITPRELADRNT-SA-FRRMAEVLNSSNDDYIRTSEERHYKA
SYM_RHILO       LTGTDEHGLKMQQTAEKEGITPQALADRNS-AI-FRSMTEAVGGSNDEYIRTTEPRHYAS
SYM_GEOSE       LTGTDEHGQKIQRKAQEKGVTPQQYVDDIV-AG-IQELWRKLDISYDDFIRTTQERHKKI
SYM_ALKHC       LTGTDEHGQKIEQKAEAKGLTPKQFVDEIV-SG-IQDLWKKLDISYDDFIRTTEERHIKV
SYM_LISIN       LTGTDEHGQKIQAKAKERGISEQEYVDEIA-EG-FQELWKKLEISNTDFIRTTQDRHKTS
SYM_LISMO       LTGTDEHGQKIQAKAKERGISEQEYVDEIA-EG-FQELWKKLEISNTDFIRTTQDRHKTS
SYM_BACSU       LTGTDEHGQKIQQKAEQENITPQEYVDRAA-AD-IQKLWKQLEISNDDFIRTTEKRHKVV
SYM_STAAM       LTGTDEHGQKIQEKAQKAGKTEIEYLDEMI-AG-IKQLWAKLEISNDDFIRTTEERHKHV
SYM_STAAW       LTGTDEHGQKIQEKAQKAGKTEIEYLDEMI-AG-IKQLWAKLEISNDDFIRTTEERHKHV
SYM_STRP1       LTGLDEHGQKIQTKAKEAGITPQTYVDNMA-KD-VKALWQLLDISYDTFIRTTDDYHEEV
SYM_STRP3       LTGLDEHGQKIQTKAKEAGITPQTYVDNMA-KD-VKALWQLLDISYDKFIRTTDDYHEEV
SYM_STRP8       LTGLDEHGQKIQTKAKEAGISPQTYVDNMA-KD-VKALWQLLDISYDTFIRTTDDYHEEV
SYM_STRPN       LTGLDEHGQKIQQKAEEAGITPQAYVDGMA-VG-VKELWQLLDISYDKFIRTTDDYHEKV
SYM_LACLA       LTGLDEHGMKIQRKAEELGMTPKEYLDPMA-AD-VQELWKKLDISYDKFIRTTDTYHEEA
SYM_OCEIH       LTGSDEHGQKIEQKAKEMNISPKAYVDDMA-EG-MKKLWNTLEISNDKFIRTTEEQHKKV
SYM_CLOPE       LTGTDEHGQKIERIANEKGITPKEHVDEIV-AG-IKDLWKMMNISYDKFIRTTDDYHVKA
SYM_CALS4       LTGTDEHGQKIQRIAREKGMSPKEYVDGIV-EW-IKDLWKTMDISYDHFIRTTDAYHEEI
SYM_CLOAB       LTGTDEHGQKIQRIAEDKGITPKAYVDEIV-AG-IKDLWKMMNISYDKFIRTTDEEHVKA
SYM_MYCGE       LVGSDEHGNKIESKAKSLNLDPKTFVDINA-QA-FKLMWKTLNISFDHFIRTTDEIHKQQ
SYM_MYCPN       LTGTDEHGNKIESKAKSLGLDPQTFVDQNV-AY-FQQMWKQLDINFDHFIRTTDLSHKAQ
SYM_MYCPU       STGSDEHGQKIFNKAQELKLETQDYVDRQA-NK-FIDFWKKANIDYDFFARTTNKEHKEV
SYM_UREPA       LTGMDEHGQKIQQKAFEENISPKALVDRNS-II-FLNLWKRLNISFSKFIRTTQMDHEES
SYM_FUSNN       VTGLDEHGQKVEQAAKQNGFTPQAWTDKMT-PN-FKNMWAALDIKYDDFIRTTEDRHKKA
SYM_THEMA       LTGTDEHGQKVLQAAQQAGKDPQEFCDELA-EK-FKRLWKELKITNDYFIRTTDEMHMKT
SYM_HELPJ       LTGTDEHGQKIEQSARLRNQSPKAYADSIS-AI-FKNQWDFFNLDYDGFIRTTDSEHQKC
SYM_HELPY       LTGTDEHGQKIEQSARLRNQSPKAYADSIS-TI-FKDQWDFFNLDYDGFIRTTDSEHQKC
SYM_CAMJE       LTGTDEHGQKIEEAAKLRNSTPQEYADKIS-FE-FKKLWDEFEITYDIYARTTDTRHIEF
SYM_AQUAE       LTGTDEHGLKIQKKAEELGISPKELVDRNA-ER-FKKLWEFLKIEYTKFIRTTDPYHVKF
SYM_THET8       LTGTDEHGETVYRAAQAAGEDPKAFVDRVS-GR-FKRAWDLLGIAYDDFIRTTEERHKKV
SYM_STRCO       LTGTDEHGQKIMRTAEANGVTPQAWADKLVTES-WKPLWEHLDIANDDFIRTTQKRHTDR
SYM_SYNY3       ITGTDEHGQKIQRTAEAQELDPQTHCDRTV-VK-FKELWRSLNILYDRFSRTTDPRHLAI
SYM_THEEB       ITGTDEHGQKIERTAQQRGLSPQAHCDEIA-AG-FQALWQQLNIHYDRFSRTTSPRHHAI
SYM_NOSS1       ITGTDEHGQKIQRSAESLGKAPQEFCDEIV-PS-FMSLWRLLNIQYDRFSRTTAVRHKAI
SYM_RICPR       LTGTDEHGQKVEKAAINQNIDPQTFTDKTS-QN-FRDLMVAMNISNDDFIRTTENRHKKA
SYM_RICCN       LTGTDEHGQKVEKAAINKNIDPQKFTDQTS-ES-FRHLMTAMHISNDDFIRTTEHRHKKA
SYM_DEIRA       VMGTDEHGEKISKAAAKGGVTPQELVDDLS-ERAFQGLWKKLGISYDFFIRTTSAKHKKY
                  * **** .:   *                                 : **:   *   

SYM_MYCTU       SKELWRRMSAAGDIYLDNYSGWYSVRDERFFVESETQLVDGT-------RLTV----ETG
SYM_MYCLE       AKEIWRRMDAAGDIYLGTYSGWYSVRDERFFVDSETKLLDNGI-----RVAVE----TGT
SYM_AGRFC       SRNIWNLMADSGDIYKDSYAGWYSVRDEAYYAEDETEVRADG-------VRYG----PQG
SYM_RHIME       SQAIWMRMGEAGDLYKDSYAGWYSVRDEAYYQENETELRGDG-------VRYG----PQG
SYM_BRUME       SQVIWQAMVANGDIYKGGYAGWYSVRDEAYYGEEETEVRADG-------VRYG----PQG
SYM_BRUSU       SQAIWQAMVANGDIYKGGYAGWYSVRDEAYYGEEETEVRADG-------VRYG----PQG
SYM_RHILO       CQAIWKAMAANGDIYLDRYSGWYSVRQEAYFDESETTLGEDG-------VRRE----PLG
SYM_GEOSE       VEKIFARLVEQGDIYLGEYEGWYCTPCESFYTERQLVDGN-----------CP----DCG
SYM_ALKHC       VQQIFEQLLDQGDIYLGDYEGWYSIPDETFYTETQLVDKEYDADGNLIGGKSP----DSG
SYM_LISIN       VEKIFEQLLEQGDIYLGEYEGWYSVSDEEYFTETQLEEVYKDE-----NGKVIGGKAPSG
SYM_LISMO       VEKIFEQLLEQGDIYLGEYEGWYSVSDEEYFTETQLEEVYKDE-----NGKVIGGKAPSG
SYM_BACSU       IEKVFQKLLDNGDIYLDEYEGWYSIPDETFYTETQLVDIERNEKGEVIGGKSP----DSG
SYM_STAAM       VEQVFERLLKQGDIYLGEYEGWYSVPDETYYTESQLVDPQYENGK-IIGGKSP----DSG
SYM_STAAW       VEQVFERLLKQGDIYLGEYEGWYSVPDETYYTESQLVDPQYENGK-IIGGKSP----DSG
SYM_STRP1       VAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLKEVFRDE-----DGQVIGGIAPSG
SYM_STRP3       VAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLKEVFRDE-----DGQVIGGIAPSG
SYM_STRP8       VAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLKEVFRDE-----DGQVIGGIAPSG
SYM_STRPN       VAQVFERLLAQDDIYLGEYSGWYSVSDEEFFTESQLAEVFRDE----AGNVTGGI-APSG
SYM_LACLA       VAKAFEQLLEQDDIYLGKYAGWYSVSDEEFFTETQLEEIFRDE----SGNITGGI-APSG
SYM_OCEIH       VADIFERFLEQGDIYLDEYEGWYSVPDETFYTETQLEDVERDDDGNVIGGKSP----DSG
SYM_CLOPE       VQEIFKKLYDQGDIYKDSYEGLYCTPCESFWTETQLVNGN-----------CP----DCG
SYM_CALS4       VQKIFMKLYEQGDIYKGEYEGWYCTPCESFWTESQLVDGK-----------CP----DCG
SYM_CLOAB       VQKIVKKFYDNGDIYKSAYEGWYCTPCESFWTETQLVDGK-----------CP----DCG
SYM_MYCGE       VQKTFQDLYDKKLIYQSEWKGAYCVECEQNYFTFNKQTM-----------LC-----EIG
SYM_MYCPN       VQHAFQLLYDKGLIYQSNWEGAYCVECEQNYFTYDKQTM-----------LC-----EIG
SYM_MYCPU       VREIFHKLKEKNIIYLDKYVGLYSVSDEEFLTETQALKKDNK-------FFHP----VSN
SYM_UREPA       VQKVFSYLYKQGKIYLGQWTGYYCVSCEENYNPAEIIKSQDN------IMLC-----RMG
SYM_FUSNN       VKRILDIVNAKGDIYKGEYEGKYCVSCETFFPENQLNGSN----------KCP----DCG
SYM_THEMA       VQEFVAKMKENGDVYKGIYKGWYCVPCETFWNEDEVIKEGEE-------RFCP----ECK
SYM_HELPJ       VQNAFEIMFEKGDIYKGTYSGYYCVSCESYCAVSKVDNTDSK-------VLCP----DCL
SYM_HELPY       VQNAFEIMFEKGDIYKGAYSGYYCVSCESYCAISKADNTNDK-------VLCP----DCL
SYM_CAMJE       IKAMFLKMWQKGDIYKDEYEGHYCISCESFFTQSQLINDC----------SCP----DCG
SYM_AQUAE       VQKVFEECYKRGDIYLGEYEGWYCVGCEEFKSEAELAEDH----------TCP----IHQ
SYM_THET8       VQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTEKELVEG-----------LCP----IHG
SYM_STRCO       VQEFVQDLYDKGEIYKGGYEGPYCVGCEEYKLPGELLDGEGEYA---GQKLCP----IHK
SYM_SYNY3       VKDFFQRVWDKGDIYLAQQQGWYCVACEEFKEKRDLLEDN----------HCPL---HPN
SYM_THEEB       VNEFFQRVWDNGDIYLGQQQGWYCVECEEFKEERELLEGR----------RCPI---HVN
SYM_NOSS1       VDEFFARVWEAGDIYQGQQKGWYCVSCEEFKEERELLEGN----------RCPI---HVN
SYM_RICPR       VAVFWKKLLDNGAIYEGFYEGWYSVRDEAFYDESEINEDK----------LA-----PTG
SYM_RICCN       VAVFWQKLLDNGTIYEGFYEGWYAVRDEAFFDESELTRDG----------LA-----PTG
SYM_DEIRA       VQDVLQRVYDAGDIYFAEYEGLYSVGAERYVTEKELVEGPDG------VRRFP----GDK
                             :*     * *.   *      .                         

SYM_MYCTU       TPVTWTEEQTYFFRLSAYTDKLLAHYHANPDFIAPETRRNEVIS-FVSGGLDDLSISR--
SYM_MYCLE       LVTWTEKEQTYFFRLSAYVDKLLAHYDANPDFIGPEVRRNEVIS-FVSGGLEDFSISR--
SYM_AGRFC       TPVEWVEEESYFFKLSEYQEKLLKLYEENPDFIGPAERRNEIIS-FVKSGLKDLSISR--
SYM_RHIME       TPVEWVEEESYFFRLSAYQDKLLKHYEENPDFIGPAERRNEVIS-FVKSGLKDLSVSR--
SYM_BRUME       TPVEWVEEESYFFRLSAYQDKLLDLYENNPGFIMPAERRNEIVS-FVKSGLKDLSISR--
SYM_BRUSU       TPVEWVEEESYFFRLSAYQDKLLDLYENNPGFIMPAERRNEIVS-FVKSGLKDLSISR--
SYM_RHILO       SPVEWNEEESYFFRLSAYQDKLLALYESQPDFVGPAERRNEVMS-FVKSGLKDLSISR--
SYM_GEOSE       RPVEKVKEESYFFRMSKYVDRLLQYYEENPDFIQPESRKNEMINNFIKPGLEDLAVSR--
SYM_ALKHC       HPVEKVREQSYFFRMSKYADRLLQFYEENPQFIQPESRKNEMINNFIKPGLEDLAVSR--
SYM_LISIN       NEVELVKEESYFFRMSKYADRLVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSR--
SYM_LISMO       NEVELVKEESYFFRMSKYADRLVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSR--
SYM_BACSU       HPVELIKEESYFFRMGKYADRLLKYYEENPTFIQPESRKNEMINNFIKPGLEDLAVSR--
SYM_STAAM       HEVELVKEESYFFNISKYTDRLLEFYDQNPDFIQPPSRKNEMINNFIKPGLADLAVSR--
SYM_STAAW       HEVELVKEESYFFNISKYTDRLLEFYDQNPDFIQPPSRKNEMINNFIKPGLADLAVSR--
SYM_STRP1       HEVEWVSEESYFLRLSKYDDRLVAFFKERPDFIQPDGRMNEMVKNFIEPGLEDLAVSR--
SYM_STRP3       HEVEWVSEESYFLRLSKYADRLVAFFKERPDFIQPDGRMNEMVKNFIEPGLEDLAVSR--
SYM_STRP8       HEVEWVSEESYFLRLSKYADRLVAFFKERPDFIQPDGRMNEMVKNFIEPGLEDLAVSR--
SYM_STRPN       HEVEWVSEESYFLRLSKYQDRLVEFFKAHPEFITPDGRLNEMLRNFIEPGLEDLAVSR--
SYM_LACLA       HEVEWVEEETYFFRMGKYADWLLQYYDEHPDFIQPEVRKNEMVNNFIKPGLEDLALTR--
SYM_OCEIH       HPVELIKEESYFFRMSKYADRLLKFYEDNPEFIQPESRKNEMINNFIKPGLEDLAVSR--
SYM_CLOPE       RPVEKAKEEAYFFKMSKYADRLIQYIEEHPDFIQPESRKNEMLNNFLRPGLQDLCVSR--
SYM_CALS4       RPVERVTEEGYFFRLSAYGDKLLKYYEEHPDFIQPESRRNEMIN-FIKAGLEDLFVSR--
SYM_CLOAB       RPVEKTKEEAYFFKMSKYADRLIKYIEDHPDFIQPESRKNEMLNNFLKPGLQDLCISR--
SYM_MYCGE       HNLSLVQEPCWFISFSSTKNWIETTIGKNQLNIIPKSRASELKNNFINNGLNDLALTR--
SYM_MYCPN       HQLTLVQEPSLFIAFKDSKDWIGEMIATNKLNITPESRAAELKNNFLDGGLNDLALTR--
SYM_MYCPU       HELIKIEEESYFFNLNLFIDWIKEFLDQ--DIISSKAIVNELKSNFINKGLENLSVTR--
SYM_UREPA       HKLETKSEESYFYKMSDQAPFLKTYYQNHPNFIIPNERANEMVN-NFLNNLEDLSISR--
SYM_FUSNN       KDLTVLKEESYFFKMSKYADALLKHIDEHPDFILPHSRRNEVIS-FIKQGLQDLSISR--
SYM_THEMA       RPVKWVEEENYFFRLSKYRDSLLKYYEEHPDFVEPDFRRNEMLK-ILEGGLKDLSITR--
SYM_HELPJ       RETTLLEEESYFFKLSAYEKPLLEFYAKNPEAILPIYRKNEVTS-FIEQGLLDLSITR--
SYM_HELPY       RETTLLEEESYFFRLSAYEKPLLDFYAKNPEAILPVYRKNEVTS-FIEQGLLDLSITR--
SYM_CAMJE       KQTRILKEESYFFKLSKYQDKILQWYEEK-DPILPKNKKNELIN-FVQNGLKDLSITR--
SYM_AQUAE       KKCEYIKEPSYFFRLSKYQDKLLELYEKNPEFIQPDYRRNEIIS-FVKQGLKDLSVTRPR
SYM_THET8       RPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLA-MLAEPIGDLSISRPK
SYM_STRCO       KPVEILSEENYFFKLSEYSEKLLAHYEANPGFVQPESARNEVVN-FVRQGLQDLSISR--
SYM_SYNY3       RKAEWRDEENYFFRLSRYQHPLEELYAQRPEFIQPSSRRNEVLN-FVAQGLQDFSISR--
SYM_THEEB       RTVEWRDERNYFFRLSKYQQALLDHYAEHPDFVQPPSRRNEVLS-FIERGLQDFSISR--
SYM_NOSS1       KEVEWRDEQNYFFRLSKYQTQLEEFYQSHPDFIQPESRRNEVLN-FVSQGLQDFSISR--
SYM_RICPR       APVEWVKEPSYFFNLAKWQDKLLEFYELNPDFVRPISRRNEVIS-FIKSGLKDLSISR--
SYM_RICCN       APVEWVKEPSYFFNLSKWQDKLLEFYEANPDFIRPISRRNEVIS-FVKSGLKDLSVSR--
SYM_DEIRA       DPPELRREANYFFNMQKYQPWLLETLQQNPDLIQPAGYRNEVLE-MLKEDIGPLSISRPK
                       *   *  :      :          : .     *:    .   :  : ::*  

SYM_MYCTU       TSFDWGVQVPE---HPDHVMYVWVDALTNYLTGAGFP-DTDS---ELFRRYWPAD-----
SYM_MYCLE       TSFDWGVQVPE---HPDHVMYVWIDALTNYLTGAGFP-DTDS---ELFGRYWPAN-----
SYM_AGRFC       TTFDWGIKVPD---DPKHVMYVWVDALTNYITATGYI-EDRN---GPRAKYWPAD-----
SYM_RHIME       TTFDWGIKVPN---DPSHVMYVWVDALTNYVTATGCL-TDPT---GPRAKFWPAN-----
SYM_BRUME       TTFDWGIPVPG---DEKHVMYVWVDALTNYITALGYP--DTT---DERWAYWPAN-----
SYM_BRUSU       TTFDWGIPVPG---DEKHVMYVWVDALTNYITALGYP--DTT---DERWAYWPAN-----
SYM_RHILO       TTFKWGVPVPG---DDKHVMYVWVDALTNYITAAGYP--DTK---SDQWRYWPA------
SYM_GEOSE       TTFDWGIKVPG---DPKHVIYVWIDALANYITALGYG-TDND---EKFRKYWPAD-----
SYM_ALKHC       TSFTWGVPVPR---DPKHVVYVWIDALSNYITALGYG-SDQQ---EKYENYWPAD-----
SYM_LISIN       TTFDWGIKVPG---NPKHVVYVWIDALSNYITALGYN-TDND---TKFQKYWPAD-----
SYM_LISMO       TTFDWGIKVPG---NPKHVVYVWIDALSNYITALGYN-TDND---TKFQKYWPAD-----
SYM_BACSU       TTFDWGVKVPE---NPKHVVYVWIDALFNYLTALGYD-TEND---ELYQKYWPAD-----
SYM_STAAM       TSFNWGVHVPS---NPKHVVYVWIDALVNYISALGYL-SDDE---SLFNKYWPAD-----
SYM_STAAW       TSFNWGVHVPS---NPKHVVYVWIDALVNYISALGYL-SDDE---SLFNKYWPAD-----
SYM_STRP1       TTFTWGVPVPS---DPKHVVYVWIDALLNYATALGYR-QANH---ANFDKFWNGTV----
SYM_STRP3       TTFTWGVPVPS---DPKHVVYVWIDALLNYATALGYG-QANH---ANFDKFWNGTV----
SYM_STRP8       TTFTWGVPVPS---DPKHVVYVWIDALLNYATALGYG-QANH---ANFDKFWNGTV----
SYM_STRPN       TTFTWGVPVPS---NPKHVVYVWIDALLNYATALGYA-QDEH---GNFDKFWNGTV----
SYM_LACLA       TSFTWGIPVPS---NPKHVVYVWFDALLNYITALGYN-SDND---SNFKKYWPG------
SYM_OCEIH       TTFSWGVQVPS---NPKHVVYVWIDALTNYITALGYG-SEDT---SLYDKFWPAD-----
SYM_CLOPE       TSFTWGIPVSF---DEKHVIYVWIDALSNYITALGYG-QENQ---ELYKKFWPAD-----
SYM_CALS4       STFDWGIKVPF---DPKHVIYVWIDALSNYITALGYM-TEND---EKFKKYWPAD-----
SYM_CLOAB       SSFDWGIPITF---DEKHVIYVWIDALSNYITALGYG-SDND---ELYNKFWPAD-----
SYM_MYCGE       KNVTWGIKVPF---DPNQTIYVWFDALFSYITNLGFR-NG-D---PNFIKWWNNDNKERE
SYM_MYCPN       QNVTWGIPVPF---DNKQTIYVWFDALFNYITNLGFAHND-----PKFNKWWNNNDEEHE
SYM_MYCPU       IKLDWGIKIDQ---SSKHVIYVWLDALFQYLTNLGYG-SKNQ---SLYEKFWKNGDE---
SYM_UREPA       TTFDWGIPIAE---NPKHVIYVWLDALMNYLTATGYL-SNNE---ELFQKYWCDNET--E
SYM_FUSNN       NTFSWGIPIDF---APGHITYVWFDALTNYITSAGFE-NDE----NKFDKFWNNSR----
SYM_THEMA       TTFKWGVPMKD---DPEHVIYVWVDALINYISAIGYGWND-----EMFNKWWPAD-----
SYM_HELPJ       TSFEWGIPLPKKMNDPKHVVYVWLDALLNYASALGYL-NGLD---NKMAHFERA------
SYM_HELPY       TSFEWGIPLPKKMNDPKHVVYVWLDALLNYASALGYL-NDLD---NKMAHFECA------
SYM_CAMJE       TSFDWGIKLPQEINDDKHIIYVWLDALFIYVSSLDF---QNK---GENAKFWPAH-----
SYM_AQUAE       SRVKWGIPVPF---DPEHTIYVWFDALFNYISALE----------DKVEIYWPAD-----
SYM_THET8       SRVPWGIPLPW---DENHVTYVWFDALLNYVSALDYP-EG-----EAYRTFWPHA-----
SYM_STRCO       STFDWGVPVPW---DDKHVIYVWVDALLNYATAVGY--NENP---EKFESTFPAD-----
SYM_SYNY3       VNLDWGFPLPN---DPNHTIYVWFDALLGYVTALLDE-DEEPNLTNALVKWWPIN-----
SYM_THEEB       VNLAWGFPVPT---DPEQTLYVWFDALLGYVTALLEP-EDEPTLANALKTWWPIN-----
SYM_NOSS1       VNLDWGFPVPN---DPKHTLYVWFDALLAYVTALLDP-EDEPTLENALGKWWPIN-----
SYM_RICPR       TTFHWGIKVPN---NRKHVIYVWLDALVNYISALGYP--DKQ---SNYAKFWPAN-----
SYM_RICCN       TTFNWGIKVPN---NEKHVIYVWLDALANYISALGYL--DEQ---SNYNKFWPAD-----
SYM_DEIRA       ARVPWGIELPW---DTDHVTYVWFDALLSYLTPLV----SQG---QDASMSGKA------
                  . **. :        :  ***.***  * :                            

SYM_MYCTU       -LHMI-GKDIIRFHAVYWPAFLMSAGIELPR-RIFAHGFLH-NRGEKMSKSVGNIVDPVA
SYM_MYCLE       -LHMI-GKDIIRFHAVYWPAFLMSAGIELPR-RIFAHGFLH-NHGEKMSKSVGNIVDPMA
SYM_AGRFC       -VHII-GKDIIRFHAVYWPAFLMSAKLPLPK-RVYAHGFLL-NKGEKMSKSLGNVVDPAN
SYM_RHIME       -IHVI-GKDIIRFHAVYWPAFLMSAGLPLPK-RVFAHGFLL-NKGEKMSKSLGNVVDPFN
SYM_BRUME       -AHII-GKDISRFHAVYWPAFLMSAQLPLPK-RVFAHGFLF-NRGEKMSKSVGNVIDPFE
SYM_BRUSU       -AHII-GKDISRFHAVYWPAFLMSAQLPLPK-RVFAHGFLF-NRGEKMSKSVGNVIDPFE
SYM_RHILO       -THII-GKDIVRFHAVYWPAFLMSAGIELPK-RVFAHGFLF-NRGEKMSKSVGNVVDPFA
SYM_GEOSE       -VHLV-GKEIVRFHTIYWPIMLMALGLPLPK-KVFGHGWLL-MKDGKMSKSKGNVVDPVM
SYM_ALKHC       -VHLV-GKEIVRFHTIYWPIMLMALDLPLPK-KVFGHGWLL-MKDGKMSKSKGNVVDPVP
SYM_LISIN       -VQIV-GKEIVRFHTIYWPIMLMALDLPLPK-MVFGHGWIL-MKDGKMSKSKGNVVDPYM
SYM_LISMO       -VQIV-GKEIVRFHTIYWPIMLMALDLPLPK-MVFGHGWIL-MKDGKMSKSKGNVVDPYM
SYM_BACSU       -VHLV-GKEIVRFHTIYWPIMLMALDLPLPK-QVFAHGWLL-MKDGKMSKSKGNVVDPVT
SYM_STAAM       -IHLM-AKEIVRFHSIIWPILLMALDLPLPK-KVFAHGWIL-MKDGKMSKSKGNVVDPNI
SYM_STAAW       -IHLM-AKEIVRFHSIIWPILLMALDLPLPK-KVFAHGWIL-MKDGKMSKSKGNVVDPNI
SYM_STRP1       -FHMV-GKDILRFHSIYWPILLMMLDLPMPD-RLIAHGWFV-MKDGKMSKSKGNVVYPEM
SYM_STRP3       -FHMV-GKDILRFHSIYWPILLMMLDLPMPD-RLIAHGWFV-MKDGKMSKSKGNVVYPEM
SYM_STRP8       -FHMV-GKDILRFHSIYWPILLMMLDLPMPD-RLIAHGWFV-MKDGKMSKSKGNVVYPEM
SYM_STRPN       -FHMV-GKDILRFHSIYWPILLMMLDVKLPD-RLIAHGWFV-MKDGKMSKSKGNVVYPEM
SYM_LACLA       -INMV-GKEIVRFHTIYWPIMLHALGLPAPK-KIFAHGWLL-MKDGKMSKSKGNVVYPEM
SYM_OCEIH       -VHMV-GKEIVRFHTIYWPIMLMALDLPLPK-KVFAHGWLL-MKDGKMSKSKGNVVYPEM
SYM_CLOPE       -VHLI-GKDILRFHTIYWPIMLMALGLELPK-QVFGHGWLL-VDGGKMSKSKGNVVDPVV
SYM_CALS4       -VHLV-GKEIVRFHTIIWPAMLMALGLPLPK-KVFGHGWLI-LEGGKMSKSKGNVVDPKE
SYM_CLOAB       -LHLV-GKDIIRFHTIYWPIMLMALDLPLPK-QVFGHGWLL-VDGGKMSKSKGNVVDPVV
SYM_MYCGE       VIHLI-SREITRFHCIYWPIFLHLLDIKLPT-QFLSHGWIVDGEGRKMSKSLNNVISPEQ
SYM_MYCPN       VIHLI-SREITRFHCIYWPIFLHQLGFKLPT-QFLSHGWIVDGNGHKMSKSLGNVISPEE
SYM_MYCPU       RVHVV-GKEITRFHCIYWPIFLKSLNVKMPT-KIISHGWIV-TPEGKMSKSKGNVVDPVV
SYM_UREPA       IVHLL-SKEIARFHCIYWPIFLNDLQIRFPS-TILSHGWII-TKEGKMSKSLGNVIDPNV
SYM_FUSNN       VVHLI-GKDIIRFHAIIWPCMLLSAGIKLPD-SIVAHGWWT-SEGEKMSKSRGNVVNPYD
SYM_THEMA       -LHLI-GKEINRFHSIIWPAMLMSVGLPLPK-KVFAHGWLT-VNGQKISKSLGNAIDPRF
SYM_HELPJ       -RHIV-GKDILRFHAIYWPAFLMSLNLPLFK-QLCVHGWWT-IEGVKMSKSLGNVLDAQK
SYM_HELPY       -RHIV-GKDILRFHAIYWPAFLMSLNLPLFK-QLCVHGWWT-IEGVKMSKSLGNVLDAQK
SYM_CAMJE       -VHLV-GKDILRFHAIYWPAFLMSVDLPLPK-FIGAHGWWT-KEGEKMSKSKGNVVKPKE
SYM_AQUAE       -LHLV-GKDILRFHTVYWPAFLMSLGYELPK-KVFAHGWWT-VEGKKMSKTLGNVVDPYE
SYM_THET8       -WHLI-GKDILKPHAVFWPTMLKAAGIPMYR-HLNVGGFLLGPDGRKMSKTLGNVVDPFA
SYM_STRCO       -VHLV-GKDILRFHAIIWPAMLMAQGLPLPG-KIAANGWLM-VGGEKMSKSNLTGIKPQD
SYM_SYNY3       -LHLI-GKDILRFHAVYWPAMLMSAELAIPA-QVFGHGFLT-KDGQKMGKSLGNTVDPLD
SYM_THEEB       -LHII-GKDILRFHGISWPAMLMSAGLPLPE-QIFVHGFLT-KDGQKMGKSLGNTLDPFA
SYM_NOSS1       -LHLI-GKDILRFHAVYWPAMLLSAGLPLPD-RVFGHGFLT-KDGQKMGKSLGNTVDPVG
SYM_RICPR       -LQIV-GKDILRFHAVYWPAFLMAAEIPLPK-AIMVHGWWT-NEGQKISKSLGNTIDPIT
SYM_RICCN       -LHVV-GKDILRFHAVYWPAFLMAAEVPLPK-TIMAHGWWT-NEGQKISKSLGNTIDPIK
SYM_DEIRA       -WHVI-GKDILKPHAVFWPTMLRAAGLPLYR-RLVVHSHILAEDGRKMGKSLGNAIDPEE
                  ::: .::* : * : ** :*           .   .        *:.*:  . : .  

SYM_MYCTU       LAEALGVDQVRYFLLREVPFGQDGSYSDEAIVTRINTDLANELGNLAQRSLSMVAKNLDG
SYM_MYCLE       LVQTFGVDQVRYFLLREIPFGQDGNYSEEAIITRMNTDLANEFGNLAQRSLSMVAKNLGG
SYM_AGRFC       LVAHFGLDPVRYFFMREVSFGQDGSYSEEGIATRINADLANGIGNLASRSLSMIVKNCDG
SYM_RHIME       LVEHFGLDQIRYFFLREVSFGQDGSYSEEGIATRINSDLANGIGNLASRSLSMIVKNCDG
SYM_BRUME       LVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQRSLSMIAKNCEG
SYM_BRUSU       LVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQRSLSMIAKNCEG
SYM_RHILO       LIEHYGLDQVRYFFLREVPFGQDGSYSHDAIVNRTNADLANGLGNLAQRSLSMIAKNCGG
SYM_GEOSE       IIDRYGLDALRYYLLREVPFGSDGVFTPEGFIERINYDLANDLGNLLHRTVAMIEKYFGG
SYM_ALKHC       LIDRYGLDALRYYLLREVPFGSDGVFTPEAFVERVNYDLANDLGNLLNRTVAMIEKYFDG
SYM_LISIN       LIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNYDLANDLGNLLNRTVAMINKYFDG
SYM_LISMO       LIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNFDLANDLGNLLNRTVAMINKYFDG
SYM_BACSU       LIERYGLDELRYYLLREVPFGSDGVFTPEGFVERINYDLANDLGNLLNRTVAMINKYFDG
SYM_STAAM       LIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFDLANDLGNLVNRTISMVNKYFDG
SYM_STAAW       LIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFDLANDLGNLVNRTISMVNKYFDG
SYM_STRP1       LVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDG
SYM_STRP3       LVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDG
SYM_STRP8       LVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDG
SYM_STRPN       LVERYGLDPLRYYLMRNLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVSMINKYFDG
SYM_LACLA       LIERYGLDAVRYYLMRAISFGQDGIFTPEDFVGRINFDLANDLGNLLNRTVSMINKYNDG
SYM_OCEIH       LVERYGLDALRYYLMREVAFGSDGVFTPEDFISRVNYDLANDLGNLLNRTVAMINKYFDG
SYM_CLOPE       LVNMFGADAVRYYLLREIPFGSDGLFNNEIFIKKVNTDLANDLGNLLSRTIAMVYKYFGG
SYM_CALS4       LVDRYGVDAIRYFLLREVPFGADGVFSNEALINRINSDLANDLGNLLSRTVTMIEKYFDG
SYM_CLOAB       LINEFGTDPVRYYLLHEIPFGSDGLFNNEIFIKKINSDLANDLGNLVSRTAAMIEKYFDG
SYM_MYCGE       LIDQFGVDGTRYCLLKEMRLDKDNRCSVSILKEIYNADLANSFGNHVSRTFGMIKKYLNG
SYM_MYCPN       LLAQFGVDGTRYCLLKEMRLDKDNRCSMAIFKDIYNADLANSFGNHASRTFGMIKKYLGG
SYM_MYCPU       LIEKYGSEVLKYFLIAKLSIKKDGVFSEELLVSAYNNDLVNTFSNLISRTVKMILNNYDR
SYM_UREPA       LIDTYGVDALRYYLMADLSLFRDAIFSEDNLIETYNTQLANSYGNMISRTLGMLKKYRNN
SYM_FUSNN       EIKKYGVDAFRYYLLREANFGTDGDYSTKGIIGRLNSDLANDLGNLLNRTLGMYKKYFNG
SYM_THEMA       FVKRYGNDVVRYYLIRDIMFGKDGDFSEERLVHRLNSDLANDYGNLLHRITAMIKKYFNG
SYM_HELPJ       LAMEYGIEELRYFLLREVPFGQDGDFSKKALVERINANLNNDLGNLLNRLLGMAKKYFNY
SYM_HELPY       IAMEYGIEELRYFLLREVPFGQDGDFSKKALIERINANLNNDLGNLLNRLLGMAKKYFNH
SYM_CAMJE       VVDAYGSEAFRYFLLREVPFGNDGDFSENMLINRINAELSNEFGNLLNRIIGMSTKYSQG
SYM_AQUAE       VVQEYGLDEVRYFLLREVPFGQDGDFSKKAILNRINGELANEIGNLYSRVVNMAHKFLGG
SYM_THET8       LLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLADDLGNLVQRTRAMLFRFAEG
SYM_STRCO       LTTHFGVDAYRWYFLRAIAFGQDGSFSWEDFSARYTSELANDYGNLASRVAAMVGKYFGG
SYM_SYNY3       LINRYGEDAFRYYFLKEIEFGKDGDFNEQRFVNVLNADLANDLGNLLNRTLGMVKKYCQG
SYM_THEEB       LVAQYGADAVRYYFMKEVEFGRDGDFSETRFVTILNADLANDLGNLLNRTLKMAWKYTDG
SYM_NOSS1       LVQQYGSDAVRYYFLKEIEFGKDGDFNEVRFIHVLNADLANDLGNLLNRTLNMVKKYCAN
SYM_RICPR       LIDEFGVDQVRYFLMREVIFGADANFARNNLITRINSELSNKIGNLLHRIVSFVYKNNDA
SYM_RICCN       LIDEFGVDQVRYFLMREVTFGADGNFARSNLITRINSELSNKIGNLLQRTTSFVYKNNDA
SYM_DEIRA       LVAAWPVDAIRYALLREASLGADSPFGEGVLVSRLNSDLANDLGNLLSRTVSMIQKYRGG
                       :  :: ::       *              :* :  .*   *   :  .    

SYM_MYCTU       RVPNP--G--EFADADAA---LLATADGLLERVRGHFDAQAMHLALEAIWLMLGDANKYF
SYM_MYCLE       VVPEP--S--EFTSADTA---LLTTADGLLERVRGNFDGQAMNLALEAIWLMLGEANKYF
SYM_AGRFC       QIPTP--GAFN--DDDKA---MLASADGLLAVCREEMGKQLIHRALAAIIAVVSETDRYF
SYM_RHIME       QVPLCG-PLTD--E-DKA---MLAAADSLIGTAREEMGKQLIHRALAAIIAVVSETDRYF
SYM_BRUME       KVPQP--GAFS--EADKA---ILDQADAALETARKAMDDQALHLALGAIFAVVAEANRYF
SYM_BRUSU       KVPQP--GAFS--EADKA---ILDQADAALETARKAMDDQALHLALGAIFAVVAEANRYF
SYM_RHILO       VVPKRG-EMTD---ADSA---ILDQAVAALTTARKAMAGQGIHLALAAIFDVVAEADRYF
SYM_GEOSE       AIPPYR-GPKT--PFDRD---LSETAREVVRQYEEAMERMEFSVALSAVWQLIGRTNKYI
SYM_ALKHC       KIPSY---VKDGTPFDAD---LVELVYSTVKKVEDAMEEMEFSIALTAIGQLISRTNKYI
SYM_LISIN       EIPAYQGNVTE---FDQT---LVDFKNNVVKEYEGSMDHMQFSVALNQLWSLISRTNKYI
SYM_LISMO       EIPAYQGNVTE---FDQI---LVDFKNNVVKEYEGSMDHMQFSVALNQLWSLISRTNKYI
SYM_BACSU       QIGSYK-GAVT--EFDHT---LTSVAEETVKAYEKAMENMEFSVALSTLWQLISRTNKYI
SYM_STAAM       ELPAYQ-GPLH--ELDEE---MEAMALETVKSYTESMESLQFSVALSTVWKFISRTNKYI
SYM_STAAW       ELPAYQ-GPLH--ELDEE---MEAMALETVKSYTESMESLQFSVALSTVWKFISRTNKYI
SYM_STRP1       TVPAYV-DNGT--AFDAD---LSQLIDAQLADYHKHMEAVDYPRALEAVWTIIARTNKYI
SYM_STRP3       TVPAYV-DNGT--AFDAD---LSQVIDAQLADYHKHMEAVDYPRALEAVWTIIARTNKYI
SYM_STRP8       TVPAYV-DNGT--AFDAD---LSQLIDAQLADYHKHMEAVDYPRALEAVWTIIARTNKYI
SYM_STRPN       QIPAYVEGVTE---FDHV---LAEVAEQSIADFHTHMEAVDYPRALEAVWTLISRTNKYI
SYM_LACLA       KIEAT--GVST--EFDAS---LEEVVEETISHFHKAMDKFEFNVALADVWTLISRTNKYI
SYM_OCEIH       KVPEFK-G--EVTSFDGE---LQTTANNAVKEYEKHMEGMQFSDALKQVWILISRANKYI
SYM_CLOPE       VIQAP--TCKE--PIDDE---LINLALSTPGKVEASIDALKIPEALESIWTLISRANKYI
SYM_CALS4       VLPKP--SSQE--EIDED---LINVAQNLPQKVEEYMDKLQFSNALIEIWKLVSRANKYI
SYM_CLOAB       SIQPP--VDKE--EIDNE---LIDMAISLPEKLDEDIKKLKIPEALDHIWDLIKRANKYI
SYM_MYCGE       KLEYQ--IITD--NALQK---IMILIDESIVQFDHYFNSYEFYRAINLLLKIVFELSKLI
SYM_MYCPN       QLDFI--EVQD--PQVKQ---LMDQANQAMVQFDTAWNNFQFYKGINGLLQLVFQASKLI
SYM_MYCPU       PLSFI--LSKD--QEDLE---IEKDIKNSFETFCSFAEEYEFDKAFESTINLGKKLNLYI
SYM_UREPA       IVPKYV-GCVL--KNDEK---LENLINKNIELVQENINKYSIDKALNCIQEILVEANKYI
SYM_FUSNN       TIVSS--STVE--PIDDE---IKSMFNDVVKDVEKYMYLFEFSRALETIWKFISRLNKYI
SYM_THEMA       RLPSP--SAQE--GFDSW---LKERFFETKDAYHELMDSYRLTEALDKIWEFIADVNKYF
SYM_HELPJ       SLKST--KITA--YYPKE---L-EKAHQILDNANSFVPKMQLHKALEELFNIYDFLNKLI
SYM_HELPY       SLKST--KITA--YYSKE---L-EKVHQILDNANSFVPKMQLHKALEELFNVYDFLNKLI
SYM_CAMJE       NISKE--GVLK--FYNAE---L-NQAKEHLNLAVEFLENLQCNRYLEELFKALSVANLAI
SYM_AQUAE       EVSGA--R-------DEE---YAKIAQESIKNYENYMEKVNFYKAIEEILKFTSYLNKYV
SYM_THET8       RIPEP--VAGE------E---L-AEGTGLAGRLRPLVRELKFHVALEEAMAYVKALNRYI
SYM_STRCO       ELPAA--TADG----DAEQAIHDGLTKAVAEADRKIGEELDFQGGILAVFDFVKQVNGYI
SYM_SYNY3       QGPQV--MATDL-APDNP---LKALGSHLGEEVSSAYERLSFTDACEAIFTLVRAGNKYI
SYM_THEEB       KVPNV--QGAAI-PREHP---LRQLAEHLSQTYGQGYRQLAFHEVCQQALTLARAGNKFL
SYM_NOSS1       YALSI--TNEDI-PAENT---LKALGVDLGAKVKQAYEVLAFNQACGVVLSLVQASNKFI
SYM_RICPR       KVPLIKSGVIDK-IYELP---ILKTAIKFAQENILLMDKTEINKILENIINLAEDANIYI
SYM_RICCN       KVPLLTQGVIDK-IYELP---ILKTASKFVEQNILLMDKTEINKILENIINLAEEANIYI
SYM_DEIRA       VIPAA----TE--PTDRER-EIEAAARALPDEVLRLVDELKINMAIDAAMSFVRDLNRYI
                                                                        .  .

SYM_MYCTU       SVQQPWVLRKSESEADQARFRTTLYVTCEVVRIAALLIQPVMPESAGKILDLLGQAPNQR
SYM_MYCLE       SSQQPWILRKSESEADQARFRTVLYTTCEVVRIAALLVQPVMPESAGKMLDLLGQEEDQR
SYM_AGRFC       ASQEPWALKKTD---P-ERMGTVLYVTAEVVRQIGILLQPFMPQSCEKLLDLVAAPADGR
SYM_RHIME       AGQEPWALKKTD---P-SRMATVLYVTAEVVRQVAILLQPFMPESAGKLLDLVAVPTDRR
SYM_BRUME       AGQEPWALRKTD---P-ARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAAPADKR
SYM_BRUSU       AGQEPWALRKTD---P-ARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADKR
SYM_RHILO       AGQAPWALKKTD---P-ERMETVLWTTAELVRRVAVLCQPFIPGSAAKLLDLLAVPADKR
SYM_GEOSE       DETQPWVLAKEES--KREELASVMAHLAESLRYTAVLLQPFLTRTPERIFTQLGISDR--
SYM_ALKHC       DETQPWVLAKDES--KREQLGAAMYHLAESIRYVSVLLQPFMTKAPQKIWEQLGIDSS--
SYM_LISIN       DETAPWALAKEED--KRTELASVMTHLAENLRIIAVLLQPFLTRTPGEIFLQLGLQEE--
SYM_LISMO       DETAPWALAKDED--KRTELASVMTHLAENLRIIAVLLQPFLTRTPGEIFLQLGLQEE--
SYM_BACSU       DETAPWVLAKDPA--KEEELRSVMYHLAESLRISAVLLQPFLTKTPEKMFEQLGITDE--
SYM_STAAM       DETTPWVLAKDDS--QKDMLGNVMAHLVENIRYAAVLLRPFLTHAPKEIFEQLNINNPQF
SYM_STAAW       DETTPWVLAKDDS--QKDMLGNVMAHLVENIRYAAVLLRPFLTHAPKEIFEQLNINNPQF
SYM_STRP1       DETAPWVLAKEDG--DKAQLASVMAHLAASLRLVAHVIQPFMMETSAAIMAQLGLEPV-S
SYM_STRP3       DETAPWVLAKEDG--DKAQLASVMAHLAASLRVVAHVIQPFMMETSAAIMAQLGLAPV-S
SYM_STRP8       DETAPWVLAKEDG--DKAQLASVMAHLAASLRVVAHVIQPFMMETSAAIMAQLGLAPV-S
SYM_STRPN       DETAPWVLAKDEA--LRDQLASVMSHLAASIRVVAHLIEPFMMETSRAVLTQLGLEEV--
SYM_LACLA       DETAPWVLAKSED--DKAKLNNVLYHLAENLRIAGALLQPFMRATSGKIFEQLGMDER--
SYM_OCEIH       DETEPWIVAKDEG--RRNELASVMVHLAESLHAAALMLQPFLTHAPKKIAEQLGLGEEYG
SYM_CLOPE       DETTPWILAKDEE--KKERLGTVLYNLLETLRFVSVMISPFLTETSVKINAQLNTKVTTW
SYM_CALS4       DETMPWVLAKDES--KRGRLGTVLYNLAESLRFIGILISPFMPNTPKKMFEQLGITED--
SYM_CLOAB       DETTPWVLAKDEN--KKARLGTVLYNLVESLRFVATTLTPFLPETGEKIKTQLNIELDTW
SYM_MYCGE       DDFKPWELFKNQ---EFSLLKQLLFTCVRCVQVCYVLLTPILVNTASKVFHLFNFADDAC
SYM_MYCPN       DQLKPWELVKQT---DYTLLKQLLFACVRCTQVCFVLLAPILVHTSTQIFDLFNFSAQAR
SYM_MYCPU       DKTRPWLLTKED-----QKLEIVLNRLLNGIYAMAFELSIVMPQTSQKLAKALGFESFEK
SYM_UREPA       EDNKPWELAKNQ---QEQELDSLLVHLVKVIQVTTTLLSPILIEGSKKAVEQLNFDESFL
SYM_FUSNN       DETMPWTLAKNEA--KKARLAAVMNILCEGLYKIAFLIAPYMPESAQKISNQLGIDKDIT
SYM_THEMA       NDTKPWILGKEG---NMERLGTVLYNSLEAVFKVALMTLPVMPDTSEEVFRRVSFEEKPS
SYM_HELPJ       AKEEPWVLHKNN---ESEKLEALLSLIANTLLQSSFLLYAFMPKSAMKLASAFRVEITPN
SYM_HELPY       AKEEPWVLHKNN---ESEKLEALLSLIANALLQSSFLLYAFMPKSAVKLANAFNTEITPD
SYM_CAMJE       SKYEPWSLIKEN---KHEQANALVALCANILAKTSLLLSPTLPKSSQKVALALNFEISSA
SYM_AQUAE       DEKQPWALNKER---KKEELQKVLYALVDGLFVLTHLLYPITPNKMKEALQMLGEKEFLK
SYM_THET8       NEKKPWELFKKE---P-EEARAVLYRVVEGLRIASILLTPAMPDKMAELRRALGLKEEVR
SYM_STRCO       TEQEPWKVAKDDSPEGKARLATILYTAAEALRAVAVLLNPIMPDTSQKLWDSLGAEPSLG
SYM_SYNY3       DDMAPWKLFKQG---SQKEVEDVLYSVLESIRLSAYLLSPIVPRLSTKIYQQLGFTWDFD
SYM_THEEB       DEEAPWKRYRAG---ETAAVAEILYCVLESVRLVAYVLAPIIPQLSEAIYGQLGYSIRFN
SYM_NOSS1       DDQAPWSLYKQE---RQQEVETVLYTVLESVRLAAYLLSPVIPNISSNIYQQLGFGINFN
SYM_RICPR       TNEAPWNLKTTD---P-DKMLEVLYSLLEVLRYIAIMLQPFVPNSANKMLDQLGVSKEER
SYM_RICCN       DSEAPWNLKKTD---P-DKMLEVLYALLEVLRYIAIMLLPFIPSSANKMLDQLGVNKEER
SYM_DEIRA       AESTPWTLAKSPE--TQGRLDTVLYTAAEGLRVASVALEAVIPTKAKELREQLGLGRQGY
                    **                 :                            .       

SYM_MYCTU       SFAAVGVRLTPGTALPPPTGVFPRYQPPQPPEGK----------------
SYM_MYCLE       AFTAVSVRLAPGTVLPPPTGVFPRYQPSEIEGADPVKSSSKRREHNKRRE
SYM_AGRFC       DFTALGEAGRLAPGTPLEAPKPVFPRYVAPEA------------------
SYM_RHIME       DFAHLGEAGRLVSGTPLEAPKPVFPRYVAPEA------------------
SYM_BRUME       QFADVLASPLAGGTDLPAPQPVFPRYVEADEQN-----------------
SYM_BRUSU       QFADVLASPLAGGTDLPAPQPVFPRYVEADEQN-----------------
SYM_RHILO       DFVHVHADYALVPGTALPAPEGVFPRYVEQPGANA---------------
SYM_GEOSE       SLKEWDSLYDFGLIPEGTNVQKGE>-------------------------
SYM_ALKHC       -LTTWESLETFGQIPGNTNVQKGQPLFPRLDVEEEVA>------------
SYM_LISIN       NLKKWDSIYGYGEIPEGTTVVKKGTPIFPRLDAEVEV>------------
SYM_LISMO       NLKKWDSIYGYGEIPAGTTVVKKGTPIFPRLDAEVEV>------------
SYM_BACSU       SLKAWDSITAFGQLKD>---------------------------------
SYM_STAAM       MEFSSLEQYGVLTESIMVTGQPKPIFPRLDSEAEIAYI>-----------
SYM_STAAW       MEFSSLEQYGVLTESIMVTGQPKPIFPRLDSEAEIAYI>-----------
SYM_STRP1       DLSTLALADFPANTKVVAKGTPIFPRLDMEAEIDYI>-------------
SYM_STRP3       DLSTLALADFPANTKVVAKGTPIFPRLDMEAEIDYI>-------------
SYM_STRP8       DLSTLALADFPANTKVVAKGTPIFPRLDMEAEIDYI>-------------
SYM_STRPN       --SSLENLSLADFPADVTVVAKGTPIFPRLNMEEEIY>------------
SYM_LACLA       --SFSLENLSFGYSFTHPVVAKGQPIFPRLDVEEEVA>------------
SYM_OCEIH       LDWGTIGFGNFPENTTVVKKGTPIFPRLDLDEEAAYI>------------
SYM_CLOPE       ESLKEFNGTVAGDKVVKGDVIFPRIDVEEKLAELEAL>------------
SYM_CALS4       -LTTWESLKFGLLKEGTRVKRGEILFPRIDVEKELA>-------------
SYM_CLOAB       ESLSAFDGTRAGTKVSKGEVIFPRIDVDKKIEELNKL>------------
SYM_MYCGE       RKDQLRDATLLKKIIISNSMEVLFKRVD----------------------
SYM_MYCPN       SKTHLADPQQLQKISLAPVIQPLFKRLD----------------------
SYM_MYCPU       SKLEDFKKFDNIKIEKIENLFNRIKL------------------------
SYM_UREPA       TLASLASYDIFNYHKVNDSKPIFARIIVEKQ-------------------
SYM_FUSNN       NLKFDDIKEWSIFKEGHKLGEASPIFPRIEIEKEEIV>------------
SYM_THEMA       KEHLENWGVLKPGSTVIHGEPLFKKIDAKD>-------------------
SYM_HELPJ       NYERFFKAKKLQDMVLQDTEPLFSK>------------------------
SYM_HELPY       NYERFFKAKKLQDMILQDTEPLFSK>------------------------
SYM_CAMJE       NYTKMILDNELLDFKANPCEALFPKVEKALLKQE>---------------
SYM_AQUAE       ELKPYSKNTYKLGERKILFPKREG--------------------------
SYM_THET8       LEEAERLLVLRLSLGNEERTVVSGIA>-----------------------
SYM_STRCO       ALADQHVQDAADWGRLPAGATVTKGAVLFPRLEEKPAA------------
SYM_SYNY3       QWRSPLEQAEEFNRHQSWGQLGANQNLPPAQPIFTKLELPAEE-------
SYM_THEEB       GSIAPDLLGDRQAQWGVLPASQPLANPEPIFQKLLLPATVADSP------
SYM_NOSS1       EQTDITPFAIHAQWGLLSNKQQLGQPQPIFKRIEQTKNV-----------
SYM_RICPR       LFKHLVRDHALKAGSNILEPSIIFPKFN----------------------
SYM_RICCN       LFKHLIRDYTLTAGSNILEPTIIFPKFE----------------------
SYM_DEIRA       PLQAAWGLTPAGTRVQGGAILFPKPEPKADETKNAEA>------------