CLUSTAL format seed alignment for MF_01229

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SSUD_ECO55            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ECOSE            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ECO24            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
A0A5B7PH51_ECOLX      ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
C8ULF8_ECO1A          ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ECO8A            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_SHIFL            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
D2ABI8_SHIF2          ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_SHIF8            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ECOLU            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
D3H0G4_ECO44          ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ECO27            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ECOL5            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ECOBW            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
A0A070SVD4_ECOLX      ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ECODH            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ECOHS            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ECOLC            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ECOLI            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ECO57            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ECO5E            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
D3QPD2_ECOCB          ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ECO45            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ECOK1            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ECOUT            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
A0A0E2L880_ECOU3      ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ECOL6            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPIDHGYLQQIAQ
SSUD_ECO81            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
W8ZQD3_ECOLX          ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ECOSM            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ECO7I            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
SSUD_ESCF3            ----------------------MSLNMFWFLPTHG-DGHYLGTEEGSRSVDHGYLQQIAQ
SSUD_CITK8            ----------------------MSLNMFWFLPTHG-DGHYLGTEAGSRPVDHGYLQQIAQ
D2TS72_CITRI          ----------------------MSLNMFWFLPTHG-DGHYLGTDEGARPVDHSYLQQIAQ
SSUD_ENT38            ----------------------MSLNLFWFLPTHG-DGHYLGTEEGARPVDYGYLQQIAQ
A0A0H3CK28_ENTCC      ----------------------MSLNLFWFLPTHG-DGHYLGTEEGSRPVDHGYLQQIAQ
A0A1F2LQS7_9ENTR      ----------------------MSLNMFWFLPTHG-DGRYLGTEEGARPVDYGYLQQIAQ
B5XY62_KLEP3          ----------------------MSLNMFWFLPTHG-DGRYLGTEEGARPVDYGYLQQIAQ
A6T736_KLEP7          ----------------------MSLNMFWFLPTHG-DGRYLGTEEGARPVDYGYLQQIAQ
SSUD_CROS8            ----------------------MSLNLFWFLPTHG-DGHYLGSDAGARPVDHGYLQQIAQ
C9Y0N2_CROTZ          ----------------------MSLNLFWFLPTHG-DGHYLGSDAGARPVDHGYLQQIAQ
SSUD_ERWT9            ----------------------MSLSVFWFLPTHG-DGQYLGTNEGARPVDHAYLQQIAQ
D4I0B4_ERWAC          ----------------------MSLSVFWFLPTHG-DGRYLGTRQGARPVDHAYLQQIAQ
SSUD_PECCP            ----------------------MSLNVFWFLPTHG-DGRYLGSTEGARHVDYGYLQQVAQ
A0A0H3I306_PECPM      ----------------------MSLNVFWFLPTHG-DGRYLGSTEGARHVDYGYLQQVAQ
SSUD_PECAS            ----------------------MSLNVFWFLPTHG-DGRYLGSTEGARHVDYSYLQQVAQ
SSUD_YERPB            ----------------------MSINVFWFLPTHG-DGHYLGSSEGARAVDYSYLQQIAQ
SSUD_YERPS            ----------------------MSINVFWFLPTHG-DGHYLGSSEGARAVDYSYLQQIAQ
SSUD_YERPY            ----------------------MSINVFWFLPTHG-DGHYLGSSEGARAVDYSYLQQIAQ
SSUD_YERP3            ----------------------MSINVFWFLPTHG-DGHYLGSSEGARAVDYSYLQQIAQ
SSUD_YERPA            ----------------------MSINVFWFLPTHG-DGHYLGSSEGARAVDYSYLQQIAQ
SSUD_YERPE            ----------------------MSINVFWFLPTHG-DGHYLGSSEGARAVDYSYLQQIAQ
SSUD_YERPN            ----------------------MSINVFWFLPTHG-DGHYLGSSEGARAVDYSYLQQIAQ
SSUD_YERPP            ----------------------MSINVFWFLPTHG-DGHYLGSSEGARAVDYSYLQQIAQ
SSUD_SERP5            ----------------------MSLNVFWFLPTHG-DGHYLGSTEGARSVDYGYLQQIAQ
D2BXP8_DICZ5          ----------------------MSLNIFWFLPTHG-DGRYFGRGENARPVDYSYLQQIAQ
C6CFJ9_DICC1          ----------------------MSLNIFWFLPTHG-DGHYFGRGENARPVDHSYLQQVAQ
C6C3U5_DICP7          ----------------------MSLNMFWFLPTHG-DGHYFGKGERARSVDYGYLQQIAQ
SSUD_PSEPK            ----------------------MSLNIFWFLPTHG-DGKYLGTSEGARAVDHGYLQQIAQ
SSUD_PSEP1            ----------------------MSLNIFWFLPTHG-DGKYLGTSEGARAVDHGYLQQIAQ
SSUD_PSEPG            ----------------------MSLNIFWFLPTHG-DGKYLGTSDGARAVDHGYLQQIAQ
SSUD_PSEPW            ----------------------MSLNIFWFLPTHG-DGKYLGTSEGARAVDHGYLQQIAQ
SSUD_PSEE4            ----------------------MSLNIFWFLPTHG-DGKYLGTTEGARAVDHGYLSQIAQ
SSUD_PSEAE            ----------------------MSLEIFWFLPTHG-DGHYLGTTQGARAVDHGYLQQIAQ
A6V1Y2_PSEA7          ----------------------MSLEIFWFLPTHG-DGHYLGTTQGARAVDHGYLQQIAQ
SSUD_PSEMY            ----------------------MSLNIFWFLPTHG-DGKYLGTAEGARAVDHGYLAQIAQ
Q3K504_PSEPF          ----------------------MSLNIFWFLPTHG-DGHYLGTAEGARAVDHGYLQQVAQ
C3K3U8_PSEFS          ----------------------MSLNIFWFLPTHG-DGHYLGTAEGARAVDHGYLQQVAQ
Q4K439_PSEF5          ----------------------MSLNIFWFLPTHG-DGHYLGTAEGARAVDHAYLQQIAQ
SSUD_AZOVD            ----------------------MSLNVFWFLPTHG-DGHYLGTAEGARAVDHAYLQQIAQ
Q21XJ7_RHOFT          ------------------------MNIFWFLPIHG-DGRYLGTQHGARAVDHHYLKQIAQ
SSUD_AGRFC            -----------------MSKHDKPLDFLWFIPTSG-DGSYLGSDDLSRPADPGYFREIAQ
SSUD_RHIE6            -----------------MMAIDKPLDFLWFIPSSG-DGQYLGSDDLSRPADPGYFREIAK
C3MH35_SINFN          -----------------MTKTDQPLDFLWFIPTSG-DGAYLGSDDLSRPADTGYFREIAT
C6B0T4_RHILS          -------------MTTSHTGTSEPINFLWFIPTSG-DGTYLGSSDLNRAPEIGYLTQIAQ
Q1MFL6_RHIL3          ------------MTTISHTGTSEPINFLWFIPTSG-DGTYLGSSDLNRAPEIGYLTQIAQ
B5ZSB3_RHILW          -----------------MTATSDPINFLWFIPTSG-DGTYLGSADLNRAPEIGYLTQIAQ
Q2K7H6_RHIEC          -----------------MTDTFNPINFLWFIPTSG-DGTYLGSSDLNRAPEIGYLTQIAQ
B9JG07_AGRRK          -----------------MTKTAKPIDFLWFIPTSG-DGTYLGSTDLNRGPEIGYLTQIAQ
B9K142_AGRVS          ------------MTKTSNAQNARPIDFLWFIPTSG-DGTYLGSNDLTRPVDHGYLREIAS
A8I8W6_AZOC5          MTISFLTAFWGETECPMSNLTPPPPHMFWFIPTHG-DGSYLGSETRQRPPEFGYFREVAT
A7IKZ2_XANP2          --------MSHPVPLPATPASQSP-DIFWFIPTHG-DGAYLGSETRQRPPEFAYFREVAQ
SSUD2_RHILO           -----------------MTSPPSPLDFFWFIPTHG-DGSYLGSEEQQRPPEFGYFKQIAQ
C1DGL2_AZOVD          ----------------------MSLDIFWFLPTSG-DTRYLGKSSSGRPATNEYMRQIAV
A1VJQ2_POLNA          ----------------------MSFEVFWFLPTSG-DTRYLGKSNTGRPATNAYMRQIAV
A9BUV1_DELAS          ----------------MSQDPHASPDIFWFLPTSG-DTRYLGTSDFGRAPTNAYMRQIAV
D8IQ40_HERSS          ----------------------MSLELFWFLPTSG-DTRYLGKSDFGRAPTLEYMRQIAV
A5EEY6_BRASB          ----------------------MSYEVFWFLPTSG-DTRYLGKSDFSRAPSNAYLRQVAE
SSUD_ACIAC            ------------------------MHVFWFIPTHG-DSRYLGTSEGARAVHYDYLRQVAT
SSUD_DELAS            ------------------------MQVFWFIPTHG-DSRYLGTAEGARPLSHDYVKQVAI
SSUD_POLNA            ------------------------MQVFWFIPTHG-DSRYLGTGEGAREVSHDYLKQVAI
SSUD_VARPS            ------------------------MQIFWFLPTHG-DSRYLGTSEGARPIDLAYLQQIAG
SSUD_RALPJ            ------------------------MQVFWFIPTHG-DSRYLGTAEGARQVDHTYLQQVAV
C6BH37_RALP1          ------------------------MQVFWFIPTHG-DSRYLGTAEGARQVDQTYLQQVAV
SSUD_RALSO            ------------------------MQVFWFLPTHG-DSRYLGTAEGARQVDQAYLQQVAV
SSUD_CUPNH            ------------------------MQVFWFIPTHG-DSRYLGTSEGAREVSFDYLKQVAV
SSUD_CUPTR            ------------------------MQVFWFIPTHG-DSRYLGTSEGARAVGFDYLRQVAV
SSUD_CUPMC            ------------------------MQVLWFIPTHG-DSRYLGTSEGAREVSFDYLKQVAV
SSUD_XANAC            ------------------------MDMFWFIPTHG-DSRYLGTSDGARQVSAEYVTQVAV
A2SBY8_METPP          ------------------------MKLLWFIPTHG-DSRYLGSAQGARAADYNYFRQVAI
SSUD_PARPJ            ------------------------MNVFWFIPTHG-DSRYLGTSQGARAADYDYFQQIAV
D5W7K4_BURSC          ------------------------MNVFWFIPTHG-DSRYLGTSQGARAADYDYFRQIAV
SSUD_PARP8            ------------------------MNVFWFIPTHG-DSRYLGTSQGARAADYDYFRQIAV
Q63TV9_BURPS          ------------------------MNVFWFIPTHG-DSRYLGTAEGARAADYDYFRQVAV
A3NUT1_BURP0          ------------------------MNVFWFIPTHG-DSRYLGTAEGARAADYDYFRQVAV
A2S363_BURM9          ------------------------MNVFWFIPTHG-DSRYLGTAEGARAADYDYFRQVAV
SSUD_BURP1            ------------------------MNVFWFIPTHG-DSRYLGTAEGARAADYDYFRQVAV
A3N936_BURP6          ------------------------MNVFWFIPTHG-DSRYLGTAEGARAADYDYFRQVAV
A0A0H2XNI1_BURCA      ------------------------MNVFWFIPTHG-DSRYLGTAEGARAADYDYFKQVAV
B1K0T2_BURCC          ------------------------MNVFWFIPTHG-DSRYLGTAEGARAADYDYFKQVAV
B4E8P2_BURCJ          ------------------------MNVFWFIPTHG-DSRYLGTAEGARAADYDYFKQVAV
Q39GW7_BURL3          ------------------------MNVFWFIPTHG-DSRYLGTAEGARAADYDYFKQVAV
Q0BFQ2_BURCM          ------------------------MNVFWFIPTHG-DSRYLGTAEGARAADYDYFKQIAV
B1YPJ4_BURA4          ------------------------MNVFWFIPTHG-DSRYLGTAEGARAADYDYFKQIAV
A4JE30_BURVG          ------------------------MNVFWFIPTHG-DSRYLGTTEGARAADYDYFKQIAV
A0A0H3KF22_BURM1      ------------------------MNVFWFIPTHG-DSRYLGTAEGARAADYDYFRQVAV
C5AGU6_BURGB          ------------------------MNVFWFIPTHG-DSRYLGTSDGARAADYDYFRQVAV
A9IMS5_BORPD          ------------------------MNVFWFIPTHG-DSRYLGTTQGARAATHDYFRQIAV
A6SVY3_JANMA          ----------------------MSLNVFWFLPTHG-DSRYLGTSKGARQVDFDYLKQVAV
D8IQQ1_HERSS          ------------------------MNVFWFIPTHG-DSRYLGTSEGARAVSHDYMKQVAV
B0V5V9_ACIBY          ------------------------MKIFWFIPTHG-DSRYLGTSKSARQVDHAYMKQIAV
A0A0J1A8C8_ACIBA      ------------------------MKIFWFIPTHG-DSRYLGTSKGARQVDHAYMKQIAV
B0VMM8_ACIBS          ------------------------MKIFWFIPTHG-DSRYLGTSKGARQVDHAYMKQIAV
D8JJB2_ACISD          ------------------------MKIFWFIPTHG-DSRYLGTSKGARQVDHAYMKQIAV
Q6FFY9_ACIAD          ------------------------MNIFWFIPTHG-DSRYLGTSKGARQVDHAYMKQIAV
SSUD_PSE14            ------------------------MNVFWFLPTHG-DGHYLGTTKGARPVTLNYLKQVAQ
SSUD_PSESM            ------------------------MNVFWFLPTHG-DGHYLGTTKGARPVTLNYLKQVAQ
SSUD_PSEU2            ------------------------MNVFWFLPTHG-DGHYLGTTKGARPVTLNYLKQVAQ
Q4K935_PSEF5          ------------------------MDVFWFLPTHG-DGHFLGTAQGARPVTLNYLKQVAQ
C3K524_PSEFS          ------------------------MDVFWFLPTHG-DGHYLGTTQGARPVTLNYLKQVAQ
Q3K9A1_PSEPF          ------------------------MDVFWFLPTHG-DGHYLGTTQGARPVTLNYLKQVAQ
MSUD_PSEAE            ------------------------MNVFWFLPTHG-DGHFLGTSQGARPVSLPYLKQVAQ
A0A0H2ZBA9_PSEAB      ------------------------MNVFWFLPTHG-DGHFLGTSQGARPVSLPYLKQVAQ
A6V5D1_PSEA7          ------------------------MNVFWFLPTHG-DGHFLGTSQGARPVSLPYLKQVAQ
SSUD_SORC5            ------------------------MNVFWFLPTHG-DGRYLGTAEGARPVTLPYLRQIAQ
C5AZ36_METEA          ------------MTIQT----DGKTDVLWFLPTHG-DGRYLGASEGARDVSLPYLRQIAQ
A9W7M5_METEP          ------------MTIQT----DGKTDVLWFLPTHG-DGRYLGASEGARDVSLPYLRQIAQ
SSUD_METC4            ------------MTIQT----DGKTDVLWFLPTHG-DGRYLGASEGARDVSLPYLRQIAQ
C7CDS9_METED          ------------MTIQT----DGKTDVLWFLPTHG-DGRYLGASEGARDVSLPYLRQIAQ
B1ZLP7_METPB          ------------MTAQSRPPADGKTDVLWFLPTHG-DGRYLGASEGARDVSLPYLRQIAQ
B8ILH7_METNO          ------------MSAQT--------DVLWFLPTHG-DGRYLGASEGAREVSLAYLRQIAQ
B0UGA6_METS4          ------------MSAQT--------DVLWFLPTHG-DGRYLGASEGARHVSLAYLRQIAQ
B1M3N9_METRJ          ------------MHAAN----DGRADVLWFLPTHG-DGRYLGAREGARDVSLSYLRQIAQ
Q0BVJ8_GRABC          ------------MSHSSH--AAEAADVLWFLPTHG-DGRYLASQVGARHVTLNYLSQIAR
A8IC39_AZOC5          ------------MTDTSDLVPAPEANVLWFLPTHG-DGHYLGTSHGARAVSLGYLRQIAQ
A7IEL9_XANP2          ------MSNAEASPAAPSLTPATEANVLWFLPTHG-DGHYLGTSHGAREVSLGYLRQIAQ
B2IFA8_BEII9          ----------------MNDIAAESANVLWFLPTHG-DGRYLGTSLGARDVTLRYLSQIAE
SSUD_RHOPA            ----------------MTAPQTPSSNFLWFLPTHG-DGHYLGTSNGGRDVNFGYLRQIAQ
SSUD_RHOPT            ----------------MTAPQTPSSNFLWFLPTHG-DGHYLGTSNGGRDVNFGYLRQIAQ
Q07LQ6_RHOP5          ----------------MSSSHAAPPNFLWFLPTHG-DGHHLGTTTGGREVSFAYLRQIAQ
A5ED25_BRASB          ------------------MSNASKPNVLWFLPTHG-DGRYLGTSEGGREVNFNYLRQIAQ
A4Z097_BRASO          ---------------MNDMSNASKPNVLWFLPTHG-DGRYLGTSEGGREVNFNYLRQIAQ
SSUD_BRADU            ------------------MSQS-KSNILWFLPTHG-DGRYLGTATGGREVNFNYLRQIAQ
Q3SUU3_NITWN          ----------------MTVAPAAKVKLLWFLPTHG-DGRYLGTTTGGREVNFSYLRQIAQ
D3P029_AZOS1          --------------MTTNSEAASEANILWFIPTHG-DGRHLGTSVGARETDRHYLRQIAQ
B8EQZ6_METSB          -----------MTNATPSGDAQNGLNVLWFIPTHG-DGRYLGTTRGGRDTNFAYLSQVAQ
D7A632_STAND          --------------MSQPGSSNDGVNVLWFLPTHG-DGRYLGTSVGARATDIDYLRQVAQ
SSUD1_RHILO           --------------MTGDVPDR--IKVLWFLPTHG-DSRYLGTAEGGRSVDLPYLTQVAK
C7JHV8_ACEP3          --------------MSYAVPDK--INVLWFLPTHG-DSRYLGTQKGGRPVDLPYLQQVAK
D4I2P7_ERWAC          --------------MSELPQGN--IKVFWFLPTHG-DGRYLGTTQGGRAVDLPYLQQVAL
E5B5C2_ERWAM          --------------MSELPQGN--IKVFWFLPTHG-DGRYLGTTQGGRAVDLPYLQQVAL
D4GGW4_PANAM          --------------MPDTAEKN--INLFWFLPTHG-DGRYLGTTQGGRAVDLPYLQQVAL
B5XUZ3_KLEP3          --------------MTQQAPDK--INVFWFLPTHG-DGRYLGTTEGGRPVDLPYLQQVAL
A6TD77_KLEP7          --------------MTQQAPDK--INVFWFLPTHG-DGRYLGTTEGGRPVDLPYLQQVAL
Q1AV42_RUBXD          --------------MSQTNGDKGEIKVLWFLPTHG-DGRYLGTNEGGRAVDLGYLGQIAQ
SSUD_BACVZ            ------------------------MEILWFIPTHG-DGRYLGTQTGGRTADHLYFKQVAQ
SSUD_BACSU            ------------------------MEILWFIPTHG-DARYLGSESDGRTADHLYFKQVAQ
SSUD_BACLD            ------------------------MDILWFIPTHG-DGRYLGTNTGGRAADHTYFQQVAQ
D5DLP6_BACMD          ------------------------MKMLWFIPSHG-DGRYLGTNRGGRSADYSYFRQVAQ
D5DTN9_BACMQ          ------------------------MKMLWFIPSHG-DGRYLGTNRGGRSADYSYFRQVAQ
C3GK80_BACTU          ------------------------MELLWFIPAYG-DGRYLGTTKRGRAAEYGYYKQVAQ
A0A6L7HK57_BACAN      ------------------------MELLWFIPAYG-DGRYLGTTKRGRAAEYGYYKQVAQ
A0RFA1_BACAH          ---------------------MQKMELLWFIPAYG-DGRYLGTTKRGRAAEYGYYKQVAQ
Q63A41_BACCZ          ------------------------MELLWFIPAYG-DGRYLGTTKRGRAAEYGYYKQVAQ
Q6HHJ0_BACHK          ------------------------MELLWFIPAYG-DGRYLGTTKRGRAAEYGYYKQVAQ
Q736E3_BACC1          ------------------------MELLWFIPAYG-DGRYLGTTKRGRAAEYGYYKQVAQ
B7JSS0_BACC0          ------------------------MELLWFIPAYG-DGRYLGTTKRGRAAEYGYYKQVAQ
D8H1E6_BACAI          ------------------------MELLWFIPAYG-DGRYLGTTKRGRAAEYGYYKQVAQ
B9J439_BACCQ          ------------------------MELLWFIPAYG-DGRYLGTTKRGRAAEYGYYKQVAQ
B7HUM3_BACC7          ------------------------MELLWFIPAYG-DGRYLGTTKRGRAAEYGYYKQVAQ
B7H609_BACC4          ------------------------MELLWFIPAYG-DGRYLGTTKRGRAAEYGYYKQVAA
Q81C71_BACCR          ------------------------MELLWFIPAYG-DGRYLGTTKRGRAAEYGYYKQVAA
B7IKQ8_BACC2          ------------------------MELLWFIPAYG-DGRYLGTTKRGRAAEYGYYKQVAV
A7GQ63_BACCN          ------------------------MEILWFIPAYG-DGRYLGTTKRGRAAEYGYYKQVAQ
C5D5P5_GEOSW          ------------------------MELLWFIPSHG-DGRYLGTTKGGRTAEYSYFRQIAQ
A4IRJ7_GEOTN          -----------------------MMELLWFIPSHG-DGRYLGTTKGGRSPEYSYFKQVAQ
D5DB81_BACMD          ------------------------MELFWFIPTYG-DGRYLGSHEGARAASYSYCKQVAQ
D5E199_BACMQ          ------------------------MELFWFIPTYG-DGRYLGSHEGARAASYSYCKQVAQ
C8WUN5_ALIAD          ------------------------MDFFWFIPTHG-DTRYLGTTYGARQVDLGYMRQVAQ
Q5WKG6_BACSK          ------------------------MSFFWFIPTHG-DGRYLGSTVGGRPVTFDYARQVAQ
Q3M323_TRIV2          ------------------------MQLHWFIPTHG-EGRYLGTAIGGRVVNFDYWRQIAQ
B0JKK3_MICAN          ------------------------MQLLWFIPTHG-DGRYLGTAIGGRSVTFAYMLQIAR
B2JAA3_NOSP7          ------------------------MQILWFIPTGSHDGRYLGTDIGSRVATPDYLQQIAQ
A9B1Y4_HERA2          ------------------------MEILWFIPTHG-DGRYLASTVASRSTTFPYLRQIAQ
A6SWR5_JANMA          ------------------------MELFWFLPTYG-DGRFLGTAVGSREATLGYLKQVAL
A0A0K1JRS4_9BACL      ------------------------MEMFWYLPTMG-DGRYLGTTKGAKITNMHYFRQIAQ
D1CHA3_THET1          ------------------------MNVFWFIPTGG-DGRYLGTSYLGRASNFDYLKQIAQ
D7DP41_METV0          ------------------------MQIFWFLPTHG-DQRYLGTSVGARPATYSYLKQIAK
C6X755_METGS          ------------------------MQIFWFLPTHG-DQRYLGTSYGARPATYSYLKQIAQ
                                                . *::*  . :  .:.     :     *  ::* 

SSUD_ECO55            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECOSE            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECO24            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
A0A5B7PH51_ECOLX      AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
C8ULF8_ECO1A          AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECO8A            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_SHIFL            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
D2ABI8_SHIF2          AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_SHIF8            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECOLU            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
D3H0G4_ECO44          AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECO27            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECOL5            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECOBW            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
A0A070SVD4_ECOLX      AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECODH            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECOHS            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECOLC            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECOLI            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECO57            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECO5E            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
D3QPD2_ECOCB          AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECO45            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECOK1            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECOUT            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
A0A0E2L880_ECOU3      AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECOL6            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECO81            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
W8ZQD3_ECOLX          AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECOSM            AADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ECO7I            AADRLGYTGVLIPTGRSCEDAWLVEASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ESCF3            VADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_CITK8            TADRLGFTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDR
D2TS72_CITRI          TADRLGFTGVLIPTGRSCEDAWLVAASMIPVTRRLKFLVALRPSVTSPTVAARQAATLDR
SSUD_ENT38            AADRIGFTGVLIPTGRSCEDAWLVAAAMIPVTQRLKFLVALRPSVVSPTVAARQAATLDR
A0A0H3CK28_ENTCC      AADRIGFTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVVSPTVAARQAATLDR
A0A1F2LQS7_9ENTR      TADRLGFTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVVSPTVAARQAATLDR
B5XY62_KLEP3          TADRLGFTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVVSPTVAARQAATLDR
A6T736_KLEP7          TADRLGFTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVVSPTVAARQAATLDR
SSUD_CROS8            AADRLGFTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVVSPTVAARQAATLDR
C9Y0N2_CROTZ          AADRLGFTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVVSPTVAARQAATLDR
SSUD_ERWT9            AADRLGFGGVLIPTGRSCEDAWLVAASLIPVTQRLRFLVALRPGVISPTQAARQAATLDR
D4I0B4_ERWAC          AADRLGFGGVLIPTGRSCEDAWLVAASLVPVTQRLRFLVALRPGVISPTQAARQAATLDR
SSUD_PECCP            AAERQGFGGVLLPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGVISPTIAARQAATLDR
A0A0H3I306_PECPM      AAERQGFGGVLLPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGVISPTIAARQAATLDR
SSUD_PECAS            AAERQGFGGVLLPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGVISPTIAARQAATLDR
SSUD_YERPB            AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTLAARQAATLDR
SSUD_YERPS            AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTLAARQAATLDR
SSUD_YERPY            AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTLAARQAATLDR
SSUD_YERP3            AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTLAARQAATLDR
SSUD_YERPA            AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTLAARQAATLDR
SSUD_YERPE            AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTLAARQAATLDR
SSUD_YERPN            AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTLAARQAATLDR
SSUD_YERPP            AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTLAARQAATLDR
SSUD_SERP5            AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTLAARQAATLDR
D2BXP8_DICZ5          AADRLGFGGVLIPTGRSCEDSWLVASSLIPVTQRLRFLVALRPGIISPTLAARQAATLDR
C6CFJ9_DICC1          AADRLGFGGVLIPTGRSCEDSWLVASSLISVTRRLRFLVALRPGIISPTLAARQAATLDR
C6C3U5_DICP7          AADRLGFGGVLIPTGRSCEDSWLVAASLISVTQRLRFLVALRPGIVSPTLAARQAATLDR
SSUD_PSEPK            AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTVAARQAATLDR
SSUD_PSEP1            AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTVAARQAATLDR
SSUD_PSEPG            AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTVAARQAATLDR
SSUD_PSEPW            AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTQHLKFLVALRPGIISPTVAARQAATLDR
SSUD_PSEE4            AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTERLKFLVALRPGIISPTVAARQAATLDR
SSUD_PSEAE            AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTVAARQAATLDR
A6V1Y2_PSEA7          AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTVAARQAATLDR
SSUD_PSEMY            AADRLGYGGVLIPTGRSCEDSWLVAASLIPVTQNLKFLVALRPGIISPTVAARQAATLDR
Q3K504_PSEPF          AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTVAARQAATLDR
C3K3U8_PSEFS          AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTVAARQAATLDR
Q4K439_PSEF5          AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTLRLKFLVALRPGIISPTVAARQAATLDR
SSUD_AZOVD            AADRLGFGGVLIPTGRSCEDSWLVAASLIPVTRRLKFLVALRPGIISPTVAARQAATLDR
Q21XJ7_RHOFT          AADELGYGGVLIPTGRSCEDSWIVASSLIPVTRRLKFLVALRPSTISPTVQARQAATFDR
SSUD_AGRFC            AADRLGYSGVLIPTGVACEESFILAANLAAYTEKLKFLVAIRPGVASPAYYARLASTLDR
SSUD_RHIE6            AADRLGYSGVLIPTGAACEESFILAADLAAHTERLKFLVAIRPGTASPAYYARLAATLDR
C3MH35_SINFN          AADRLGYSGVLLPTGVACEESFILAAHLAASTENLKLLVAIRPGIASPAYYARLAATLDR
C6B0T4_RHILS          AVDRLGYSGVLLPTGVACEESFVTAAALAAKTEKLQFLVAIRPGTASPAYYARLATTLDR
Q1MFL6_RHIL3          AVDRLGYSGVLLPTGVACEESFVTAAALAAKTEKLQFLVAIRPGTASPAYYARLATTLDR
B5ZSB3_RHILW          AVDRLGYSGVLLPTGVACEESFVMAAALAAKTEKLQFLVAIRPGTASPAYYARLATTLDR
Q2K7H6_RHIEC          AVDRLGYSGVLLPTGVACEESFVTAAALAAKTEKLQFLVAIRPGTASPAYYARLATTLDR
B9JG07_AGRRK          AVDRLGFSGVLLPTGVSCEESFITAAALSAHTQKLKFLVAIRPGTASPAYYARLASTLDR
B9K142_AGRVS          AVDRLGYYGVLLPTGVACEESFVTAASLAAHTQKLKFLVAIRPGTASPAYYARLAVALDR
A8I8W6_AZOC5          AVDRLGFEGVLLPTGQSCEDSWITAAGLATATERLRFLVALRPGVTTPVFAARQTAALDR
A7IKZ2_XANP2          AVDRLGFKGVLLPTGQSCEDSWITAAGLATATERLKFLVALRPGVTTPAFAARQAAALDR
SSUD2_RHILO           AVDRLGFPGVLLPTGQNCEDSWITATGLATLTEKLKFLVALRPGVTLPTFAARQTAALDR
C1DGL2_AZOVD          TAESLGYDGLLIPTGSSCLDPWVTAASLVPVTSRIKLLVALRTSVSGPTATARQAATLDQ
A1VJQ2_POLNA          TAESLGYDGLLIPTGSSCLDPWVTASSLIAVTQRIKLLVALRTSVTGPTASARQAATLDQ
A9BUV1_DELAS          TAEELGYDGLLIPTGSSCLDPWVVASSLVPVTQRIKLLVALRTSLGAPVSSARQAATLDQ
D8IQ40_HERSS          TSETLGYDGLLIPTGASCLDPWVVAASLVPVTQRIKLLVALRTSLGGPGPSARQAATLDQ
A5EEY6_BRASB          TVDRLGYDGILIPTGASCADPWVTAATLVGVTRRIKLLVALRTSISGPTAGARQAAALDE
SSUD_ACIAC            AADTLGYEGVLIPTGRSCEDPWVVASALAPVTRRLKFLVAVRPGLHQPALAARMAATFDR
SSUD_DELAS            AADSLGYEGVLIPTGRSCEDPWVVASSLIPVTRRLKFLVAVRPGLHQPSLAARMAASFDR
SSUD_POLNA            AADTQGYDGVLIPTGRSCEDPWVVASSLISATKNLKFLVAVRPGLHQPSLAARMAATFDR
SSUD_VARPS            AADQLGYEGVLIPTGRSCEDPWVIASSLIGATKNLKFLVAVRPGLHQPSLAARMAATFDR
SSUD_RALPJ            AADTLGYEGVLIPTGRSCEDPWVVAASLIPVTKRLRFLVAVRPGLMAPTLAARMAATYDR
C6BH37_RALP1          AADTLGYEGVLIPTGRSCEDPWIVAASLIPVTKRLRFLVAVRPGLMAPTLAARMAATYDR
SSUD_RALSO            AADTLGYEGVLIPTGRSCEDPWIVAASLIPATRRLRFLVAVRPGLVAPTLAARMAATFDR
SSUD_CUPNH            AADTLGYEGVLIPTGRSCEDPWVAASALAAVTQRLKFLVAVRPGLMAPTLAARMAATFDR
SSUD_CUPTR            AADTLGYEGVLIPTGRSCEDPWVVASALAAVTQRLKFLVAVRPGLMAPTLAARMAATFDR
SSUD_CUPMC            AADTLGYDGVLIPTGRSCEDPWVVASALAAVTRKLRFLVALRPGLMTPTLAARMAATFDR
SSUD_XANAC            AADTLGYEGVLIPTGRSCEDPWVIASSLINATRRLKFLVALRPGLMAPALAARTAASFDR
A2SBY8_METPP          AADSLGYEGVLIPTGRSCEDPWVVASSLIGETRRLKFLVALRPGLVAPSQSARMAATFDR
SSUD_PARPJ            AADTLGYEGVLLPTGRSCEDAWVVASSLIAATKRLKFLVAIRPGISSPGLAARMAATFDR
D5W7K4_BURSC          AADTLGYEGVLLPTGRSCEDAWVVASSLIPATQRLKFLVAIRPGLSSPGLAARMAATFDR
SSUD_PARP8            AADTLGYEGVLLPTGRSCEDAWVVASSLIPATQRLKFLVAIRPGIASPGLSARMAATFDR
Q63TV9_BURPS          AADTLGYDGVLLPTGRSCEDAWVVASSLIPATKRLKFLVAIRPGLSSPGLSARMASTFDR
A3NUT1_BURP0          AADTLGYDGVLLPTGRSCEDAWVVASSLIPATKRLKFLVAIRPGLSSPGLSARMASTFDR
A2S363_BURM9          AADTLGYDGVLLPTGRSCEDAWVVASSLIPATKRLKFLVAIRPGLSSPGLSARMASTFDR
SSUD_BURP1            AADTLGYDGVLLPTGRSCEDAWVVASSLIPATKRLKFLVAIRPGLSSPGLSARMASTFDR
A3N936_BURP6          AADTLGYDGVLLPTGRSCEDAWVVASSLIPATKRLKFLVAIRPGLSSPGLSARMASTFDR
A0A0H2XNI1_BURCA      AADTLGYDGVLLPTGRSCEDAWVVASSLIPATQRLKFLVAVRPGIASPGLAARMAATFDR
B1K0T2_BURCC          AADTLGYDGVLLPTGRSCEDAWVVASSLIPATQRLKFLVAVRPGIASPGLAARMAATFDR
B4E8P2_BURCJ          AADTLGYDGVLLPTGRSCEDAWVVASSLIPATQRLKFLVAVRPGIASPGLAARMAATFDR
Q39GW7_BURL3          AADTLGYEGVLLPTGRSCEDAWVVASSLIPATQRLKFLVAIRPGIASPGLSARMAATFDR
Q0BFQ2_BURCM          AADTLGYEGVLLPTGRSCEDAWVVASSLIPATQRLKFLVAVRPGIASPGLAARMAATFDR
B1YPJ4_BURA4          AADTLGYEGVLLPTGRSCEDAWVVASSLIPATQRLKFLVAVRPGIASPGLAARMAATFDR
A4JE30_BURVG          AADTLGYEGVLLPTGRSCEDAWVVASSLIPATQRLKFLVAIRPGIASPGLSARMAATFDR
A0A0H3KF22_BURM1      AADTLGYEGVLLPTGRSCEDAWVVASSLIPATRRLKFLVAVRPGIASPGLSARMAATFDR
C5AGU6_BURGB          AADTLGYEGVLLPTGRSCEDAWVVASSLIPATRRLKFLVAVRPGLSSPGLAARMAATFDR
A9IMS5_BORPD          AADTLGYDGVLLPTGRSCEDAWVVASSLIGATRRLKFLVAVRPGVSSPQFAARMAATFDR
A6SVY3_JANMA          SADTLGYDGVLLPTGRSCEDAWVAASSLIGETKQLKFLVAVRPGLSTPGLAVRMAATFDR
D8IQQ1_HERSS          AADTLGYDGVLLPTGRSCEDAWVAAASLIDATRRLKFLVAVRPGLMAPTLAARMAATFDR
B0V5V9_ACIBY          AVDNLGYEGVLIPTGRSCEDPWITAASLIDATQHLKFLVALRPGVTTPALAARMAATFDR
A0A0J1A8C8_ACIBA      AVDNLGYEGVLIPTGRSCEDPWITAASLIDATQHLKFLVALRPGVTTPALAARMAATFDR
B0VMM8_ACIBS          AVDNLGYEGVLIPTGRSCEDPWITAASLIDATQHLKFLVALRPGVTTPALAARMAATFDR
D8JJB2_ACISD          AVDNLGYEGVLIPTGRSCEDPWITAASLIDATQHLKFLVALRPGVTTPALAARMAATFDR
Q6FFY9_ACIAD          AVDNLGYSGVLIPTGRSCEDPWITAASLIDATKQLKFLVALRPGITTPALAARMAATFDR
SSUD_PSE14            AADDLGYYGVLIPTGRSCEDSWVIASALVPLTERLKYLVAIRPGIISPTVSARMAATLDR
SSUD_PSESM            AADDLGYYGVLIPTGRSCEDSWVIASALVPLTERLKYLVAIRPGIISPTVSARMAATLDR
SSUD_PSEU2            AADDLGYYGVLIPTGRSCEDSWVIASALVPLTERLRYLVAIRPGIISPTVSARMAATLDR
Q4K935_PSEF5          AADSLGYHGVLIPTGRSCEDSWVIASALVPLTERLRYLVAIRPGIISPTVSARMAATLDR
C3K524_PSEFS          AADSLGYYGVLIPTGRSCEDSWVIASALVPLTERLRYLVAIRPGIISPTVSARMAATLDR
Q3K9A1_PSEPF          AADSLGYHGVLIPTGRSCEDSWVIASALVPLTERLRYLVAIRPGIISPTVSARMAATLDR
MSUD_PSEAE            AADSLGYHGVLIPTGRSCEDSWVVASALAPLTERLRFLVAIRPGIVSPTVSARMAATLDR
A0A0H2ZBA9_PSEAB      AADSLGYHGVLIPTGRSCEDSWVVASALAPLTERLRFLVAIRPGIVSPTVSARMAATLDR
A6V5D1_PSEA7          AADSLGYHGVLIPTGRSCEDSWVVASALAPLTERLRFLVAIRPGIVSPTVSARMAATLDR
SSUD_SORC5            AADDLGYHGVLVPTGRSCEDAWAVASAMIPLTQRLRFLVAVRPGVVSPTWAARMASTVDR
C5AZ36_METEA          AADDLGYYGVLLPTGRSCEDSWVVASALAPLTQRLRFLVAVRPGLQEPSMAARMAATLDR
A9W7M5_METEP          AADDLGYYGVLLPTGRSCEDSWVVASALAPLTQRLRFLVAVRPGLQEPSMAARMAATLDR
SSUD_METC4            AADDLGYYGVLLPTGRSCEDSWVVASALAPLTQRLRFLVAVRPGLQEPSMAARMAATLDR
C7CDS9_METED          AADDLGYYGVLLPTGRSCEDSWVVASALAPLTQRLRFLVAVRPGLQEPSMAARMAATLDR
B1ZLP7_METPB          AADDLGYYGVLLPTGRSCEDSWVVASALAPLTQRLRFLVAVRPGLQEPSVAARMAATLDR
B8ILH7_METNO          AADELGYFGVLLPTGRSCEDSWIVASALAPLTKRLRFLVAVRPGLQEPSMAARMAATLDR
B0UGA6_METS4          AADDLGYFGVLLPTGRSCEDSWIVASALAPLTRRLRFLVAVRPGLQEPSAAARMAATLDR
B1M3N9_METRJ          GADELGYYGVLLPTGRSCEDSWIVASALAPLTKQLRFLVAVRPGLMEPSAAARMTATLDR
Q0BVJ8_GRABC          AADELGYYGLLLPTGKSCEDSWIIASAMVPLTQRTRFLVAVRPGLSEPSMTARMAATLDR
A8IC39_AZOC5          AADQLGYYGVLIPTGRSCEDSWIVASALAPATEKLRYLIAVRPGLLEPAVAARMTATLDR
A7IEL9_XANP2          AADQLGYYGVLIPTGRSCEDSWIVASALAGLTERLRFLVAVRPGLLSPGVAARMTATLDR
B2IFA8_BEII9          AADELGYFGVLLPTGRSCEDSWIVASALAPRTRRLRFLVAVRPGLQSPAVAARMTATLDR
SSUD_RHOPA            AADQLGYFGVLLPTGRSCEDSWVVASAVAPWTERLRYLVAVRPGLQSPSVAARMTATLDR
SSUD_RHOPT            AADQLGYFGVLLPTGRSCEDSWVVASAVAPWTERLRYLVAVRPGLQSPSVAARMTATLDR
Q07LQ6_RHOP5          AADQLGYFGVLIPTGRSCEDSWIVASAVAPWTERLRYLVAVRPGLQSPAVAARMTATLDR
A5ED25_BRASB          AADQLGYYGVLIPTGRSCEDSWIVASAVAPFTEKLRYLVAVRPGLQSPGVAARMTATLDR
A4Z097_BRASO          AADQLGYYGVLLPTGRSCEDSWIVASAVAPFTEKLRYLVAVRPGLQSPSVAARMTATLDR
SSUD_BRADU            AADQLGYFGVLLPTGRSCEDSWIVASSVAPFTERLRYLVAVRPGLQSPSVAARMTATLDR
Q3SUU3_NITWN          AADQLGYYGVLLPTGRSCEDSWVTASAVAPWTERLRYLVAVRPGLQSPTVAARMTATLDR
D3P029_AZOS1          AADSLGYYGVLLPTGRSCEDSWVVASSLVPVTERLRFLVAVRPGLQSPTLAARMAATLDR
B8EQZ6_METSB          AADSLGYFGVLLPTGRSCEDSWVVASALAPLTKQLRFLVAVRPGLSSPTLAARMTATLDR
D7A632_STAND          AADRLGYYGVLIPTGKSCEDSWLVASALAPATKRLRYLVAVRPGLASPTLYARMTATLDR
SSUD1_RHILO           AADTLGYYGVLLPTGRSCEDSWVIASALVPLTERLRFLVAVRPGLQSPTLAARMTATLDR
C7JHV8_ACEP3          AADTLGYYGVLIPTGRSCEDSWVVASALAPVTEHLRYLIAVRPGLLSPTLAARMTATLDR
D4I2P7_ERWAC          AADNLGYYGVLIPTGKSCEDAWLVASALAPLTKRLRYLVAVRPGLQPPSLAARMAATLDR
E5B5C2_ERWAM          AADNLGYYGVLIPTGKSCEDAWLVASALAPLTKRLRYLVAVRPGLQPPSLAARMAATLDR
D4GGW4_PANAM          AADNLGFYGVLIPTGKSCEDAWLVASALVPITKQLRYLVAVRPGLQPPSLAARMAATLDR
B5XUZ3_KLEP3          AADSLGYYGVLIPTGKSCEDSWLVASALAPLTRRLRYLVAVRPGLQPPTLAARMAATLDR
A6TD77_KLEP7          AADSLGYYGVLIPTGKSCEDSWLVASALAPLTRRLRYLVAVRPGLQPPTLAARMAATLDR
Q1AV42_RUBXD          AADNLGYHGVLLPTGRSCEDAWVVASAMVPLTRSLRYLVAVRPALQPPSLAARMTATLDR
SSUD_BACVZ            AADRLGYTGVLLPTGRSCEDPWLTAAALAGETSDLKFLVAVRPGLMQPSVAARMASTMDR
SSUD_BACSU            AADRLGYTGVLLPTGRSCEDPWLTASALAGETKDLKFLVAVRPGLMQPSLAARMTSTLDR
SSUD_BACLD            AADRLGYTGVLLPTGRSCEDPWITAAALASVTKNLKFLVAVRPGLMQPSVAARMASTFDR
D5DLP6_BACMD          AADRLGFEGVLIPTGKSCEDPWLLAASLIPETERLKFLVAVRPGIMAPSVAARMTSTLDR
D5DTN9_BACMQ          AADRLGFEGVLIPTGKSCEDPWLLAASLIPETERLKFLVAVRPGIMAPSVAARMTSTLDR
C3GK80_BACTU          AADYLGYTGVLLPTGQGCEDPWVLASALAAETEKLKFLVAVRPGLMSPTVAARMASTFDR
A0A6L7HK57_BACAN      AADYLGYTGVLLPTGQGCEDPWVLASALAAETEKLKFLVAVRPGLMSPTVAARMASTFDR
A0RFA1_BACAH          AADYLGYTGVLLPTGQGCEDPWVLASALAAETEKLKFLVAVRPGLMSPTVAARMASTFDR
Q63A41_BACCZ          AADYLGYTGVLLPTGQGCEDPWVLASALAAETEKLKFLVAVRPGLMSPTVAARMASTFDR
Q6HHJ0_BACHK          AADYLGYTGVLLPTGQGCEDPWVLASALAAETEKLKFLVAVRPGLMSPTVAARMASTFDR
Q736E3_BACC1          AADYLGYTGVLLPTGQGCEDPWVLASALAAETEKLKFLVAVRPGLMSPTVAARMASTFDR
B7JSS0_BACC0          AADYLGYTGVLLPTGQGCEDPWVLASALAAETEKLKFLVAVRPGLMSPTVAARMASTFDR
D8H1E6_BACAI          AADYLGYTGVLLPTGQGCEDPWVLASALAAETEKLKFLVAVRPGLMSPTVAARMASTFDR
B9J439_BACCQ          AADYLGYTGVLLPTGQGCEDPWVLASALAAETEKLKFLVAVRPGLMSPTVAARMASTFDR
B7HUM3_BACC7          AADYLGYTGVLLPTGQGCEDPWVLASALAAETEKLKFLVAVRPGLMSPTVAARMASTFDR
B7H609_BACC4          AADYLGYTGVLLPTGQGCEDPWVLASALAAETEKLKFLVAVRPGLMSPTVAARMASTFDR
Q81C71_BACCR          AADYLGYTGVLLPTGQGCEDPWVLASALAAETEKLKFLVAVRPGLMSPTVAARMASTFDR
B7IKQ8_BACC2          AADYLGYTGVLLPTGQGCEDPWVLASALAAETEKLKFLVAVRPGLMSPTVAARMASTFDR
A7GQ63_BACCN          AADYLGYSGVLLPTGQGCEDPWVLASALAAETEKLRFLVAVRPGIMSPTVAARMASTFDR
C5D5P5_GEOSW          AADRLGYKGVLIPTGKSCEDPWLLASALAAETEQLHFLVAVRPGLMSPTLAARMASTLDR
A4IRJ7_GEOTN          AADRLGYTGVLIPTGKSCEDPWLLASALAAETNRLRFLVAVRPGLMTPTLAARMASTLDR
D5DB81_BACMD          AADELGYSGVLLPTGKSCEDAWIAASTLVPVTENLKFLVAVRPGLMSPTQAARMAATFDR
D5E199_BACMQ          AADELGYSGVLLPTGKSCEDAWIAASTLVPVTENLKFLVAVRPGLMSPTQAARMAATFDR
C8WUN5_ALIAD          AADNLGYDGVLLPTGRSCEDAWIVASALIPATERLRFLVALRPGLMSPVLAARMAATFDR
Q5WKG6_BACSK          AADQLGYKGVLLPTGQSCEDAWVTASSLISATEQLKFLVALRPGVISPTAAARMAVTFDR
Q3M323_TRIV2          AVDHLGFTGALLPTGRSCEDAWILASTLVTHTKQMKFLVAIRPGLMSPGVAARMAATFDR
B0JKK3_MICAN          AVDDLGYTGALLPTGRSCEDAWIVASTLVTHTRQMRFLVAVRPGLVSPGVAARMAATFDR
B2JAA3_NOSP7          AVDSLGYTGALLPTGSSCEDAWITAAAFISVTKQMKFLVAIRPGITSPGAAARMAATFDR
A9B1Y4_HERA2          AVDELGFTGALLPTGHYCEDAWVLASALSAVTRQMKFLVAIRPGLMLPGPAVRMASTFDR
A6SWR5_JANMA          ASEELGFSGVLVPSGKGCDDAWIVASNLAAITQRLKFLIALRPGIIAPAAAARMASALDR
A0A0K1JRS4_9BACL      AVDQLGYSGMLVPTGHACEDGWVVASALMQATEKLKFLVAVRPGGISVSIAARMAASFER
D1CHA3_THET1          AVDALGYEGALLPTGANCEDAWIVASSLIPLTRRMKFLVAVRPGLISPTLAARMAATFDR
D7DP41_METV0          AADRLGFNGVLVPSGRSCEDPWVVSASLINETERLKFLVAVRPGFTSPTVSARMASTLDR
C6X755_METGS          AADRLGYEGVLVPSGRSCEDPWVVSASLVNETRDLKFLVAVRPGFTSPTVSARMASTLDR
                        :  *: * *:*:*  * : :   : .   *   : *:*:*..       .* : : :.

SSUD_ECO55            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----NFNG
SSUD_ECOSE            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----NFNG
SSUD_ECO24            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----NFNG
A0A5B7PH51_ECOLX      LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----NFNG
C8ULF8_ECO1A          LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----NFNG
SSUD_ECO8A            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----NFNG
SSUD_SHIFL            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----NFNG
D2ABI8_SHIF2          LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----NFNG
SSUD_SHIF8            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----NFNG
SSUD_ECOLU            LSNGRALFNLVTGSDPQELAGDGVFLDHRERYEASAEFTQVWRRLLLGETV-----NFNG
D3H0G4_ECO44          LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----NFNG
SSUD_ECO27            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----NFNG
SSUD_ECOL5            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----NFNG
SSUD_ECOBW            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLQRETV-----DFNG
A0A070SVD4_ECOLX      LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLQRETV-----DFNG
SSUD_ECODH            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLQRETV-----DFNG
SSUD_ECOHS            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLQRETV-----DFNG
SSUD_ECOLC            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLQRETV-----DFNG
SSUD_ECOLI            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLQRETV-----DFNG
SSUD_ECO57            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----DFNG
SSUD_ECO5E            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----DFNG
D3QPD2_ECOCB          LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----DFNG
SSUD_ECO45            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----DFNG
SSUD_ECOK1            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----DFNG
SSUD_ECOUT            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----DFNG
A0A0E2L880_ECOU3      LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----DFNG
SSUD_ECOL6            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----DFNG
SSUD_ECO81            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----DFNG
W8ZQD3_ECOLX          LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----DFNG
SSUD_ECOSM            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----DFNG
SSUD_ECO7I            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----DFNG
SSUD_ESCF3            LSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLLGETV-----DFNG
SSUD_CITK8            LSNGRALFNLVTGSDPQELAGDGVFLDHTERYEASSEFTQVWRRLLQGETV-----DFNG
D2TS72_CITRI          LSDGRALFNLVTGSDPQELAGDGVFLNHTERYEASAEFTQVWRRLLQGETV-----DFNG
SSUD_ENT38            LSNGRALFNLVTGSDPTELAGDGVFLDHTERYEASAEFTRVWRRLLEGDTV-----TYEG
A0A0H3CK28_ENTCC      LSNGRALFNLVTGSDPQELAGDGVFLDHTERYEASAEFTRVWRRLLEGETV-----TFDG
A0A1F2LQS7_9ENTR      LSNGRALFNLVTGSDPAELAGDGVFLDHTERYEASAEFTHIWRKLMEGETV-----TFNG
B5XY62_KLEP3          LSNGRALFNLVTGSDPAELAGDGVFLDHTERYEASAEFTHIWRKLMEGETV-----TFNG
A6T736_KLEP7          LSNGRALFNLVTGSDPAELAGDGVFLDHTERYEASAEFTHIWRKLMEGETV-----TFNG
SSUD_CROS8            LSNGRALFNLVTGSDPQELAGDGVFLDHTARYEASAEFTRVWRRLLEGEKV-----DFEG
C9Y0N2_CROTZ          LSNGRALFNLVTGSDPQELAGDGVFLDHTARYEASAEFTRVWRRLLEGEKV-----DFEG
SSUD_ERWT9            LSNGRALFNLVTGGDAEELAGDGVFLDHRERYAESAEFTRVWRRVLEGETV-----DYEG
D4I0B4_ERWAC          LSNGRALFNLVTGGDAGELAGDGVFLDHRQRYAESAEFTRVWRRVLEGETV-----DYEG
SSUD_PECCP            LSNGRALFNLVTGGDPEELAAEGLFLSHEERYEASAEFTHIWRRLLEGETV-----DFAG
A0A0H3I306_PECPM      LSNGRALFNLVTGGDPEELAAEGLFLSHEERYEASAEFTHIWRRLLEGETV-----DFAG
SSUD_PECAS            LSNGRALFNLVTGGDPEELAAEGLFLSHEERYEASAEFTHIWRRLLEGETV-----DFAG
SSUD_YERPB            LSNGRALFNLVTGGDPEELAAEGLHLNHTERYEASAEFTHVWRKVLEGETV-----DFAG
SSUD_YERPS            LSNGRALFNLVTGGDPEELAAEGLHLNHTERYEASAEFTHVWRKVLEGETV-----DFAG
SSUD_YERPY            LSNGRALFNLVTGGDPEELAAEGLHLNHTERYEASAEFTHVWRKVLEGETV-----DFAG
SSUD_YERP3            LSNGRALFNLVTGGDPEELAAEGLHLNHTERYEASAEFTHVWRKVLEGETV-----DFAG
SSUD_YERPA            LSNGRALFNLVTGGDPEELAAEGLHLNHTERYEASAEFTHVWRKVLEGETV-----DFAG
SSUD_YERPE            LSNGRALFNLVTGGDPEELAAEGLHLNHTERYEASAEFTHVWRKVLEGETV-----DFAG
SSUD_YERPN            LSNGRALFNLVTGGDPEELAAEGLHLNHTERYEASAEFTHVWRKVLEGETV-----DFAG
SSUD_YERPP            LSNGRALFNLVTGGDPEELAAEGLHLNHTERYEASAEFTHVWRKVLEGETV-----DFAG
SSUD_SERP5            LSNGRALFNLVTGGDPDELAAEGLHLNHEERYEASAEFTHIWRKVLEGETV-----DFNG
D2BXP8_DICZ5          LSNGRALFNLVTGGDPEELAAEGLFLDHEQRYEASAEFTRIWRRVLEGETV-----DYDG
C6CFJ9_DICC1          LSNGRALFNLVTGGDPEELAAEGLFLDHQQRYEASAEFTRIWRRVLEGETV-----DYDG
C6C3U5_DICP7          LSNGRALFNLVTGGDPDELAAEGLFLDHAARYEASAEFTRIWRRVLAGESV-----DYDG
SSUD_PSEPK            LSNGRALFNLVTGGDPDELAGDGLHLNHQERYEASVEFTRIWRKVLEGENV-----DYDG
SSUD_PSEP1            LSNGRALFNLVTGGDPDELAGDGLHLNHQERYEASVEFTRIWRKVLEGENV-----DYDG
SSUD_PSEPG            LSNGRALFNLVTGGDPDELAGDGLHLNHQERYEASVEFTRIWRKVLEGENV-----DYDG
SSUD_PSEPW            LSNGRALFNLVTGGDPDELAGDGLHLNHQERYEASVEFTRIWRKVLEGENV-----DYQG
SSUD_PSEE4            LSNGRALFNLVTGGDPDELAGDGLHLNHQERYEASVEFTRIWRKVLEGEVV-----DYDG
SSUD_PSEAE            LSNGRALFNLVTGGDPDELAGDGLHLSHAERYEASVEFTRIWRRVLEGETV-----DYAG
A6V1Y2_PSEA7          LSNGRALFNLVTGGDPDELAGDGLHLSHAERYEASVEFTRIWRRVLEGETV-----DYAG
SSUD_PSEMY            LSNARALFNLVTGGDPDELAGDGLHLSHAERYEASVEFTRIWRRVLEGETV-----DYDG
Q3K504_PSEPF          LSGGRALFNLVTGGDPEELAGDGLFLDHEARYQASVEFTRIWRRVLEGETV-----DYDG
C3K3U8_PSEFS          LSGGRALFNLVTGGDPEELAGDGLFLSHEERYQASVEFTRIWRRVLEGETV-----DYDG
Q4K439_PSEF5          LSGGRALFNLVTGGDPDELAGDGLFLDHEERYQASVEFTRIWRRVLEGETV-----DYDG
SSUD_AZOVD            LSGGRALFNLVTGGDPEELAGEGLHLSHAERYEAATEFTRIWRGVLSGETV-----DLQG
Q21XJ7_RHOFT          LSEGRLLVNIVAGGDTGDLEADGTFLSHDERYEHAREFIHVWKRLLAGEEV-----TYEG
SSUD_AGRFC            VSHGRLLLNIVVGGSAQELAGDGIFLPHDERYDHADEFFQVFNSLIETGKG-----DLDG
SSUD_RHIE6            VSNGRLLINIVVGGSAQELAGDGIFLPHDERYDHAGEFFQVFNSLVETGKA-----NLDG
C3MH35_SINFN          VSKGRLLLNIVVGGSAKELAGDGVFLPHDERYAHAEEFFHVFNRLLETGKA-----HLDG
C6B0T4_RHILS          ISNGRLLLNVVVGGSPAELAGDGIHLEHDERYAHAEEFFTVFEELLEKGTA-----SFDG
Q1MFL6_RHIL3          ISNGRLLLNIVVGGSPAELAGDGIHLEHDERYAHAEEFFTVFEELLEKGTA-----SFDG
B5ZSB3_RHILW          ISNGRLLLNIVVGGSPAELAGDGIHLEHDERYAHAEEFFTVFEELLDKGTA-----SFDG
Q2K7H6_RHIEC          ISNGRLLLNIVVGGSPAELAGDGIHLEHDERYAHAEEFFTVFEELLDKGTA-----SYDG
B9JG07_AGRRK          VSNGRVLLNIVVGGSPAELAGDGIHLEHDERYAHADEFFTVWEELMEKGSS-----TFKG
B9K142_AGRVS          VSNGRTLLNIVVGGSPTELAGDGIFVSHDERYAHADEFFTVWEDLLSKGHA-----DLNG
A8I8W6_AZOC5          LSDGRLLLNLVVGGHPGELAADGVFLGHDERYAQGAEFVAIWRALVRGETV-----NHEG
A7IKZ2_XANP2          LSDGRLLLNVVVGGHPAELAADGIFLDHDARYAQADEFLKIWRDLVAGKTV-----DHSG
SSUD2_RHILO           LSNGRLLLNVVVGGNPTELAGDGVFLPHDERYAQAHEFLTIWRGLVSGERV-----NFDG
C1DGL2_AZOVD          ALKGRLLLNVVPGGDATELAADGVFLDHDERYEAADEVLTVWRDLLQGKTV-----DFAG
A1VJQ2_POLNA          ALNGRLLLNVVPGGDAAELAAEGVYLDHDQRYEAADEFITVWRDLMAGKTV-----DFTG
A9BUV1_DELAS          ALGGRLLLNVVPGGDATELEADGIFLAHDERYAYADEFLTIWRRLLAGEAV-----DFDG
D8IQ40_HERSS          ALNGRLLLNVVPGGDATELEADGVFLKHDERYEAADEYLTIWRKLLQGETV-----NYEG
A5EEY6_BRASB          ALGGRLLLNVVPGGDATELAAEGVFLSHDERYDVADEYLTVWKRLLAGEKV-----DFEG
SSUD_ACIAC            LSGGRLLINLVTGGDRTELEGDGVFLDHAQRYAQSEEFIRIWREILSRSHE-GGTFDYEG
SSUD_DELAS            LSGGRLLINLVTGGDRAELEGDGVFLDHAQRYEQSAEFIRIWREILERSHE-GGTLDYEG
SSUD_POLNA            LSGGRLLINLVTGGDQAELEGDGVSLGHAERYEQSAEFIRIWREIIARSHT-GESFDYEG
SSUD_VARPS            LSGGRLLVNLVTGGDQSELEGDGVYLDHAQRYEQSAEFIRIWREILARSHS-GQAFDYEG
SSUD_RALPJ            LSNGRLLVNLVTGGDPAELAGDGLFLDHAQRYEASEEFIRIWRETLAASHE-GAALDYTG
C6BH37_RALP1          LSNGRLLVNLVTGGDPAELAGDGLFLDHAQRYEASEEFIRIWRETLAASHE-GAALDYNG
SSUD_RALSO            LSQGRLLVNLVTGGDPGELAGDGLFLDHAQRYEASAEFIRIWRETLAASHE-GAALDYTG
SSUD_CUPNH            ISNGRLLINLVTGGDTAELEGDGLFLDHTARYEASAEFLRIWRQVLAASHD-GDKVDYEG
SSUD_CUPTR            ISNGRLLINLVTGGDRAELEGDGLFLDHAARYEASAEFLRIWRQVLAASHD-GDKVDYDG
SSUD_CUPMC            VSNGRLLVNLVTGGDVAELEGDGLFLNHAERYEASAEFIRVWRDLLAASHE-NGEISFEG
SSUD_XANAC            LSGGRLLVNLVTGGDRGELEGDGVFLDHAERYEASAEFIRIWREIIAHSHS-GESYDFDG
A2SBY8_METPP          LSGGRLLVNLVTGGDAEELAGDGQFLSHAERYEQSVEFMKIWREVIARSHEPQNAVDFDG
SSUD_PARPJ            LSNGRLLINVVTGGDAAELEGDGVFVDHDTRYEITDEFLHIWRKLLTAAHT-NDAIDFEG
D5W7K4_BURSC          LSNGRLLINVVTGGDAAELAGDGVFVDHDTRYEITDEFLHIWRKLLAASHT-NEAIDFDG
SSUD_PARP8            LSGGRLLINVVTGGDAAELEGDGLFVDHDTRYEITDEFLRIWRGLLTSAHH-GESVEFIG
Q63TV9_BURPS          LSDGRLLINVVTGGDSAELEGDGLFADHDTRYAITDDFLHIWRGLLAESHE-NGGIDFDG
A3NUT1_BURP0          LSDGRLLINVVTGGDSAELEGDGLFADHDTRYAITDDFLHIWRGLLAESHE-NGGIDFDG
A2S363_BURM9          LSDGRLLINVVTGGDSAELEGDGLFADHDTRYAITDDFLHIWRGLLAESHE-NGGIDFDG
SSUD_BURP1            LSDGRLLINVVTGGDSAELEGDGLFADHDTRYAITDDFLHIWRGLLAESHE-NGGIDFDG
A3N936_BURP6          LSDGRLLINVVTGGDSAELEGDGLFADHDTRYAITDDFLHIWRGLLAESHE-NGGIDFDG
A0A0H2XNI1_BURCA      LSGGRLLINVVTGGDAAELEGDGLFADHDTRYEITDDFLNIWRGLLAASHD-NDGFDYIG
B1K0T2_BURCC          LSGGRLLINVVTGGDAAELEGDGLFADHDTRYEITDDFLNIWRGLLAASHD-NEGFDYIG
B4E8P2_BURCJ          LSGGRLLINVVTGGDAAELEGDGLFADHDTRYEITDDFLNIWRGLLAASHD-NDGFDYIG
Q39GW7_BURL3          LSGGRLLINVVTGGDAAELEGDGLFADHDTRYEITDDFLNIWRGLLSASHD-NGGFDYIG
Q0BFQ2_BURCM          LSGGRLLINVVTGGDSAELEGDGLFADHDTRYEITDDFLHIWRGLLAASHD-NGGFDYIG
B1YPJ4_BURA4          LSGGRLLVNVVTGGDAAELEGDGLFADHDTRYEITDDFLHIWRGLLAASHD-NGGIDYIG
A4JE30_BURVG          LSGGRLLINVVTGGDSAELEGDGLFADHDTRYEITDDFLNIWRGLLTASHD-NGGFDYIG
A0A0H3KF22_BURM1      LSGGRLLINVVTGGDAAELEGDGLFADHDTRYEITDDFLHIWRGLLAASHD-NDGFDYIG
C5AGU6_BURGB          LSQGRLLINVVTGGDATELEGDGVFVDHDTRYAITDEFLHIWRELLAKSHD-GASIDFDG
A9IMS5_BORPD          MSGGRLLVNVVTGGDPAELEGDGLFASHDERYAITADFLKIWRGILQASHE-GGSYSFQG
A6SVY3_JANMA          LSKGRLLINVVTGGDQAELEADGLHASHSERYEITDEFLKVWRASLSGEGG-DAGYDFEG
D8IQQ1_HERSS          LSGGRLLINVVTGGDPVEQESDGVFGSHAERYEISDEFLKIWRDVLTKTRS-GEPTHFQG
B0V5V9_ACIBY          LSNGRVLLNLVTGGDEAELRGDGLYEDHSTRYQTANEYVKIWREILTRSHT-GEAFTFHG
A0A0J1A8C8_ACIBA      LSNGRVLLNLVTGGDEAELRGDGLYEDHSTRYQTANEYVKIWREILTRSHT-GEAFTFHG
B0VMM8_ACIBS          LSNGRVLLNLVTGGDEAELRGDGLYEDHSTRYQTANEYVKIWREILTRSHT-GEAFTFHG
D8JJB2_ACISD          LSNGRVLLNLVTGGDEAELRGDGLYEDHSTRYQTANEYVKIWREILTRSHT-GEAFTFHG
Q6FFY9_ACIAD          LSNGRILLNLVTGGDEQELKGDGLYEDHSTRYQTASEYVKIWREILTRSHT-GESFTFHG
SSUD_PSE14            LSGGRLLINVVTGGDPDENRGDGSFLDHSERYEVTDEFLKIWRRVLQGEAV-----DFEG
SSUD_PSESM            LSGGRLLINVVTGGDPDENRGDGSFLDHSERYEVTDEFLHIWRRVLQGEAV-----DFEG
SSUD_PSEU2            LSGGRLLINVVTGGDPDENRGDGSFLDHSERYEVTDEFLKIWRRVLQGEAV-----DFEG
Q4K935_PSEF5          LSNGRLLINVVTGGDPDENRGDGSFLSHSERYEVTDEFLQIWRRVLQGEAV-----DFEG
C3K524_PSEFS          LSNGRLLINVVTGGDPDENRGDGSFLDHSERYEVSDEFLQIWRRVLQGESV-----DFEG
Q3K9A1_PSEPF          LSNGRLLINVVTGGDPDENRGDGSFLSHSERYEVTDEFLKIWRRVLQGEAV-----DFEG
MSUD_PSEAE            LSGGRLLINVVTGGDPDENRGDGIHLGHAERYEVTDEFLRVWRRVLQGEAV-----DFHG
A0A0H2ZBA9_PSEAB      LSGGRLLINVVTGGDPDENRGDGIHLGHAERYEVTDEFLRVWRRVLQGEAV-----DFHG
A6V5D1_PSEA7          LSAGRLLINVVTGGDPDENRGDGIHLGHAERYEVTDEFLRVWRRVLQGEAV-----DFHG
SSUD_SORC5            LSDGRLLVNVVTGGDPAESEGDGVFLKHDDRYVVTDEFLGIWRRVMAGETV-----DFTG
C5AZ36_METEA          ISDGRLLINVVTGGDPVELKGDGVFLDHDERYVVTDEFLHIWRGLMAGETV-----NFEG
A9W7M5_METEP          ISDGRLLINVVTGGDPVELKGDGVFLDHDERYVVTDEFLHIWRGLMAGETV-----NFEG
SSUD_METC4            ISDGRLLINVVTGGDPVELKGDGVFLDHDERYVVTDEFLHIWRGLMAGETV-----NFEG
C7CDS9_METED          ISDGRLLINVVTGGDPVELKGDGVFLDHDERYVVTDEFLHIWRGLMAGETV-----NFEG
B1ZLP7_METPB          ISDGRLLINVVTGGDPVELKGDGVFLDHDERYVVTDEFLHIWRGLMAGETV-----NFEG
B8ILH7_METNO          ISDGRLLINVVTGGDPVELRGDGVFLGHDERYAVTDEFLHIWRGLMAGESV-----TFQG
B0UGA6_METS4          ISEGRLLINVVTGGDPVELRGDGVFLDHDARYAVTDEFLHIWRRLMAGETV-----TYAG
B1M3N9_METRJ          ISDGRLLINVVTGGDPVELAGDGVFLSHDARYAVTDEFLTIWRGLLAGETV-----TFQG
Q0BVJ8_GRABC          LSGGRLLINVVAGGDPKELQGDGVFLDHSERYEATAEYLQVWRALLEGKTV-----DFEG
A8IC39_AZOC5          ISDGRVLINVVTGGDPVENRGDGFFLDHAERYEVTDEFLSIYTRLLKGEDV-----TFTG
A7IEL9_XANP2          ISNGRALINVVTGGDPEENKGDGFFADHAERYEITREFLDIYTRLLKGEEV-----TFAG
B2IFA8_BEII9          LSEGRLLINVVTGGDPLENKGDGVFLSHDERYAETDEFLQVYSRLLAGEEV-----DFNG
SSUD_RHOPA            LIGGRLLVNVVTGGDPVENKGDGVFLSHDERYEVTREFLNVYSDLLSGKTV-----NVAG
SSUD_RHOPT            VIGGRLLVNVVTGGDPVENKGDGVFLSHDERYEVTREFLNVYSDLLSGKTV-----NVAG
Q07LQ6_RHOP5          VTNGRLLVNVVTGGDPVENKGDGIFLDHNERYVVTREFLTIYSDLLAGKAV-----NFQG
A5ED25_BRASB          VSNGRLLVNVVTGGDPVENKGDGIFLSHEERYEVTREFLTVYNALLEGEAV-----NFSG
A4Z097_BRASO          VSNGRLLVNVVTGGDPVENKGDGIFLSHEERYEVTREFLTVYNKLLEGEAV-----NFAG
SSUD_BRADU            ITNGRLLINVVTGGDPVENKGDGIFLGHDERYEVTREFLNVYSDLLGGKAV-----NVEG
Q3SUU3_NITWN          VSNGRLLINVVTGGDPVENKGDGVYLDHDERYVVTREFLNVYRSLLAGESV-----NVDG
D3P029_AZOS1          LSDGRLLINVVTGGDPVENKGDGIFLSHGERYEVTREFLDVWKGLFGNEPV-----DYQG
B8EQZ6_METSB          ISEGRLLINVVTGGDPAENAGDGIFLNHDERYEVTREFLTVYRALLAGERV-----NFSG
D7A632_STAND          ISDGRLLINIVTGGDPVENAGDGIFLNHDERYEVTDEFLTVYRRLLAGERV-----TYFG
SSUD1_RHILO           ISNGRLLINVVTGGDPLENKGDGIFLSHAERYEVTQEFLRIYKRVLSGETV-----EHQG
C7JHV8_ACEP3          FSNGRLLINIVTGGDPAENAGDGLFADHATRYEITDEFLDIYRALLRGENV-----NFEG
D4I2P7_ERWAC          LSEGRLLINVVTGGDPVENKGDGIFLNHAERYQVTQEFLEVYSRLLKGEKV-----DFHG
E5B5C2_ERWAM          LSEGRLLINVVTGGDPVENKGDGIFLNHAERYQVTQEFLEVYSRLLKGEKV-----DFHG
D4GGW4_PANAM          LSEGRLLINVVTGGDPVENKGDGIFLSHAERYQVTREFLDVYSRLLKGEKV-----DYHG
B5XUZ3_KLEP3          LSEGRLLINVVTGGDPVENKGDGIFLSHSERYQVTREFLDVYTRLLRGEKV-----DYHG
A6TD77_KLEP7          LSEGRLLINVVTGGDPVENKGDGIFLSHSERYQVTREFLDIYTRLLRGEKV-----DYHG
Q1AV42_RUBXD          LSGGRVLINVVTGGDPVENRGDGIFLDHGERYEATREFLEVYRRLLAGETV-----DFSG
SSUD_BACVZ            LSDGRLLVNVVAGGDPYELAGDGMFISHDERYKATEEFLTVWRGLMRGETV-----TYEG
SSUD_BACSU            ISDGRLLINVVAGGDPYELAGDGLFISHDERYEATDEFLTVWRRLLQGETV-----SYEG
SSUD_BACLD            LAEGRLLINVVAGGDPYELAGDGLFISHDERYEATNEFLDIWRSLLKGETV-----SYSG
D5DLP6_BACMD          ISNGRLLVNVVAGGDPAELAGDGLFLSHDERYEAADEFLDVWKGLLAGDTV-----NYEG
D5DTN9_BACMQ          ISNGRLLVNVVAGGDPAELAGDGLFLSHDERYEAADEFLDVWKGLLAGDTV-----NYEG
C3GK80_BACTU          ISDGRLLINVVAGGDPVELQGDGLYLEHDERYEAADEFLKVWKSTLQGETI-----SLEG
A0A6L7HK57_BACAN      ISDGRLLINVVAGGDPVELQGDGLYLEHDERYEAADEFLKVWKSTLQGETI-----SLEG
A0RFA1_BACAH          ISDGRLLINVVAGGDPVELQGDGLYLGHDERYEAADEFLKIWKSTLQGEAI-----SLEG
Q63A41_BACCZ          ISDGRLLINVVAGGDPVELQGDGLYLEHDERYEAADEFLKVWKSTLQGETI-----SLEG
Q6HHJ0_BACHK          ISDGRLLINVVAGGDPVELQGDGLYLEHDERYEAADEFLKVWKSTLQGETI-----SLEG
Q736E3_BACC1          ISDGRLLINVVAGGDPVELQGDGLYLEHDERYEAADEFLKVWKSTLQGETI-----SLEG
B7JSS0_BACC0          ISDGRLLINVVAGGDPVELQGDGLYLEHDERYEAADEFLKVWKSTLQGETI-----SLEG
D8H1E6_BACAI          ISDGRLLINVVAGGDPVELQGDGLYLEHDERYEAADEFLKVWKSTLQGETI-----SLEG
B9J439_BACCQ          ISDGRLLINVVAGGDPVELQGDGLYLEHDERYEAADEFLKVWKSTLQGETF-----SLEG
B7HUM3_BACC7          ISDGRLLINVVAGGDPVELQGDGLYLEHDERYEAADEFLKVWKSTLQGETF-----SLEG
B7H609_BACC4          ISDGRLLINVVAGGDPVELQGDGLYLDHDERYEAADEFLKVWKSTLQGKTI-----SLEG
Q81C71_BACCR          ISDGRLLINVVAGGDPVELQGDGLYLNHDERYEAADEFLKVWKSTLQGETI-----SLEG
B7IKQ8_BACC2          ISDGRLLINVVAGGDPVELQGDGLYLEHDERYEAADEFLKVWKSTLQGETI-----SLEG
A7GQ63_BACCN          ISDGRLLINVVAGGDPVELQGDGLFLDHDARYDATDEFLKVWKSVLQGEQV-----SLEG
C5D5P5_GEOSW          ISEGRLLINVVAGGDPVELAGDGLFLSHDERYEATDEFLTVWRRLLSGEEV-----TLKG
A4IRJ7_GEOTN          ISDGRLLINVVAGGDPVELAGDGLFLSHDERYEATDEFLTVWRRLLAGEEV-----TLSG
D5DB81_BACMD          FSKGRLLINVVAGGDPVELEGDGVFLNHHDRYELTDEFLTIWRRVLNESDV-----HFDG
D5E199_BACMQ          FSKGRLLINVVAGGDPVELEGDGVFLNHHDRYELTDEFLTIWRRVLNESDV-----HFDG
C8WUN5_ALIAD          LSEGRLAVNIVTGGDPVENRGDGLFLDHDARYEVTDEFLTVWRSVMRGEHM-----DFAG
Q5WKG6_BACSK          LSHGRLLLNVVTGGDPLELGGDGIYLNHEERYQLTFEFLEAWRSIVTGNPT-----TFAG
Q3M323_TRIV2          ISGGRLLINVVTGGDPVELAGDGLHLTHDDRYRLTDEFLAVWREIAAGETA-----NFQG
B0JKK3_MICAN          LSEGRLLINVVTGGDPVELAGDGVHLNHDDRYRLTDEFLTVWRQLLSKPNT-----DFQG
B2JAA3_NOSP7          ISKGRLLINVVTGGDPVQLAGDGLHLNHDDRYDLTDEFLTVWRGIVSGETV-----DFKG
A9B1Y4_HERA2          ISNGRLLINVVAGGDSAEVASDGLHLDHDQRYALTDEFLDVWRRVLAGEHV-----TLEG
A6SWR5_JANMA          FSDGRLLLNVVTGGDPVELAGDGLHLSHSERYVQTDEFLTVFRRLFTEASV-----THKG
A0A0K1JRS4_9BACL      LSSGRLLINVVTGGDPAEMKGDGIFLSHGERYEATDEFLTVWKRLMRGETV-----TFHG
D1CHA3_THET1          VSGGRLLINVVTGGNPQELAGDGLHLDHDERYEVTDEFLTVWRSIMSGNTV-----DFEG
D7DP41_METV0          ISGGRLLINVVAGGDPEEQQADGSFLQHDERYTETGEFLKVWKAVLQGETI-----SLDG
C6X755_METGS          ISGGRLLVNVVAGGDPAEQQADGSFLSHDERYAETAEFLQVWKSVLQGETI-----SLEG
                         .*  .*:* *.   :  .:*    *  **    :    :                 *

SSUD_ECO55            KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
SSUD_ECOSE            KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
SSUD_ECO24            KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
A0A5B7PH51_ECOLX      KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
C8ULF8_ECO1A          KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
SSUD_ECO8A            KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
SSUD_SHIFL            KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
D2ABI8_SHIF2          KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
SSUD_SHIF8            KHSHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
SSUD_ECOLU            KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDFYLTWGEPPELVKEKIEQVR
D3H0G4_ECO44          KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDFYLTWGEPPELVKEKIEQVR
SSUD_ECO27            KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEHVR
SSUD_ECOL5            KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
SSUD_ECOBW            KHIHVRGAKLLFPAIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
A0A070SVD4_ECOLX      KHIHVRGAKLLFPAIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
SSUD_ECODH            KHIHVRGAKLLFPAIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
SSUD_ECOHS            KHIHVRGAKLLFPAIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
SSUD_ECOLC            KHIHVRGAKLLFPAIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
SSUD_ECOLI            KHIHVRGAKLLFPAIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
SSUD_ECO57            KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
SSUD_ECO5E            KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
D3QPD2_ECOCB          KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
SSUD_ECO45            KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEHVR
SSUD_ECOK1            KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEHVR
SSUD_ECOUT            KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEHVR
A0A0E2L880_ECOU3      KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEHVR
SSUD_ECOL6            KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEHVR
SSUD_ECO81            KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
W8ZQD3_ECOLX          KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPKLVKEKIEHVR
SSUD_ECOSM            KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
SSUD_ECO7I            KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVR
SSUD_ESCF3            KHIHVRGAKLLFPPIQQPYPPLYFGGSSDVAQDLAAEQVDLYLTWGEPPELVKEKIAHVR
SSUD_CITK8            KHIHVRGAKLFFPAIQQPYPPLYFGGSSDVAQDLAAEQVDLYLTWGEPPAQVKEKIEQVR
D2TS72_CITRI          KHIHVNGAKLFFPPVQQPHPPLYFGGSSDVAQDLAAEQVDLYLTWGEPPEQVKEKIAQVR
SSUD_ENT38            KHIRVRDAKLYFPPVQQPRPPLYFGGSSDVAQDLAAEQVDLYLTWGEPPEQVKEKIEQVR
A0A0H3CK28_ENTCC      KHIHVRDAKLYFPPVQQPRPPLYFGGSSDVAQDLAAEQVDLYLTWGEPPELVKEKIAQVQ
A0A1F2LQS7_9ENTR      KHQRVRDAKLLFPPLQQPRPPLYFGGSSDVAQDLAAEQVDLYLTWGEPPKQVAEKIAQVR
B5XY62_KLEP3          KHQRVRDAKLLFPPLQQPRPPLYFGGSSDVAQDLAAEQVDLYLTWGEPPKQVAEKIAQVR
A6T736_KLEP7          KHQRVRDAKLLFPPLQQPRPPLYFGGSSEVAQELAAEQVDLYLTWGEPPAQVAEKIAQVR
SSUD_CROS8            KHIKVRGAQLLFPPVQQPRPPLYFGGSSDVAQDLAAEQVDLYLTWGEPPEQVKEKIAQVR
C9Y0N2_CROTZ          KHIKVRGAQLLFPPVQQPRPPLYFGGSSDVAQDLAAEQVDLYLTWGEPPEQVKEKITQVR
SSUD_ERWT9            KHVHVRGARLLFKPVQQPRPPLWFGGSSEVAQDLAAEQVDVYLTWGEPPAQVKEKIERVQ
D4I0B4_ERWAC          KYVHVRGARLMFKPVQQPRPPLWFGGSSEVAQDLAAEQVDVYLTWGEPPAQVKEKIDRVQ
SSUD_PECCP            KHIQVKDAKLLYPPVQQPRPPLYFGGSSEAAQNLAAEQVDLYLTWGEPPEQVKEKLAEVR
A0A0H3I306_PECPM      KHIQVKDAKLLYPPVQQPRPPLYFGGSSEAAQNLAAEQVDLYLTWGEPPEQVKEKLAEVR
SSUD_PECAS            KHIQVKDAKLLYPPVQQPRPPLYFGGSSEAAQDLAAEQVDLYLTWGEPPEQVKEKLAEVR
SSUD_YERPB            KHIQVKGAKLLFPPVQHPRPPLYFGGSSAAAQDLAAEQVELYLTWGETPEQVKEKIEEVR
SSUD_YERPS            KHIQVKGAKLLFPPVQHPRPPLYFGGSSAAAQDLAAEQVELYLTWGETPEQVKEKIEEVR
SSUD_YERPY            KHIQVKGAKLLFPPVQHPRPPLYFGGSSAAAQDLAAEQVELYLTWGETPEQVKEKIEEVR
SSUD_YERP3            KHIQVKGAKLLFPPVQHPRPPLYFGGSSAAAQDLAAEQVELYLTWGETPEQVKEKVEEVR
SSUD_YERPA            KHIQVKGAKLLFPPVQHPRPPLYFGGSSAAAQDLAAEQVELYLTWGEPPEQVKEKIEEVR
SSUD_YERPE            KHIQVKGAKLLFPPVQHPRPPLYFGGSSAAAQDLAAEQVELYLTWGEPPEQVKEKIEEVR
SSUD_YERPN            KHIQVKGAKLLFPPVQHPRPPLYFGGSSAAAQDLAAEQVELYLTWGEPPEQVKEKIEEVR
SSUD_YERPP            KHIQVKGAKLLFPPVQHPRPPLYFGGSSAAAQDLAAEQVELYLTWGEPPEQVKEKIEEVR
SSUD_SERP5            KHIQVKGAKLLYPPVQQPRPPLYFGGSSAAAQDLAADQVEMYLTWGEPPAQVKEKIAEVR
D2BXP8_DICZ5          KHIQVKGAKLHYPPVQQPRPPLYFGGSSDAALDLAAEQVELYLTWGEPPAQVKEKIERVR
C6CFJ9_DICC1          KHIQVKGAKLHYPPVQQPRPPLYFGGSSDAALDLAAEQVELYLTWGEPPAQVKEKLDRVR
C6C3U5_DICP7          KHIQVKGARLHYPPVQQPHPPLYFGGSSDAALDLAAEQVDLYLTWGEPPAQVKEKLDRVR
SSUD_PSEPK            KHIQVKGAKLLYPPIQQPRPPLYFGGSSEAAQDLAAEQVELYLTWGEPPAAVAEKIAQVR
SSUD_PSEP1            KHIQVKGAKLLYPPIQQPRPSLYFGGSSEAAQDLAAEQVELYLTWGEPPAAVAEKIAQVR
SSUD_PSEPG            KHIQVKGAKLLYPPIQQPRPPLYFGGSSEAAQDLAAEQVELYLTWGEPPSAVAEKIAQVR
SSUD_PSEPW            KHIQVKGAKLLYPPIQQPRPPLYFGGSSEAAQDLAAEQVELYLTWGEPPAAVAEKIAQVR
SSUD_PSEE4            KHLQVKGAKLLYPPIQQPRPPLYFGGSSDAAQDLAAEQVELYLTWGEPPAAVAEKIAQVR
SSUD_PSEAE            KHIQVKGAKLLYPPLQQPRPPLYFGGSSEAAQDLAAEQVELYLTWGEPPAAVAEKIAQVR
A6V1Y2_PSEA7          KHIQVKGAKLLYPPLQQPRPPLYFGGSSEAAQDLAAEQVELYLTWGEPPAAVAEKIAQVR
SSUD_PSEMY            KHIQVKGAKLLYPPIQQPRPPLYFGGSSDAAQDLAAEQVELYLTWGEPPAAVAEKIAQVR
Q3K504_PSEPF          EHISVKGAKLLYPPIQQPRPPLYFGGSSEAAQDLAAEQVEMVLTWGEPPAAVAEKIEQVR
C3K3U8_PSEFS          EHISVKGAKLLYPPIQQPRPPLYFGGSSEAAQDLAAEQVEMVLTWGEPPAAVAEKIAQVR
Q4K439_PSEF5          QHISVKGAKLLYPPLQQPRPPLYFGGSSEAAQDLAAEQVEMVLTWGEPPAAVAEKIQQVR
SSUD_AZOVD            KHIQVEGARLLFPPLQQPHPPLYFGGSSEAAHELAAEQVDLYLTWGEPPAAVAEKIADVR
Q21XJ7_RHOFT          KHIKVKKAKQLFPPVQQPYPPLYFGGSSDAAHDLAAEEVELYLTWGEPPAEVEKKFDDVR
SSUD_AGRFC            KYIKAQGARLGLPPVQEPRPPLYFGGSSDAGIEFSAGITDKYLTWGEPPAQVAEKIVKVR
SSUD_RHIE6            KYIKAIDARLGLPPVQEPRPPLYFGGSSDAAIAFSGGITDKYLTWGEPPAQVAEKIAKVR
C3MH35_SINFN          KYIKAHDAQLGFPPVQEPRPPLYFGGSSDAAIEFSTGVVDKYLTWGETPAQVAEKIATVR
C6B0T4_RHILS          KYIKATNARLGFPSVQNPRPPLYFGGSSDAGIDFSVGRVDKYLTWGEPPAQVAEKVTKVR
Q1MFL6_RHIL3          KYIKATNARLGFPSVQNPRPPLYFGGSSDAGIDFSVGRVDKYLTWGEPPAQVAEKITKVR
B5ZSB3_RHILW          KYIKATNARLGFPSVQNPRPPLYFGGSSDAGIDFSVGRVDKYLTWGEPPAQVAEKVAKVR
Q2K7H6_RHIEC          KYIKATNARLGFPSVQNPRPPLYFGGSSDAGIDFSVGRVDKYLTWGEPPAQVAEKVAKVR
B9JG07_AGRRK          KYITATNARLGLPPVQSPRPPLYFGGSSDAGIDFSVGRVDKYLTWGEPPAQVAEKVEKVR
B9K142_AGRVS          KYIRAEGARLGFPPVQSPRPPLYFGGSSDAGIDFAARRVDKYLTWGEPPAQVKEKVDAVR
A8I8W6_AZOC5          RYYRVENGRLDFPVVQE-HLPLYFGGSSDAGLDVAAEHVDLYLSWGEPPALLAEKIATAR
A7IKZ2_XANP2          KYYRVEHGRLDFPVVQQPHPPLWFGGSSEAGHEVAAEHTSVYLSWGEPPHILKDKLADVQ
SSUD2_RHILO           KYYRVENGRLDLLPSQE-RPPLYFGGSSDAGQDLAADLVDMYLTWGEPPALVAEKLASAR
C1DGL2_AZOVD          KHVTVEGAKNFFPPVQQPYPPLYFGGSSPAAHELAAKHVDAYLTWGEPPAAVAEKIADVR
A1VJQ2_POLNA          KHVNVKQARNFFPPVQQPAPPLYFGGSSPAAHELAAKHVDAYLTWGEPPAAVAEKIADVR
A9BUV1_DELAS          KYFKVKQGRNFFPPVQKPHPPLYFGGSSDAAHDLAARQVDAYLTWGEPPAAVAEKFADIR
D8IQ40_HERSS          KHFRIRNGQLFHPAVQQPYPPLYFGGSSPAAHDLAAKHVDAYLTWGEPPAAVRQKIDDVR
A5EEY6_BRASB          RHFRLEGARNFHDALQKPWPPLYFGGSSPAAHELAAKHVDAYLTWGEPVEAVAAKIADVR
SSUD_ACIAC            EHLSVKGAKLLYPPVQKPYPPVYFGGSSEAAHDLAAEQVDTYLTWGEPPAAVAQKVADVR
SSUD_DELAS            EHLSVKGAKLLFPPLQKPYPPVYFGGSSEAAHDLAAEQVDAYLTWGEPPAEVAKKIADVR
SSUD_POLNA            KHLSVKGAKLLYPPVQKPYPLVYFGGSSPAAHDLAAEQVDAYLTWGEPPAEVAKKIADVR
SSUD_VARPS            RHLSVKGAKLLYPPVQEPYPPVWFGGSSAAAHELAAEQVDAYLTWGEPPAEVARKIADVR
SSUD_RALPJ            KHLSVKGAKVLYPPVQRPHPPVYFGGSSEAAHELAAEQVDSYLTWGEPPAAVAEKIADVR
C6BH37_RALP1          KHLSVKGAKVLYPPVQRPHPPVYFGGSSEAAHELAAEQVDTYLTWGEPPAAVAEKLADVR
SSUD_RALSO            RHLSVKGARVLFPPVQRPHPPVYFGGSSEAAHALAAEQVDTYLTWGEPPAAVAEKIADVR
SSUD_CUPNH            KHLSVKGATVLYPPLQQPHPPVYFGGSSAPAHALAGEQVDTYLTWGEPPADVAQKLDDVR
SSUD_CUPTR            KHLSVKGATVLYPPLQRPHPPVYFGGSSAPAHALAGEQVDTYLTWGEPPAAVAQKLDDVR
SSUD_CUPMC            KHVTVKGARVLYPPIQRPHPPVYFGGSSEAAHDLAAEQVETYLTWGEPPADVAKKIADVR
SSUD_XANAC            KHLQVKAAKLLYPTVQRPYPPVWFGGSSDAAHDLAAEQVDTYLTWGEPPDAVAEKIASVR
A2SBY8_METPP          RHLQVKGAKLLYPPIAKPYPPLFFGGSSEAAHELAAEQFDTYLTWGEPPAAVAEKVADIR
SSUD_PARPJ            KHLSSKGGKALYPPVQNPHPPLWFGGSSPAAHEMAGEHIDTYLTWGEPPAAVAKKIADIR
D5W7K4_BURSC          KHLQSKGGKALYPPVQNPHPPLWFGGSSAAAHDIAAEHIDTYLTWGEPPEAVAKKIADIR
SSUD_PARP8            RHLKSKGGKLLYPPVQSPHPPLWFGGSSPAAHEMAGEHIDTYLTWGEPPEAVAEKIADIR
Q63TV9_BURPS          EHLSAKGGKLLYPPVQRPHPPLWFGGSSPAAHAIAADHIDTYLSWGEPPAAVEKKIADIR
A3NUT1_BURP0          EHLSAKGGKLLYPPVQRPHPPLWFGGSSPAAHAIAADHIDTYLSWGEPPAAVEKKIADIR
A2S363_BURM9          EHLSAKGGKLLYPPVQRPHPPLWFGGSSPAAHAIAADHIDTYLSWGEPPAAVEKKIADIR
SSUD_BURP1            EHLSAKGGKLLYPPVQRPHPPLWFGGSSPAAHAIAADHIDTYLSWGEPPAAVEKKIADIR
A3N936_BURP6          EHLSAKGGKLLYPPVQRPHPPLWFGGSSPAAHAIAADHIDTYLSWGEPPAAVEKKIADIR
A0A0H2XNI1_BURCA      KHLQSKGGKALYPPVQHPHPPLWFGGSSPAAHAIAADHIDTYLTWGEPPEAVAKKIADIR
B1K0T2_BURCC          KHLQSKGGKALYPPVQHPHPPLWFGGSSPAAHAIAADHIDTYLTWGEPPEAVAKKIADIR
B4E8P2_BURCJ          KHLQSKGGKALYPPVQHPHPPLWFGGSSPAAHAIAADHIDTYLTWGEPPEAVAKKIADIR
Q39GW7_BURL3          KHLQSKGGKALYPPVQRPHPPLWFGGSSPAAHEIAADHIDTYLTWGEPPAAVAKKIADIR
Q0BFQ2_BURCM          KHLQSKGGKALYPPVQRPHPPLWFGGSSPAAHTIAADHIDTYLTWGEPPEAVAKKIADIR
B1YPJ4_BURA4          KHLQSKGGKALYPPVQRPHPPLWFGGSSPAAHTIAADHIDTYLTWGEPPEAVAKKIADIR
A4JE30_BURVG          KHLQSKGGKALYPPVQRPHPPLWFGGSSPAAHAIAADHIDTYLTWGEPPEAVAKKIADIR
A0A0H3KF22_BURM1      KHLRSKGGKALYPPVQRPHPPLWFGGSSPAAHAIAADHIDTYLTWGEPPEAVAKKIADIR
C5AGU6_BURGB          RHLQSKGGKLLYPPVQHPHPPLWFGGSSPAAHAIAADHIDTYLTWGEPPEAVARKIADIR
A9IMS5_BORPD          QKLASRGGKVIFPPAQLPYPPLYFGGSSEPAHELAAEQLDVYLTWGEPPAAVAAKLADLR
A6SVY3_JANMA          KHIQVKGAKTLYPPVQQPYPPLYFGGSSPAAHELAAEQVDVYLTWGEPPAAVAEKIADMR
D8IQQ1_HERSS          KHLSVKGAKALYPPVQQPYPPLYFGGSSDEAIDLAAEQVDVYLTWGEPPAAVAEKIARVR
B0V5V9_ACIBY          ERLQVDDAKLLYPPVQKPYPPLWFGGSSDVAVELAAEQVDTYLTWGEPPAAVKEKIEHVR
A0A0J1A8C8_ACIBA      ERLQVDDAKLLYPPVQKPYPPLWFGGSSDVAVELAAEQVDTYLTWGEPPAAVKEKIEHVR
B0VMM8_ACIBS          ERLQVDDAKLLYPPVQKPYPPLWFGGSSDVAVELAAEQVDTYLTWGEPPAAVKEKIEHVR
D8JJB2_ACISD          ERLQVDDAKLLYPPVQKPYPPLWFGGSSDVAVDLAAEQVDTYLTWGEPPEAVKQKVEHVR
Q6FFY9_ACIAD          DRLSVDDAKLLYPPVQQPYPPLWFGGSSDAASELAAEQVDTYLTWGEPPAAVKEKIEAMR
SSUD_PSE14            KHLRVQNAKALYPPIQKPYPPLYFGGSSDAAHDLAADQVDVYLTWGEPPAAVAQKLADVR
SSUD_PSESM            KHLRVQNAKALYPPIQKPYPPLYFGGSSDAAHDLAADQVDVYLTWGEPPAAVAQKLADVR
SSUD_PSEU2            KHLRVQNAKALYPPIQQPYPPLYFGGSSDAAHDLAADQVDVYLTWGEPPAAVAQKLADVR
Q4K935_PSEF5          KHLHVQNAKALYPPVQKPYPPLYFGGSSEAAHELAADQVDVYLTWGEPPAAVAQKLADVR
C3K524_PSEFS          KHLRVQNAKALYPPVQKPYPPLYFGGSSDAAHDLAAEQVDVYLTWGEPPAAVAEKLADVR
Q3K9A1_PSEPF          KHLKVQNAKALYPPVQKPYPPLYFGGSSDAAHDLAAEQVDVYLTWGEPPAAVAEKLADVR
MSUD_PSEAE            KHIHVENAKALYPPLQRPYPPLYFGGSSEAAHELAGEQVDVYLTWGEPLPAVAAKIADVR
A0A0H2ZBA9_PSEAB      KHIHVENAKALYPPLQRPYPPLYFGGSSEAAHELAGEQVDVYLTWGEPLPAVAAKIADVR
A6V5D1_PSEA7          KHIHVENAKALYPPLQRPYPPLYFGGSSEAAHELAGEQVDVYLTWGEPLPAVAAKIADVR
SSUD_SORC5            QHLRVKGAKILFPPLQAPHPPLYFGGSSPAAHGLAARHVDVYLTWGEPPAAVAEKIADVR
C5AZ36_METEA          KHLRSENGRVIFRPVQAPYPPLYFGGSSPAGIEVAAEHCEVYLTWGEPPAGVAEKIAKAR
A9W7M5_METEP          KHLRSENGRVIFRPVQAPYPPLYFGGSSPAGIEVAAEHCEVYLTWGEPPAGVAEKIAKAR
SSUD_METC4            KHLRSENGRVIFRPVQAPYPPLYFGGSSPAGIEVAAEHCEVYLTWGEPPAGVAEKIAKAR
C7CDS9_METED          KHLRSENGRVIFRPVQAPYPPLYFGGSSPAGIEVAAEHCEVYLTWGEPPAGVAEKIAKAR
B1ZLP7_METPB          KHLRTENGRVIFRPVQAPYPPLYFGGSSPAGIEVAAEHCEVYLTWGEPPAGVAEKIARAR
B8ILH7_METNO          RHLRAEDGRLIFRPVQDPYPPLYFGGSSDAGIEVAADHCDVYLTWGEPPAQVADKIARAR
B0UGA6_METS4          RHLRTEEGRLIFGPVQQPSPPLYFGGSSEAGIAVAAEHCEVYLTWGEPPAQVAEKIARAR
B1M3N9_METRJ          DHLRTENGRLIFPPVQKPYPPLYFGGSSAAGMAVAAEHCDVYLTWGEPPAQVAEKIAAAR
Q0BVJ8_GRABC          KHVRSKQGKLLYPPVQTPYPPLYFGGSSEAGQEVAAEQCDVYLTWGEPPGDVAEKIADMR
A8IC39_AZOC5          KHLKVEDGKLLYPPVQEPHPPLFFGGSSPAAHTVAAKHIQKYLTWGEPPAAVAGKIRDIK
A7IEL9_XANP2          KHLQVEGGKLLYPPVQQPHPPLFFGGSSAPAHEVAARQVQKYLTWGEPPALVAEKIRDLK
B2IFA8_BEII9          KYIQIEKGKLLYPPHQQPAPPLYFGGSSEIGQDIAARTVQKYLTWGEPPAQVASKIAGMR
SSUD_RHOPA            KHITIEDGRLLFPPVQSPRPPLYFGGSSDAGIDVAADTVDKYLTWGEPPAQVAEKVNRVR
SSUD_RHOPT            KHITIEDGRLLFPPVQSPRPPLYFGGSSDAGIDVAADTVDKYLTWGEPPAQVAEKVNRVR
Q07LQ6_RHOP5          KHITIEDGRLLFPPVQQPRPPLYFGGSSDAGIDVAADTVDKYLTWGEPPAQVAEKVARVR
A5ED25_BRASB          KHIKVEDGRLLFPPVQSPRPPLFFGGSSDAGIDVAVDTVEKYLTWGEPPADVAAKIAKVR
A4Z097_BRASO          KHITVEDGRLLFPPVQSPRPPLFFGGSSDAGIDVAVDTVEKYLTWGEPPADVAAKVAKVK
SSUD_BRADU            KHIRIEDGKLLFPPVQSPRPPLYFGGSSDAGIDVAVDTVDKYLTWGEPPAQVAEKIARVR
Q3SUU3_NITWN          RHIRIEDGRLLFQPVQQPYPPLYFGGSSDAGIDVAVDTVDKYLTWGEPPAQVADKVNRVR
D3P029_AZOS1          KHIRIEDGRLFYPPVQAGGPPLFFGGSSDAANAVAATYVDKYLTWGEPPAQVAAKLADVR
B8EQZ6_METSB          KHIKLEDGHLLFTPRQAP-PPLFFGGSSPAANDVAAEHVDKYLTWGEPPEAVAAKLKEVR
D7A632_STAND          KHIKVDDAHLLFPPVQAEGPALYFGGSSEAANKVAAEHVDKYLTWGEPPAAVAAKIKQVR
SSUD1_RHILO           KHLHIEDGRLLFPPVQTPYPPLYFGGSSDAGSTVAAQEIDKYLTWGEPPADVERKLDAVR
C7JHV8_ACEP3          KHFTIKDGRLLFPAYQHEGPPLYFGGSSEAATHVAAKSIDKYLTWGEPPAQVAEKISHVR
D4I2P7_ERWAC          RHIRVEGAEILFPPVQENGPPLYFGGSSPEATDVAANQIDTWLTWGEPPDRVAEKIALVR
E5B5C2_ERWAM          RHIRVEGAEILFPPVQENGPPLYFGGSSPEATDVAANQIDTWLTWGEPPDRVAEKIALVR
D4GGW4_PANAM          EHIHVEGAEILFPPVQAEGPPLYFGGSSDEAVDVAARQVDTYLTWGEPLAQVAAKLEGVR
B5XUZ3_KLEP3          EHIHVEGAEVLFPPVQENGPPLYFGGSSEAAIDVAAEQIDSYLTWGEPPELVAEKLAVVR
A6TD77_KLEP7          EHIHVEGAEVLFPPVQENGPPLYFGGSSDAAIDVAAEQIDSYLTWGEPPELVAEKLAVVR
Q1AV42_RUBXD          RHIRVEGARLLFPPVQEGGPPLWFGGSSEAAIGVAASTIDKYLTWGEPPAQVAEKVERVR
SSUD_BACVZ            DHIKVENSNLLFPPKQSPHPPLYFGGSSQAGIEAAAKHTDVYLTWGEPPEQVKEKIETVK
SSUD_BACSU            KHIKVENSNLLFPPQQEPHPPIYFGGSSQAGIEAAAKHTDVYLTWGEPPEQVKEKIERVK
SSUD_BACLD            KHLKTENGRLLFPPAQQPHPPIYFGGSSKAGQETAAKHADVYLTWGEPPHLVKEKIQSVK
D5DLP6_BACMD          KHIHVENSELLYPPVQKPSPPIYFGGSSPAGQKVAAKHSDVYLTWGEPPEQVREKITAVR
D5DTN9_BACMQ          KHIHVENSELLYPPVQKPSPPIYFGGSSPAGQKVAAKHSDVYLTWGEPPEQVREKITAVR
C3GK80_BACTU          KHMKVTDSKVVFPPVQTPYPPIYFGGSSDAGKEVAAEHSDVYLTWGEPPEQVKEKIEEVR
A0A6L7HK57_BACAN      KHMKVTDSKVVFPPVQTPYPPIYFGGSSDAGKEVAAEHSDVYLTWGEPPEQVKEKIEEVR
A0RFA1_BACAH          KHMKVTDSKVVFPPVQTPYPPIYFGGSSAAGKEVAAEHSDVYLTWGEPPEQVKEKIEEVR
Q63A41_BACCZ          KHIKVTDSKVVFPPVQTPYPPIYFGGSSNAGKEVAAEHSDVYLTWGEPPEQVKEKIEEVR
Q6HHJ0_BACHK          KHIKVTDSKVVFPPVQTPYPPIYFGGSSDAGKEVAAEHSDVYLTWGEPPEQVKEKIEEVR
Q736E3_BACC1          KHIKVTDSKVVFPLVQTPYPPIYFGGSSTAGKEVAAEHSDVYLTWGEPPEQVKEKIEEVR
B7JSS0_BACC0          KHMKVTDSKVVFPPVQTPYPPIYFGGSSDAGKEVAAEHSDVYLTWGEPPEQVKGKIEEVR
D8H1E6_BACAI          KHIKVTDSKVVFPPVQTPYPPIYFGGSSDAGKEVAAEHSDVYLTWGEPPEQVKGKIEEVR
B9J439_BACCQ          KHIKVTESKVVFLPVQTPYPPIYFGGSSAAGKEVAAEHSDVYLTWGEPPEQVKEKIEEVR
B7HUM3_BACC7          KHIKVTESKVVFPPVQTPYPPIYFGGSSAAGKEVAAEHSDVYLTWGEPPEQVKEKIEEVR
B7H609_BACC4          KHIKVTDSKVVFPPVQTPYPPIYFGGSSAAGKEVAAEHSDVYLTWGEPPEQVKEKIEEVR
Q81C71_BACCR          KHIQVTDSKVVFPPVQTPYPPIYFGGSSAAGKEVAAEHSDVYLTWGEPPEQVKEKVEEVR
B7IKQ8_BACC2          KHIQVTDSKVVFPPVQTPYPPIYFGGSSAAGKEVAAEHSDVYLTWGEPPEQVKEKIEEVR
A7GQ63_BACCN          EYIQVKDSKVVFPPVQSPHPPIYFGGSSDAGKAVAAEHCDVYLTWGEQPAQVEQKIKEVK
C5D5P5_GEOSW          KHIHVNGAKLLFPPIQTPYPPIYFGGSSSAGQLVAAKHADVYLTWGEPPAQVEEKISQVR
A4IRJ7_GEOTN          KHVSVKGAKLLFPAVQKPYPPIFFGGSSDAGQRVAARHADVYLTWGEPPEQVKDKIERVR
D5DB81_BACMD          DYLSVKGGDVLYPPIQKPYPPLYFGGSSPVAMDVASRHIDVYLTWGEPPAQVKEKIERMK
D5E199_BACMQ          DYLSVKGGDVLYPPIQKPYPPLYFGGSSPVAMDVASRHIDVYLTWGEPPAQVKEKIERMK
C8WUN5_ALIAD          RHLRVEDAHILYPPIQRPYPPVYFGGSSEAGKRVAAKHVDVYLTWGEPPQDVAEKIQTVR
Q5WKG6_BACSK          KHVNIKEAKTNFPPVQTPYPPLYLGGSSIGAMEVTAKHIDVYLTWGETPAQVKEKIAKVK
Q3M323_TRIV2          DYLNIQDGKLLFPPVQKPHPPLWFGGSSPIAQEIAAKHVDVYLTWGEPPEQVAQKIASVR
B0JKK3_MICAN          DYLRIEGGKVLFPPVQKPHPPLWFGGSSPIAHEIAAKHVDVYLTWGEPPSAVAEKIITVR
B2JAA3_NOSP7          NYLDIKGGKLLFPPVQKPYPPLWFGGSSAAAKRVAAKHIDVYLTWGEPPQQVAQKIAEVK
A9B1Y4_HERA2          QHIHVTDGKLMLPPLQQPHPPLYFGGSSPAALEVAAKHVDVYLTWGEPPAQVAEKITQVR
A6SWR5_JANMA          PYFHLTDGELLQPSRQKPYPPLFLGGSSAAAHEITAKHIDVYLTWGEPPAQVEEKIADIR
A0A0K1JRS4_9BACL      KHIRVEGAKLQYVPFSRQSPPLFIGASSEAGHAVAAKHIDTYLTWAETPAMVAEKIADVR
D1CHA3_THET1          KHIKVKGGRLLFPPVQAPYPPLYFGGSSPVAQQVAAKHVDMYLSWGEPPEQLAEKISAVR
D7DP41_METV0          EYIRVKDARLPSGAHQKPYPPLFIGGSSDAAIDLTAEHIDVYLTWGEPPAAVAEKIERVR
C6X755_METGS          DYIRVKDASLPTGAFQKPYPPLFIGGSSQAAIDLTAEHIDVYLTWGEPPAAVAEKIAAVR
                             .             :::*.**  .   :    .  *:*.*    :  *.   :

SSUD_ECO55            AKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ECOSE            AKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ECO24            AKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
A0A5B7PH51_ECOLX      AKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
C8ULF8_ECO1A          AKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ECO8A            AKAAAHGHKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
SSUD_SHIFL            AKAAAYGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
D2ABI8_SHIF2          AKAAAYGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
SSUD_SHIF8            AKAAAYGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ECOLU            AKAAAHGRKIRFGIRLHVIVRETSDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
D3H0G4_ECO44          AKAAAHGRKIRFGIRLHVIVRETSDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ECO27            AKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ECOL5            AKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ECOBW            AKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
A0A070SVD4_ECOLX      AKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ECODH            AKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ECOHS            AKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ECOLC            AKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ECOLI            AKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ECO57            AKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ECO5E            AKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
D3QPD2_ECOCB          AKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ECO45            AKAAAHGRKIRFGVRLHVIVRETNDEAWQAAERLISRLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ECOK1            AKAAAHGRKIRFGVRLHVIVRETNDEAWQAAERLISRLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ECOUT            AKAAAHGRKIRFGVRLHVIVRETNDEAWQAAERLISRLDDETIAKAQAAFA-RTDSVGQQ
A0A0E2L880_ECOU3      AKAAAHGRKIRFGVRLHVIVRETNDEAWQAAERLISRLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ECOL6            AKAAAHGRKIRFGVRLHVIVRETNDEAWQAAERLISRLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ECO81            AKAAAHGRKIRFGVRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
W8ZQD3_ECOLX          AKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQASFA-RTDSVGQQ
SSUD_ECOSM            AKAAAHGRKIRFGIRLHVIVRETNGEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ECO7I            AKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
SSUD_ESCF3            AKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFA-RTDSVGQQ
SSUD_CITK8            AKAAARGRKIRFGIRLHVIVRETNEEAWRAADRLIAHLDDDTIAKAQAAFA-RTDSVGQH
D2TS72_CITRI          AKAAARGRTIRFGIRLHVIVRETNDEAWRAADRLIAHLDDDTIAKAQAAFA-RTDSVGQQ
SSUD_ENT38            AKAAAHGRKVRFGIRLHVIVRETNQEAWQAADRLISHLDDDTIAKAQAALA-KTDSVGQH
A0A0H3CK28_ENTCC      AKAAAHGRKVRFGIRLHVIVRETNEEAWQAADRLISHLDDETIAKAQAAFA-KTDSVGQH
A0A1F2LQS7_9ENTR      EKAARHGRRVRFGIRLHVIVRETNEEAWQAADSLISHLDDETIARAQAAFA-RTDSVGQQ
B5XY62_KLEP3          EKAARHGRRVRFGIRLHVIVRETNEEAWQAADSLISHLDDETIARAQAAFA-RTDSVGQK
A6T736_KLEP7          EKAARHGRQVRFGIRLHVIVRETNEEAWQAADSLISHLDDETIARAQAAFA-RTDSVGQQ
SSUD_CROS8            AKAAAHGRTVRFGIRLHVIVRETTEEAWQAADRLIAHLDDETIAKAQAAFA-RQDSVGQQ
C9Y0N2_CROTZ          AKAAAHGRTVRFGIRLHVIVRETSEEAWQAADRLIAHLDDDTIAKAQAAFA-RQDSVGQQ
SSUD_ERWT9            AKAAAQGRKVRFGIRLHVIVRETNEEAWQAADRLISHLDDETIAKAQEALA-RTDSVGQQ
D4I0B4_ERWAC          AKAAAQGRKVRFGIRLHVIVRETNEEAWQAADHLISHLDDETIAHAQSALA-RTDSVGQQ
SSUD_PECCP            DKAAAQGREVRFGIRLHVIVRETTEEAWQAADRLISHLDEKTIADAQAALA-RFDSVGQQ
A0A0H3I306_PECPM      AKAAAQGREVRFGIRLHVIVRETTEEAWQAAERLISHLDEKTIADAQAALA-RFDSVGQQ
SSUD_PECAS            AKAAAQGREVRFGIRLHVIVRETTEEAWQAAERLISHLDEKTIADAQAALA-RFDSVGQQ
SSUD_YERPB            AKAAAKGRTVRFGIRLHVIVRETTEEAWRAANRLIANLDDKTIADAQQAFA-RFDSVGQQ
SSUD_YERPS            AKAAAKGRTVRFGIRLHVIVRETTEEAWRAANRLIANLDDKTIADAQQAFA-RFDSVGQQ
SSUD_YERPY            AKAAAKGRTVRFGIRLHVIVRETTEEAWRAANRLIANLDDKTIADAQQAFA-RFDSVGQQ
SSUD_YERP3            AKAAAKGRTVRFGIRLHVIVRETTEEAWRAANRLIANLDDKTIADAQQAFA-RFDSVGQQ
SSUD_YERPA            AKAAAKGRTVRFGIRLHVIVRETTEEAWRAANRLIANLDDKTIADAQQAFA-GFDSVGQQ
SSUD_YERPE            AKAAAKGRTVRFGIRLHVIVRETTEEAWRAANRLIANLDDKTIADAQQAFA-GFDSVGQQ
SSUD_YERPN            AKAAAKGRTVRFGIRLHVIVRETTEEAWRAANRLIANLDDKTIADAQQAFA-GFDSVGQQ
SSUD_YERPP            AKAAAKGRTVRFGIRLHVIVRETTEEAWRAANRLIANLDDKTIADAQQAFA-GFDSVGQQ
SSUD_SERP5            AKAAAKGRQVRFGIRLHVIVRETTEEAWRAADRLIANLDEKTIADAQQAFA-RFDSVGQQ
D2BXP8_DICZ5          AKAAAQGRSVRFGIRLHVIVRETNEEAWQAANRLISRLDDDTIAEAQASLK-RFDSVGQQ
C6CFJ9_DICC1          AKAAAQGRSVRFGIRLHVIVRETNEEAWQAANRLISKLDDETIAEAQASLK-RFDSVGQQ
C6C3U5_DICP7          AKAAAQGRSVRFGIRLHVIVRETSQEAWQAAERLISRLDDDTIAQAQASLK-RFDSVGQQ
SSUD_PSEPK            EKAAAQGREVRFGIRLHVIVRETNEEAWAAAERLISHLDDDTISRAQASLA-RFDSVGQQ
SSUD_PSEP1            EKAAAQGREVRFGIRLHVIVRETNEEAWAAAERLISHLDDDTISRAQASLA-RFDSVGQQ
SSUD_PSEPG            EKAAAQGREVRFGIRLHVIVRETNEEAWAAADRLISHLDDDTISRAQASLA-RFDSVGQQ
SSUD_PSEPW            EKAAAQGREVRFGIRLHVIVRETNDEAWAAADRLISHLDDDTIARAQASLA-RFDSVGQQ
SSUD_PSEE4            EKAAAQGREVRFGIRLHVIVRETNEEAWAAADKLISHLDDDTIARAQASLA-RFDSVGQQ
SSUD_PSEAE            EKAARQGRQVRFGIRLHVIVRETSEEAWQAADRLIAHLDDDTIARAQASLA-RFDSVGQQ
A6V1Y2_PSEA7          EKAARQGRQVRFGIRLHVIVRETSEEAWQAADRLIAHLDDDTIARAQASLA-RFDSVGQQ
SSUD_PSEMY            EKAARQGREVRFGIRLHVIVRETNEEAWAAADRLISHLDQDTIDRAQASLA-RFDSVGQQ
Q3K504_PSEPF          AKAAKLGRTVRFGIRLHVIVRETNAEAWQAADRLISHLDDDTIKRAQASLA-RFDSVGQQ
C3K3U8_PSEFS          AKAAKLGRTVRFGIRLHVIVRETNDEAWKAADKLISHLDDDTIARAQASLA-RFDSVGQQ
Q4K439_PSEF5          DKAAKLGRTVRFGIRLHVIVRETNAEAWQAAERLISHLDDDTIARAQASLA-RFDSVGQQ
SSUD_AZOVD            ARAARHGRTVRFGIRLHVIVRETTEEAWEAADRLIGHLDDETIAKAQASLA-RFDSVGQQ
Q21XJ7_RHOFT          KRAAKLGRKVKFGVRLHVIPRDTNDQAWAAADDLIKYLDEETIAKAQNNLS-GMDSEGQR
SSUD_AGRFC            AAAAKNGREVTFGIRLHFIVRETDEEAWADADRLISKLSDETIASAQEVFSKASDSVGQA
SSUD_RHIE6            KAAAAQGKHVTFGIRLHFIVRETDEEAWAAADRLISKLSDETIAAAQEVFAKSSDSVGQA
C3MH35_SINFN          KAAADKGRQVTFGIRLHFIVRETEEEAWAAADRLISKLSDETVAAAQQGFAKNSDSVGQA
C6B0T4_RHILS          KAASERGREVSFGIRLHFIVRETDDEAWEAAERLIRHLDDDTIREAQERFVHESDSVGQK
Q1MFL6_RHIL3          KAAGERSREVSFGIRLHFIVRETDEEAWEAAERLIRHLDDDTIREAQERFVHESDSVGQK
B5ZSB3_RHILW          KAAAERGREVSFGIRLHFIVRETDEEAWEAAERLIRHLDDDTIREAQERFVHESDSVGQK
Q2K7H6_RHIEC          KAAAERGREVTFGIRLHFIVRETDEEAWEAAERLIRHLDDDTIREAQERFVHESDSVGQK
B9JG07_AGRRK          AAAAKKGREVSFGIRLHFIVRETDEEAWAAADRLISKLDDETIREAQEQFVNQSDSVGQK
B9K142_AGRVS          AAAARSGRDVSFGIRLHFIVRETDEEAWAAADKLISKLSDETIRETQARFAKESDSVGQR
A8I8W6_AZOC5          ARAAARGRTLRFGIRLHFIVRETESEAWTAAERLISQVSDAQIANAQKRFKEEMDSVGQA
A7IKZ2_XANP2          ARAARRGRKLKFGLRIHFIVRETGAEAWAAADRLISQVSDEQIESAQKRFKVEMDSVGQA
SSUD2_RHILO           KKAALRGRKLRFGIRLHFIVRETEDEAWRAADRLISHVTDAQIENAQARFLNQMDSVGQR
C1DGL2_AZOVD          ERAKKYGRSVRFGVRLHVIVRETNEEAWAAAEKLISHLDDETIAKAQANYA-AMDSEGQR
A1VJQ2_POLNA          RRAEKYGRTVRFGVRLHVIVRETNEEAWAAAERLISRLDDDTIAKAQSNYA-SMDSEGQR
A9BUV1_DELAS          RRAAQQGRQVRLGVRLHVIVRETNEEAWADAERLISKLTDEDIARAQAGYA-RMDSVGQS
D8IQ40_HERSS          ERAARQGRTVRFGVRLHAIVRETTAEAWTAAERLISKLTDEDIARAQQNYA-RMDSVGQQ
A5EEY6_BRASB          KRAERHGRTVRFGVRLHVIVRETEDEAWSDADRLISRLTDDDIARAQAQYA-QMDSVGQA
SSUD_ACIAC            ARAAQRGRTVRFGIRLHVIVRETDAAAWAAAEELISRVQDETVAQAQAVFS-RMDSEGQR
SSUD_DELAS            EKAARHGRSVKFGIRLHVIVRETEDEAWADADRLISRLKDETVVQAQAAFA-RMDSEGQR
SSUD_POLNA            ARAAKFGRTVKFGIRLHVIVRETDDEAWRAAESLISRLDDDTVIRAQAAFS-RMDSEGQR
SSUD_VARPS            NRAARKGRTVEFGIRLHVIVRETEDAAWKAAEELISRVDDETVIRAQAAFA-RMDSEGQR
SSUD_RALPJ            ARAAKHGRTVRFGIRLHVIVRETEDEAWAAADKLISKLDDDTVARAQEAFR-KMDSAGQQ
C6BH37_RALP1          ARAAKHGRTVRFGIRLHVIVRETEDEAWAAADTLISKLDDDTVARAQEAFR-KMDSAGQQ
SSUD_RALSO            RRAARHGRTVRFGIRLHVIVRETEDAAWQAADTLISKLDDDTVARAQAAFR-KMDSAGQQ
SSUD_CUPNH            RQAARHGRTVKFGIRLHVIVRETEAAAWAAADDLISRLDDETVARAQAVFA-KMDSEGQR
SSUD_CUPTR            RHAARHGRTVKFGIRLHVIVRETDAAAWAAAEDLISRLDDDTVARAQAVFA-NMDSEGQR
SSUD_CUPMC            ARAAKHGRTVRFGIRLHVIVRETDAAAWAAADELISKLDDQTVARAQAVFA-KMDSEGQR
SSUD_XANAC            SKAAALGRTLTFGIRLHVIVRETEAEAWAAAESLISHLDDETVERAQSAFA-RMDSVGQR
A2SBY8_METPP          RRAAKHGRTLSFGIRLHVIVRETEDEAWRAAGALLSHLDDATIAAAQQRFG-QMDSVGQR
SSUD_PARPJ            ARAAAHGRQIKFGIRLHVIVRETEEEAWAAADKLISKLDDETISRAQASFS-KMDSEGQR
D5W7K4_BURSC          ARAAARGRQIRFGIRLHVIVRETEEEAWAAADKLISKLDDDTVARAQASFA-KMDSEGQR
SSUD_PARP8            ARAAQHGRTIRFGIRLHVIVRETEDEAWAAADKLISKLDDDTVARAQEAFA-KMDSEGQR
Q63TV9_BURPS          ARAAARGREIKFGIRLHVIVRETQEEAWRDADRLISRLDDDTIARAQQAFA-KMDSEGQR
A3NUT1_BURP0          ARAAARGREIKFGIRLHVIVRETQEEAWRDADRLISRLDDDTIARAQQAFA-KMDSEGQR
A2S363_BURM9          ARAAARGREIKFGIRLHVIVRETQEEAWRDADRLISRLDDDTIARAQQAFA-KMDSEGQR
SSUD_BURP1            ARAAARGREIKFGIRLHVIVRETQEEAWRDADRLISRLDDDTIARAQQAFA-KMDSEGQR
A3N936_BURP6          ARAAARGREIKFGIRLHVIVRETQEEAWRDADRLISRLDDDTIARAQQAFA-KMDSEGQR
A0A0H2XNI1_BURCA      ARADARGRKIKFGIRLHVIVRETEDEAWRDADRLISRLDDDTIARAQKAFA-NMDSEGQR
B1K0T2_BURCC          ARADARGRKIKFGIRLHVIVRETEDEAWRDADRLISRLDDDTIARAQKAFA-NMDSEGQR
B4E8P2_BURCJ          ARADARGRKIKFGIRLHVIVRETEDEAWRDAERLISRLDDDTIARAQKAFA-NMDSEGQR
Q39GW7_BURL3          ARAEARGRKIKFGIRLHVIVRETEDEAWRDAERLISRLDDETIARAQKAFA-NMDSEGQR
Q0BFQ2_BURCM          ARAESRGRTIRFGIRMHVIVRETEDEAWRDAERLISRLDDETIARAQKAFA-NMDSEGQR
B1YPJ4_BURA4          ARAESRGRTIRFGIRMHVIVRETEDEAWRDAERLISRLDDETIARAQKAFA-NMDSEGQR
A4JE30_BURVG          ARADARGRKIKFGIRLHVIVRETEDEAWRDAERLISRLDDETIARAQQVFA-NMDSEGQR
A0A0H3KF22_BURM1      ARAQARGREIKFGIRLHVIVRETEDEAWRDADRLISRLDDDTIARAQQAFA-NMDSEGQR
C5AGU6_BURGB          ARAEARGRQIKFGIRLHVIVRETEEEAWADADRLISRLDDATIKRAQESFA-KMDSEGQR
A9IMS5_BORPD          ARAARHGRVLKFGIRLHVIVRETEQAAWQAANALISHLDDDTVAAAQAAFG-RMDSEGQR
A6SVY3_JANMA          ARAAKHGRILKFGIRLHVIVRETNEEAWKAADELIKYVDDDLIARAQASFN-KMDSEGQR
D8IQQ1_HERSS          ERAAKAGRTLRFGIRLHVIVRETNEAAWRAADELISRLDDETIAKAQANFA-RMDSEGQR
B0V5V9_ACIBY          AKAEAKGRKLTYGIRLHVIVRETNEQAWAAANELIQYLDDATIAAAQKKFA-QMDSVGQQ
A0A0J1A8C8_ACIBA      AKAEAKGRKLTYGIRLHVIVRETNEQAWAAANELIQYLDDATIAAAQKKFA-QMDSVGQQ
B0VMM8_ACIBS          AKAEAKGRKLTYGIRLHVIVRETNEQAWAAANELIQYLDDATIAAAQKKFA-QMDSVGQQ
D8JJB2_ACISD          AKAEAKGRKLTYGIRLHVIVRETNEQAWAAANELIQYLDDATIAAAQKKFA-QMDSVGQQ
Q6FFY9_ACIAD          ARAATKGRTLNYGIRLHVIVRETNEQAWAAANELIQYLDDDTIAAAQKKFA-QMDSVGQQ
SSUD_PSE14            ERAARKGRTVKFGIRLHVIVRETSEEAWKAASTLIEHISDETIAAAQKSFS-RFDSEGQR
SSUD_PSESM            ERAARKGRTVKFGIRLHVIVRQTSEEAWKAASTLIEHISDETIAAAQKSFS-RFDSEGQR
SSUD_PSEU2            ERAARKGRTVKFGIRLHVIVRETSEEAWKAASTLIEHISDDTIAAAQKSFS-RFDSEGQR
Q4K935_PSEF5          ERAARKGRTVKFGIRLHVIVRETEDEAWKAADKLIEHISDDTIAAAQQSFS-RFDSEGQR
C3K524_PSEFS          ERAARRGRTVKFGIRLHVIVRETEEEAWKAADKLIEHISDDTIAAAQKSFS-RFDSEGQR
Q3K9A1_PSEPF          ERAARHGRKVKFGIRLHVIVRETAEEAWKAADKLIEHISDETIEAAQKSFS-RFDSEGQR
MSUD_PSEAE            QRAARHGRTVKFGIRLHVIVRETAEEAWRAADRLIEHISDETIAAAQQSFA-RFDSEGQR
A0A0H2ZBA9_PSEAB      QRAARHGRTVKFGIRLHVIVRETAEEAWRAADRLIEHISDETIAAAQQSFA-RFDSEGQR
A6V5D1_PSEA7          QRAARHGRTVKFGIRLHVIVRETAEAAWRAADRLIEHISDETIAAAQQSFA-RFDSEGQR
SSUD_SORC5            RRAAAEQRTVRFGIRLHVIVRETSEAAWAAANDLIRHLDDSTIAAAQQAFG-RLDSEGQR
C5AZ36_METEA          EAAERKGKTFSYGIRLHVIVRETESEAWEAADRLISRLDDATIAQAQATLK-RQDSVGQS
A9W7M5_METEP          EAAERKCKTFSYGIRLHVIVRETESEAWEAADRLISRLDDATIAQAQATLK-RQDSVGQS
SSUD_METC4            EAAERKGKTFSYGIRLHVIVRETESEAWEAADRLISRLDDATIAQAQATLK-RQDSVGQS
C7CDS9_METED          EAAEKKGKTFSYGIRLHVIVRETESEAWEAADRLISRLDDATIAQAQATLK-RQDSVGQS
B1ZLP7_METPB          EAAEKKGKTFSYGIRLHVIVRQTEAEAWDAADRLISRLDDATIAQAQATLK-RQDSVGQS
B8ILH7_METNO          QAAARRGRSFSYGIRLHVIVRETEGEAWEAAESLISRLDDATIARAQETLK-RQDSVGQS
B0UGA6_METS4          AAAAAKGKTFSFGIRLHVIVRETEGAAWEAAESLISRLDDATIARAQETLK-RQDSVGQS
B1M3N9_METRJ          QAAEAKGKTFSYGIRLHVIARETEAAAWEAAEQLISKLDDATIAKAQETLK-RQDSVGQS
Q0BVJ8_GRABC          ARAAKRGRKLSFGIRLHVIVRETAEEAWAAADHLIQYVTDEAIETAQKAFA-HFDSVGQQ
A8IC39_AZOC5          ARAAAEGREVSFGIRLHVIVRDTNEKAWEAAEDLIRHVDENTIAEAQKVFL-RMDSEGQR
A7IEL9_XANP2          ARAAAVGRELSFGIRLHVIVRDTTAEAWAAADKLISYIDDTTIAEAQKVFA-RMDSEGQR
B2IFA8_BEII9          ERAKAYGRKISFGIRLHVIVRETASEAWDAANDLIKYVDEKTIAEAQKAFA-RMDSVGQQ
SSUD_RHOPA            AVAEQRGRKLSFGIRLHVIVRETNEAAWAAADDLIRYVTDDTIAAAQKVFA-RMDSVGQQ
SSUD_RHOPT            AVAEQRGRKLSFGIRLHVIVRETNEAAWAAADDLIRYVTDDTIAAAQKVFA-RMDSVGQQ
Q07LQ6_RHOP5          AVAEPRGRTLSFGIRLHVIVRETNQAAWAAADDLIRYVTDDTIAAAQKVFA-RMDSVGQQ
A5ED25_BRASB          AVADKRGRKLSFGIRLHVIVRETNEEAWAAADDLIKYVTDETIASAQKIFA-RMDSVGQQ
A4Z097_BRASO          AVADKRGRKLSFGIRLHVIVRETNEEAWAAADDLIKHVTDETIASAQKIFA-RMDSVGQQ
SSUD_BRADU            EVANARGRKLSFGIRLHVIVRETNEEAWSAANELIKHVSDDTIARAQRNFA-RMDSVGQQ
Q3SUU3_NITWN          ALAATRGRQLSFGIRLHVIVRETNAEAWRAADELISYVTDDTIAAAQKIFS-RMDSVGQQ
D3P029_AZOS1          CQAEARGRKVTFGIRLHVIVRETTEQAWKAADDLIRHVDDTTIAAAQAVYA-RMDSVGQR
B8EQZ6_METSB          AAAAARGRSISFGIRLHIIARETNEAAWAAADRLISHLSDDTIAAAQKVFS-RLDSVGQA
D7A632_STAND          ALAEAEGRKVSFGIRLHVIARETDAKAWEAADDLIRHLDDDTIAAAQKVFS-RLDSVGQS
SSUD1_RHILO           ELAEKAGRKLSFGIRLHVIARETTEEAWAAADRLISRLDDATIASAQKVFA-RMDSVGQA
C7JHV8_ACEP3          KLAHAQGREVSFGIRLHVIVRETAEEAWHEADRLISHLDDATIAKAQQVFA-RMDSVGQA
D4I2P7_ERWAC          QRAQQQGRRLNYGIRLHVIVRETEEEAWAAADRLIAHLDDETIAAAQKIFS-RMDSTGQA
E5B5C2_ERWAM          QRAQQQGRRLNYGIRLHVIVRETEEEAWAAADRLIAHLDDETIAAAQKIFS-RMDSTGQA
D4GGW4_PANAM          KRAEERGRTLSYGIRLHVIVRETEEEAWAAADKLIAHLDEDTIAAAQKIFA-RMDSTGQA
B5XUZ3_KLEP3          ERAAARGRTLQYGIRLHVIVRETEEEAWAAADRLIAHLDDDTIAQAQKIFA-RMDSAGQA
A6TD77_KLEP7          ERAAARGRILQYGIRLHVIVRETEEEAWAAADRLIAHLDDDTIAQAQKIFA-RMDSAGQA
Q1AV42_RUBXD          RAARRAGREVSFGIRLHVIVRPTGEEAWAAAEDLIRHLDEKTIASAQKIFA-RMDSEGQR
SSUD_BACVZ            KQAAKEGRTMRFGIRLHVIVRETEEEAWEAAERLISHLDEETIAKAQAALR-RADSSGQK
SSUD_BACSU            KQAAKEGRSVRFGIRLHVIARETEQEAWEAAERLISHLDDDTIAKAQAALS-RYDSSGQQ
SSUD_BACLD            KKAEKEGRTVRFGIRLHVIVRETEKEAWQAADRLISRLEDETIAAAQNAMK-RMDSSGQK
D5DLP6_BACMD          KQAEAEGRTVKFGIRLHIIVRETEEEAWQAADRLIQHLDDETIQAAQRTFA-RYDSVGQQ
D5DTN9_BACMQ          KQAEAEGRTVKFGIRLHIIVRETEEEAWQAADRLIQHLDDDTIQAAQRTFA-RYDSVGQQ
C3GK80_BACTU          KLAEEKGRSVRFGIRLHVIVRETEEEAWEEAERLIQYVDNETIELAQKTFA-RYDSVGQK
A0A6L7HK57_BACAN      KLAEEKGRSVRFGIRLHVIVRETEEEAWEEAERLIQYVDNETIELAQKTFA-RYDSVGQK
A0RFA1_BACAH          KLAEEKGRSVRFGIRLHVIVRETEEEAWEEAERLIQYVDNETIELAQKTFA-RYDSVGQK
Q63A41_BACCZ          KLAEEKGRSVRFGIRLHVIVRETEEEAWEEAERLIQYVDNETIELAQKTFA-RYDSVGQK
Q6HHJ0_BACHK          KLAEEKGRSVRFGIRLHVIVRETEEEAWEEAERLIQYVDNETIELAQKTFA-RYDSVGQK
Q736E3_BACC1          KLAEEKGRSVRFGIRLHVIVRETEEEAWEEAERLIQYVDNETIELAQKTFA-RYDSVGQK
B7JSS0_BACC0          KLAEAKGRSVRFGIRLHVIVRETEEEAWEEAERLIQYVDNETIELAQKTFA-RYDSVGQK
D8H1E6_BACAI          KLAEAKGRSVRFGIRLHVIVRETEEEAWEEAERLIQYVDNETIELAQKTFA-RYDSVGQK
B9J439_BACCQ          KLAEEKGRSVRFGIRLHVIVRETEEEAWEEAERLIQYVDNETIELAQKTFA-RYDSVGQK
B7HUM3_BACC7          KLAAEKGRSVRFGIRLHVIVRETEEEAWEEAERLIQYVDNETIELAQKTFA-RYDSVGQK
B7H609_BACC4          KLAEEKGRTVRFGIRLHVIVRETEEEAWEEAERLIQYVDNETIELAQKTFA-RYDSVGQK
Q81C71_BACCR          KLAEEKGRTVRFGIRLHVIVRETEEEAWEEAERLIQYVDNETIELAQKTFA-RYDSVGQK
B7IKQ8_BACC2          KLAEEKGRTVRFGIRLHVIVRETEEEAWEEAERLIQYVDNETIELAQKTFA-RYDSVGQK
A7GQ63_BACCN          KLAEAKGRTVRFGIRLHVIVRETEEEAWKDAERCIQYVDDATIELAQKTFA-RYESVGQK
C5D5P5_GEOSW          KLAEQQGRAVEFGIRLHIIVRETEKEAWNAAEQLIRYVDEKTIQEAQRVFS-RYDSVGQQ
A4IRJ7_GEOTN          ELARQEGRKIEFGVRLHIIVRETEKEAWEAAERLIRYVDDRTIEEAQRVFA-RYDSVGQQ
D5DB81_BACMD          EKAKQKGREIRFGIRLHVIVRETEEEAWKAADELIQHVDEEAVKSAQKVFS-RMDSEGQK
D5E199_BACMQ          EKAKQTGREIRFGIRLHVIVRETEEEAWKAADELIQHVDEEAVKSAQKVFS-RMDSEGQK
C8WUN5_ALIAD          ALAAREGRTVRFGIRLHVIVRETEDEAWRAAKDLIRYVDRDTIRRAQEVFQ-RMDSVGQH
Q5WKG6_BACSK          QYARKTGRSIKFGIRLHVIVRETEGEAWQEADRLIQHLSQKDIDEAQKVFA-RFDSQGQR
Q3M323_TRIV2          RLAAAQGRTLSFGIRLHVIVRETESQAWDAANNLIRYVDDSAIAQAQQAYS-RMDSEGQR
B0JKK3_MICAN          RLAEARGRTLRFGIRLHVIVRETASEAWETAETLIRYVDEEAIATAQNAYA-RMDSEGQR
B2JAA3_NOSP7          RLAAEQGRTVRFGIRLHVIVRETDSAAWDAANELIKYVDEDAIAKAQKHLA-SSDSEGQR
A9B1Y4_HERA2          ALAAKHGRTIRFGMRMHVIVRETNQAAWDAANDLIRYVDDAAIANAQAAFA-KMDSVGQK
A6SWR5_JANMA          MKAEKLGRQVKFGIRLHTVVRQNADDAWTAANDLLKHVDDDTIAKAQATLA-RFDSEGQK
A0A0K1JRS4_9BACL      SRAQALGRRIKFGLRVQIIVRETAEEAWAAARKLIQYVSEEDVREAQAMLD-RFDSVGQR
D1CHA3_THET1          QQAWEQGRSVRFGIRMHVIVRETEEEAWEAAERLISKLDDDTVARAQEVFA-QMDSHGQH
D7DP41_METV0          AEAALKGRTVKFGIRLHVIVRETSEEAWQAADQLISYVTDETIAAAQAAVA-KFDSVGQK
C6X755_METGS          TAAAAQGRSVKFGIRLHVIVRETSEEAWQAADQLISHVTDETIAAAQAAVA-RFDSVGQQ
                        *    : .  *:*:: : * .   **  *   :  :    :  :*       :* ** 

SSUD_ECO55            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECOSE            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECO24            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
A0A5B7PH51_ECOLX      RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
C8ULF8_ECO1A          RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECO8A            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_SHIFL            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
D2ABI8_SHIF2          RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_SHIF8            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECOLU            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
D3H0G4_ECO44          RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECO27            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECOL5            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECOBW            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
A0A070SVD4_ECOLX      RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECODH            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECOHS            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECOLC            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECOLI            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECO57            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECO5E            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
D3QPD2_ECOCB          RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECO45            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECOK1            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECOUT            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
A0A0E2L880_ECOU3      RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECOL6            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECO81            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
W8ZQD3_ECOLX          RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECOSM            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ECO7I            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_ESCF3            RMAALHNGK-------RDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
SSUD_CITK8            RMAALHNGK-------RDQLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
D2TS72_CITRI          RMAALHNGR-------RDKLEISPNLWAGVGLVRGGAGTALVGDGPIVAARINEYAALGI
SSUD_ENT38            RMASLHNGK-------RENLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYADLGI
A0A0H3CK28_ENTCC      RMASLHNGK-------RENLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAELGI
A0A1F2LQS7_9ENTR      RMAALHNGR-------RDQLEISPNLWAGVGLARGGAGTALVGDAATVAERINEYAALGI
B5XY62_KLEP3          RMAALHNGR-------RDQLEISPNLWAGVGLARGGAGTALVGDAATVAERINEYAALGI
A6T736_KLEP7          RMAALHNGR-------RDKLEISPNLWAGVGLARGGAGTALVGDAATVAERINEYAALGI
SSUD_CROS8            RMAALHGGR-------RDQLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGI
C9Y0N2_CROTZ          RMAALHGGR-------RDQLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYASLGI
SSUD_ERWT9            RMAALHGGK-------RDRLEISPNLWAGVGLVRGGAGTALVGDGPTVAARMQEYADLGI
D4I0B4_ERWAC          RMAALHGGK-------RDRLEISPNLWAGVGLVRGGAGTALVGDGPTVAARMQEYADLGI
SSUD_PECCP            RMAALHGGK-------KDKLEISPNLWAGIGLVRGGAGTALVGDGPTVAERIQEYADLGI
A0A0H3I306_PECPM      RMAALHGGK-------KDNLEISPNLWAGIGLVRGGAGTALVGDGPTVAERIQEYADLGI
SSUD_PECAS            RMAALHGGK-------KDKLEISPNLWAGIGLVRGGAGTALVGDGPTVAERIKEYADLGI
SSUD_YERPB            RMAALHGGK-------KDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAQRIQEYADLGI
SSUD_YERPS            RMAALHGGK-------KDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAQRIQEYADLGI
SSUD_YERPY            RMAALHGGK-------KDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAQRIQEYADLGI
SSUD_YERP3            RMAALHGGK-------KDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAQRIQEYADLGI
SSUD_YERPA            RMAALHGGK-------KDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAQRIQEYADLGI
SSUD_YERPE            RMAALHGGK-------KDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAQRIQEYADLGI
SSUD_YERPN            RMAALHGGK-------KDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAQRIQEYADLGI
SSUD_YERPP            RMAALHGGK-------KDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAQRIQEYADLGI
SSUD_SERP5            RMAALHGGK-------KDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARMQEYADLGI
D2BXP8_DICZ5          RMVALHGGR-------RDKLEISPNLWAGIGLVRGGAGTALVGDPQTVAQRIQEYADLGI
C6CFJ9_DICC1          RMAALHGGR-------RDKLEISPNLWAGIGLVRGGAGTALVGDPQTVAQRIQEYADLGI
C6C3U5_DICP7          RMAALHGGR-------RDHLEISPNLWAGIGLVRGGAGTALVGDPQTVAQRIQEYADLGI
SSUD_PSEPK            RMAALHGGN-------RDNLEVSPNLWAGVGLVRGGAGTALVGDGPTVAARVKEYADLGI
SSUD_PSEP1            RMAALHGGN-------RDNLEVSPNLWAGVGLVRGGAGTALVGDGPTVAARVKEYADLGI
SSUD_PSEPG            RMAALHGGN-------RDNLEVSPNLWAGVGLVRGGAGTALVGDGPTVAARVKEYAELGI
SSUD_PSEPW            RMAALHGGN-------RDNLEVSPNLWAGVGLVRGGAGTALVGDGPTVAARVKEYADLGI
SSUD_PSEE4            RMAALHGGK-------RDKLEVAPNLWAGVGLVRGGAGTALVGDGPTVAARVKEYADLGI
SSUD_PSEAE            RMAALHGGS-------RDNLEVSPNLWAGVGLVRGGAGTALVGDGPTVAARVREYAELGI
A6V1Y2_PSEA7          RMAALHGGS-------RDNLEVSPNLWAGVGLVRGGAGTALVGDGPTVAARVREYAELGI
SSUD_PSEMY            RMAALHGGK-------TDNLEVSPNLWAGVGLVRGGAGTALVGDGPTVAARVREYAELGI
Q3K504_PSEPF          RMAALHGGS-------RDNLEVSPNLWAGVGLVRGGAGTALVGDGPTVAARVKEYADLGI
C3K3U8_PSEFS          RMAALHGGN-------RDNLEVSPNLWAGVGLVRGGAGTALVGDGPTVAARVKEYAALGI
Q4K439_PSEF5          RMAALHGGR-------RDQLEVSPNLWAGVGLVRGGAGTALVGDGPTVAARMQEYADLGI
SSUD_AZOVD            RMAALHGGS-------KENLEVSPNLWAGVGLVRGGAGTALVGDGPTVAARMKEYAALGI
Q21XJ7_RHOFT          RMRALHGGS-------RAKLEISPNLWAGVGLARSGAGTALVGDGETIARRLKEYEALGA
SSUD_AGRFC            RMQALHNGR-------RDKLEVSPNLWAGIGLVRSGAGTALVGSPKTVAARLREYQALGI
SSUD_RHIE6            RMVALHQGR-------RDKLEVSPNLWAGIGLVRTGAGTALVGSPKTIAERLREYQALGI
C3MH35_SINFN          RMAALHGGR-------RDRLEVSPSLWAGIGLVRSGAGTALVGSPKTVAARLREYQDLGI
C6B0T4_RHILS          RMAALHGGR-------RDKLEVSPNLWAGVGLVRAGAGTALVGSPKTVAARLREYQEIGI
Q1MFL6_RHIL3          RMAALHGGR-------RDKLEVSPNLWAGVGLVRAGAGTALVGSPKTVAARLREYQEIGI
B5ZSB3_RHILW          RMAALHGGR-------RDKLEVSPNLWAGVGLVRAGAGTALVGSPKAVAARLAEYQDIGI
Q2K7H6_RHIEC          RMAALHGGR-------RDKLEVSPNLWAGVGLVRAGAGTALVGSPKTVAARLREYQELGI
B9JG07_AGRRK          RMAALHGGR-------RDKLEVSPNLWAGVGLVRAGAGTALVGSPQTVAARLREYQDIGI
B9K142_AGRVS          RMTELHNGR-------RDKLEVSPNLWAGVGLVRAGAGTALVGSPETVAERLREYQAIGI
A8I8W6_AZOC5          RMAALHDGR-------RDRLEVAPNLWAGVGLVRRGAGTALVGDPQTIAARIREYQAVGV
A7IKZ2_XANP2          RMAALQPGD-------RNKLEIAPNLWAGIGLVRRGAGTALVGDPKSVAARIREYQEIGI
SSUD2_RHILO           RMAELHGGR-------RDRLVVSPNLWAGVGLVRGGAGTALVGTPEQVTERIREYQAIGI
C1DGL2_AZOVD          RMAALHGGR-------RDKLEVSPNLWAGVGLVRGGAGTALVGDPQTVAARLKEYADLGV
A1VJQ2_POLNA          RMAALHGGR-------RDQLEVSPNLWAGVGLVRGGAGTALVGDAQTVAARLQEYADLGV
A9BUV1_DELAS          RMAALHGGR-------RDRLEVAPNLWAGVGLVRGGAGTALVGDAATVAERLREYAALGA
D8IQ40_HERSS          RMAALHGGR-------RDKLEIAPNLWAGVGLVRGGAGTSLVGDATTVAERLQEYADLGV
A5EEY6_BRASB          RMAALHQGR-------RDRLVIGPNLWAGVGLVRGGAGTALVGSPEQVVNRLDEYAALGV
SSUD_ACIAC            RMAALHAGGT-RRS--RADLEISPNLWAGVGLVRGGAGTALVGDPQTVAARMQEYADLGI
SSUD_DELAS            RMAALHAGGS-RRT--RAELEISPNLWAGVGLVRGGAGTALVGDAQTVADRIKEYADLGI
SSUD_POLNA            RMAALHAGGK-KRT--RADLEISPNLWAGVGLVRGGAGTALVGDAKTVAARIEEYAALGI
SSUD_VARPS            RMAALHAGGA-RRS--RAELEISPNLWAGVGLVRGGAGTALVGDPKTVAARIEEYAALGL
SSUD_RALPJ            RMAALHANGV-KRT--RADLEISPNLWAGVGLVRGGAGTALVGDPQTVAARMKEYADLGI
C6BH37_RALP1          RMAALHANGV-KRT--RADLEISPNLWAGVGLVRGGAGTALVGDPQTVAARMKEYADLGI
SSUD_RALSO            RMAALHANGI-RRS--RAELEISPNLWAGVGLVRGGAGTALVGDPHTVAARMREYADLGI
SSUD_CUPNH            RMAALHAGGA-RRT--REALEISPNLWAGVGLVRGGAGTALVGDPHTVAERMREYAELGI
SSUD_CUPTR            RMAALHAGGT-RRT--REALEISPNLWAGVGLVRGGAGTALVGDPATVAERLREYAALGI
SSUD_CUPMC            RMAALHAGGT-RRT--REALEISPNLWAGVGLVRGGAGTALVGDPKTVAARIEEYAALGI
SSUD_XANAC            RMAALHSRGQ-RRT--RADLEVSPNLWAGVGLVRGGAGTALVGDPQTVAKRIEEYAALGI
A2SBY8_METPP          RMAELNKGKF-NRANIREGLEISPNLWAGVGLVRGGAGTALVGNPEQVAARIKEYAALGL
SSUD_PARPJ            RMAALHGGK----RGGRAELEVYPNLWAGVGLVRGGAGTALVGNPEQVAARMKEYAELGI
D5W7K4_BURSC          RMAALHGGK----RGGREQLEVYPNLWAGVGLVRGGAGTALVGSPEQVAARMKEYAALGI
SSUD_PARP8            RMAALHGGK----RGSRKELEIYPNLWAGVGLVRGGAGTALVGNAEQVAARMREYAELGI
Q63TV9_BURPS          RMAALHGGK----RGSRQELEIYPNLWAGVGLVRGGAGTALVGNPEQIAARMREYAALGI
A3NUT1_BURP0          RMAALHGGK----RGSRQELEIYPNLWAGVGLVRGGAGTALVGNPEQIAARMREYAALGI
A2S363_BURM9          RMAALHGGK----RGSRQELEIYPNLWAGVGLVRGGAGTALVGNPEQIAARMREYAALGI
SSUD_BURP1            RMAALHGGK----RGSRQELEIYPNLWAGVGLVRGGAGTALVGNPEQIAARMREYAALGI
A3N936_BURP6          RMAALHGGK----RGSRQELEIYPNLWAGVGLVRGGAGTALVGNPEQIATRMREYAALGI
A0A0H2XNI1_BURCA      RMAALHGGK----RGGREALEVYPNLWAGVGLVRGGAGTALVGNPEQVAERMREYADLGI
B1K0T2_BURCC          RMAALHGGK----RGGREALEVYPNLWAGVGLVRGGAGTALVGNPEQVAERMREYADLGI
B4E8P2_BURCJ          RMAALHGGK----RGGREALEVYPNLWAGVGLVRGGAGTALVGNPEQVAERMREYADLGI
Q39GW7_BURL3          RMAALHGGK----RGGREALEVYPNLWAGVGLVRGGAGTALVGNPEQVAERMREYADLGI
Q0BFQ2_BURCM          RMAALHGGK----RGGRDALEVYPNLWAGVGLVRGGAGTALVGNPEQVAERMREYADLGI
B1YPJ4_BURA4          RMAALHGGK----RGGRDALEVYPNLWAGVGLVRGGAGTALVGNPEQVAERMREYADLGI
A4JE30_BURVG          RMAALHGGK----RGGRDTLEVYPNLWAGVGLVRGGAGTALVGNPQQVAERMREYADLGI
A0A0H3KF22_BURM1      RMAALHGGK----RGGRETLEVYPNLWAGVGLVRGGAGTALVGNPEQVAERMREYAALGI
C5AGU6_BURGB          RMAALHGGK----RGSRQELEVYPNLWAGVGLVRGGAGTALVGSARQVAERMREYASLGV
A9IMS5_BORPD          RMAALHGGRLHGVDGGRGHLEIAPNLWAGVGLVRGGAGTALVGSPEIVAARMQEYADLGI
A6SVY3_JANMA          RMAALHGGK-------KDKLEVSPNLWAGVGLVRGGAGTALVGDAETVAARMQEYADLGI
D8IQQ1_HERSS          RMAALHGGR-------RDKLEVSPNLWAGVGLVRGGAGTALVGDGPTVAERLQEYAALGI
B0V5V9_ACIBY          RMAALHGGN-------RDKLEVSPNLWAGIGLVRGGAGTALVGDPETVAARIQEYADLGI
A0A0J1A8C8_ACIBA      RMAALHGGN-------RDKLEVSPNLWAGIGLVRGGAGTALVGDPETVAARIQEYADLGI
B0VMM8_ACIBS          RMAALHGGN-------RDKLEVSPNLWAGIGLVRGGAGTALVGDPETVAARIQEYADLGI
D8JJB2_ACISD          RMAALHGGN-------RDKLEVSPNLWAGIGLVRGGAGTALVGDPETVAARIQEYADLGI
Q6FFY9_ACIAD          RMAALHGGK-------RDQLEVSPNLWAGIGLVRGGAGTALVGDPETVAARIQEYADLGI
SSUD_PSE14            RMAALHDGR-------RDNLEIAPNLWAGVGLVRGGAGTALVGNPQEVAARIKEYADLGI
SSUD_PSESM            RMAALHDGR-------RDNLEIAPNLWAGVGLVRGGAGTALVGNPQEVAERIKEYADLGI
SSUD_PSEU2            RMAALHDGR-------RDNLEIAPNLWAGVGLVRGGAGTALVGNPEEVAARIKEYADLGI
Q4K935_PSEF5          RMAALHGGR-------RDQLQIAPNLWAGVGLVRGGAGTALVGNPQQVAERIKEYADLGI
C3K524_PSEFS          RMAALHDGR-------RDNLEIAPNLWAGVGLVRGGAGTALVGNPQQVAERIKEYADLGI
Q3K9A1_PSEPF          RMAALHDGR-------RDNLEIAPNLWAGVGLVRGGSGTALVGDPQQVAARIKEYADLGI
MSUD_PSEAE            RMAALHGGR-------RDRLEIQPNLWAGVGLVRGGAGTALVGDPRQVAERIGEYAELGI
A0A0H2ZBA9_PSEAB      RMAALHGGR-------RDRLEIQPNLWAGVGLVRGGAGTALVGDPRQVAERIGEYAELGI
A6V5D1_PSEA7          RMAALHGGR-------RDRLEIQPNLWAGVGLVRGGAGTALVGDPRQVAERIGEYAELGI
SSUD_SORC5            RMAALHKGR-------RDALEVSPNLWAGVGLVRGGAGTALVGDAETVARRMKEYAELGI
C5AZ36_METEA          RMMALHGGD-------RNKLVVSPNLWAGVGLVRGGAGTALVGSADQVADRMKEYIDLGI
A9W7M5_METEP          RMMALHGGD-------RNKLVVSPNLWAGVGLVRGGAGTALVGSADQVADRMKEYIDLGI
SSUD_METC4            RMMALHGGD-------RNKLVVSPNLWAGVGLVRGGAGTALVGSADQVADRMKEYIDLGI
C7CDS9_METED          RMMALHGGD-------RNKLVVSPNLWAGVGLVRGGAGTALVGSADQVADRMKEYIDLGI
B1ZLP7_METPB          RMMALHGGD-------RSKLVVSPNLWAGVGLVRGGAGTALVGSADQVADRMKEYIDLGI
B8ILH7_METNO          RMMALHGGD-------RGRLVVSPNLWAGVGLVRGGAGTALVGSADQVADRMKEYIDLGI
B0UGA6_METS4          RMMALHRGD-------RRNLVVAPNLWAGVGLVRGGAGTALVGSADQVADRMKEYIDLGI
B1M3N9_METRJ          RMMALHGGS-------RDKLVVAPNLWAGVGLVRGGAGTALVGSADQVADRMKAYIDLGI
Q0BVJ8_GRABC          RMARLHSGR-------REKLEISPNLWAGVGLVRGGAGTALVGSPQQVADRMKEYMALGI
A8IC39_AZOC5          RMSALHGGD-------RTKLEVAPNLWAGVGLVRGGAGTALVGDPQTVAERMKEYMSLGI
A7IEL9_XANP2          RMSALHGGR-------RDKLEVSPNLWAGVGLVRGGAGTALVGDPEIVAERMKEYMALGI
B2IFA8_BEII9          RMTVLHGGE-------RSKLEISPNLWAGVGLVRGGAGTALVGDPDTVAERMREYMRAGV
SSUD_RHOPA            RMSELHGGR-------RDKLEISPNLWAGVGLVRGGAGTALVGDPQTVAARIKEYQDVGI
SSUD_RHOPT            RMSELHGGR-------RDKLEISPNLWAGVGLVRGGAGTALVGDPQTVAARIKEYQDVGI
Q07LQ6_RHOP5          RMSQLHGGR-------RDQLEISPNLWAGVGLVRGGAGTALVGDPATVAARIKEYQDVGI
A5ED25_BRASB          RMSQLHGGR-------RDKLEISPNLWAGVGLVRGGAGTALVGDPDTVAARIREYQDLGI
A4Z097_BRASO          RMSQLHGGR-------RDKLEISPNLWAGVGLVRGGAGTALVGDPDTVAARIREYQDIGI
SSUD_BRADU            RMAQLHGGK-------RDKLEISPNLWAGVGLVRGGAGTALVGDAQTVAARIKEYQDIGI
Q3SUU3_NITWN          RMAQLHGGR-------RDKLEISPNLWGGVGLVRGGAGTALVGDPDTVAARIREYQDIGI
D3P029_AZOS1          RMSELHGGR-------RDKLEVAPNLWAGVGLVRGGAGTALVGDPETVAARMREYIDLGI
B8EQZ6_METSB          RMAALHGGR-------RDKLEVSPNLWAGVGLVRGGAGTALVGDGETVAARIQEYADLGI
D7A632_STAND          RMSALHGGR-------RDKLEVSPNLWAGVGLVRGGAGTALVGSGETVAARMQEYADLGI
SSUD1_RHILO           RMSALHGGD-------RAKLEIAPNLWAGVGLVRGGAGTALVGDPDTIAERIDEYRRLGI
C7JHV8_ACEP3          RMSALHGGR-------RDKLEISPNLWAGVGLVRGGAGTALVGDPDTVAERIDEYRRLGI
D4I2P7_ERWAC          RMSALHGGS-------RDNLRIAPNLWAGVGLVRGGAGTALVGNPQQVAGRIREYQALGI
E5B5C2_ERWAM          RMSALHGGS-------RDNLRIAPNLWAGVGLVRGGAGTALVGNPQQVAGRIREYQALGI
D4GGW4_PANAM          RMSALHGGS-------RDGLRIGPNLWAGVGLVRGGAGTALVGNPQQVAERIREYQALGI
B5XUZ3_KLEP3          RMSALHQGS-------RDNLRIAPNLWAGVGLVRGGAGTALVGNPQQVAERIREYQALGI
A6TD77_KLEP7          RMSALHQGS-------RDNLRIAPNLWAGVGLVRGGAGTALVGNPQQVAERIREYQALGI
Q1AV42_RUBXD          RMSALHGGR-------RDRLEVSPNLWAGVGLVRGGAGTALVGDPETVAERMREYMDIGI
SSUD_BACVZ            RMAGLHNGD-------RSKLEISPNLWAGIGLVRGGAGTALVGDPQTVATRILEYQALGI
SSUD_BACSU            RMAVLHQGD-------RTKLEISPNLWAGIGLVRGGAGTALVGDPQTIADRIAEYQALGI
SSUD_BACLD            RMVQLHQGN-------RSNLEISPNLWAGIGLVRGGAGTALVGDPETVASRIKEYADIGI
D5DLP6_BACMD          RMASLHRGT-------REELTISPNLWAGVGLVRGGAGTALVGSAENVAKRIKEYEALGI
D5DTN9_BACMQ          RMASLHRGT-------REELTISPNLWAGVGLVRGGAGTALVGSAENVAKRIKEYEALGI
C3GK80_BACTU          RMTHLNKGT-------RESLEISPNLWAGIGLVRGGAGTALVGDPHTVAERIKEYEALGI
A0A6L7HK57_BACAN      RMTHLNKGT-------RESLEISPNLWAGIGLVRGGAGTALVGDPHTVAERIKEYEALGI
A0RFA1_BACAH          RMTHLNKGT-------RESLEISPNLWAGIGLVRGGAGTALVGDPHTVADRIKEYEALGI
Q63A41_BACCZ          RMTHLNKGT-------RESLEISPNLWAGIGLVRGGAGTALVGDPHTVADRIKEYEALGI
Q6HHJ0_BACHK          RMTHLNKGT-------RESLEISPNLWAGIGLVRGGAGTALVGDPHTVADRIKEYEALGI
Q736E3_BACC1          RMTHLNEGT-------RESLEISPNLWAGIGLVRGGAGTALVGDPHTVANRIKEYEALGI
B7JSS0_BACC0          RMTHLNKGT-------RESLEISPNLWAGIGLVRGGAGTALVGDPHTVAERIKEYEALGI
D8H1E6_BACAI          RMTHLNKGT-------RESLEISPNLWAGIGLVRGGAGTALVGDPHTVAERIKEYEALGI
B9J439_BACCQ          RMTHLNKGT-------RESLEISPNLWAGIGLVRGGAGIALVGDPHTVADRIKEYEALGI
B7HUM3_BACC7          RMTHLNKGT-------RESLEISPNLWAGIGLVRGGAGTALVGDPHTVADRIKEYEALGI
B7H609_BACC4          RMTHLNKGT-------RESLEISPNLWAGIGLVRGGAGTALVGDPHTVAERIKEYESLGI
Q81C71_BACCR          RMTHLNKGT-------RESLEISPNLWAGIGLVRGGAGTALVGDPHTVAERIKEYESLGI
B7IKQ8_BACC2          RMTHLNKGT-------RESLEISPNLWAGIGLVRGGAGTALVGNPHTVAERIKEYESLGI
A7GQ63_BACCN          RMTRLNKGT-------REALEISPNLWAGIGLIRGGAGTALVGDPHTVAKRIKEYEELGI
C5D5P5_GEOSW          RMRQLHNGS-------RESLEISPNLWAGVGLVRGGAGTALVGDPETVAERLLEYHQLGI
A4IRJ7_GEOTN          RMRQLHGGK-------RDSLEISPNLWAGVGLVRGGAGTALVGDPETVAARLREYEQLGI
D5DB81_BACMD          RMSALHQGD-------RSNLEVSPNLWAGVGLVRGGAGTALVGDADTVAQRIKEYAELGI
D5E199_BACMQ          RMSALHQGD-------RSNLEVSPNLWAGVGLVRGGAGTALVGDADTVAQRIKEYAELGI
C8WUN5_ALIAD          RMQSLHQGD-------PSKLVVGPNLWAGVGLVRGGAGTALVGNPESVAERIREYADLGI
Q5WKG6_BACSK          RMAALHKGS-------RESLEISPNLWAGVGLVRGGAGTALVGGPESVAARIQEYKDLGI
Q3M323_TRIV2          RMKELHNGS-------REALEISPNLWAGIGLVRGGAGTALVGDPDTVAQRMLEYQKLGI
B0JKK3_MICAN          RMSQLHNGS-------RAALEISPNLWAGVGLVRGGAGTALVGDADTVARRLLEYRDLGI
B2JAA3_NOSP7          RMSQLHSGS-------RETLEISPNLWTGIGLVRGGAGTALVGDPDTVAARMLEYQDLGI
A9B1Y4_HERA2          RMQALHNGN-------RNQLEVSPNLWAGVGLVRGGAGTALVGDAGTVAERMLEYNELGI
A6SWR5_JANMA          RLLELHGGS-------RDKLEVSPNLWAGISLVRGGVGTALVGNGEQVAARILEYAALGI
A0A0K1JRS4_9BACL      RMTQLVRDN-------RHKPEVSPNLWAGIGQVRGGVGTALVGSPDEVAERLKEYAALGI
D1CHA3_THET1          RMAALHNGR-------RDNLRIGPNLWAGVGLVRGGAGTALVGSPEQVVERMREYEALGV
D7DP41_METV0          KMSALHGGK-------RGNLVVSPNLWAGVGLVRGGAGTALVGNPQEVADRIKEYSALGI
C6X755_METGS          KMSALHGGR-------RDRLVVSPNLWAGVGLVRGGAGTALVGSAQEVADRIKEYADLGI
                      ::  *                : *.** *:.  * * * :***    :. *:  *   * 

SSUD_ECO55            DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_ECOSE            DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_ECO24            DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
A0A5B7PH51_ECOLX      DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
C8ULF8_ECO1A          DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_ECO8A            DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_SHIFL            DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
D2ABI8_SHIF2          DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_SHIF8            DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_ECOLU            DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANEFIPR
D3H0G4_ECO44          DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANEFIPR
SSUD_ECO27            DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_ECOL5            DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_ECOBW            DSFVLSGYPHLEEAYRVGELLFPLLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
A0A070SVD4_ECOLX      DSFVLSGYPHLEEAYRVGELLFPLLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_ECODH            DSFVLSGYPHLEEAYRVGELLFPLLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_ECOHS            DSFVLSGYPHLEEAYRVGELLFPLLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_ECOLC            DSFVLSGYPHLEEAYRVGELLFPLLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_ECOLI            DSFVLSGYPHLEEAYRVGELLFPLLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_ECO57            DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVENDFIPR
SSUD_ECO5E            DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVENDFIPR
D3QPD2_ECOCB          DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_ECO45            DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_ECOK1            DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_ECOUT            DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
A0A0E2L880_ECOU3      DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_ECOL6            DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_ECO81            DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
W8ZQD3_ECOLX          DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_ECOSM            DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_ECO7I            DSFVLSGYPHLEEAYRVGELLFPHLDVAIP---EIPQPQ-----PLNPQGEAVANDFIPR
SSUD_ESCF3            DSFVLSGYPHLEEAYRIGELLFPHLDVAIP---EIPQPQ-----LLNPQGEAVANDFIPR
SSUD_CITK8            DSFVLSGYPHLEEAYNVGELLFPHLDVAIP---EIPQPQ-----PLHQQGEAVANEFIPR
D2TS72_CITRI          DSFVLSGYPHLEEAWKVGELLFPHLDVATP---AIPQPQ-----RRHLQGEAVANDFIPQ
SSUD_ENT38            DSFILSGYPHLEEAYNVGELLFPHLDVAIP---EIPQPR-----PLQVQGEAVANEFIPR
A0A0H3CK28_ENTCC      DSFILSGYPHLEEAYKVGELLFPHLDVAIP---DIPQPR-----QLQLQGEAVANEFIPR
A0A1F2LQS7_9ENTR      DSFIFSGYPHLEEAYRVGELLFPLLDVAVP---SIPQPQ-----NLRLQGEAVANEFIPR
B5XY62_KLEP3          DSFIFSGYPHLEEAYRVGELLFPLLDVAVP---SIPQPQ-----NLRLQGEAVANEFIPR
A6T736_KLEP7          DSFIFSGYPHLEEAYRVGELLFPLLDVAVP---SIPQPQ-----NLRLQGEAVANEFIPR
SSUD_CROS8            DSFILSGYPHLEEAYRVGEFLFPHLDVAIP---DVPQPR-----PLTAQGEAVANEFIPR
C9Y0N2_CROTZ          DSFILSGYPHLEEAYRVGELLFPHLDVAIP---DVPQPR-----PLTAQGEAVANEFIPR
SSUD_ERWT9            ETFILSGYPHLEEAYRVGELLFPHLDLVVP---EIPRPA-----AILAQGEHIAHQFVPQ
D4I0B4_ERWAC          ETFILSGYPHLEEAYRVGELLFPHLDLNIP---EVPKPA-----DIQAHGEHVAHDFAPQ
SSUD_PECCP            DTFILSGYPHLEEAYRVGELLFPHLDLA-----QQPTPLH----AVNNAGEVVANRYVPR
A0A0H3I306_PECPM      DTFVLSGYPHLEEAYRVGELLFPHLDLA-----QQPTPLH----AVNSAGEVVANRYVPR
SSUD_PECAS            DTFILSGYPHLEEAYRVGELLFPHLDLA-----QQPTPLH----AVSNAGEVVANRYVPR
SSUD_YERPB            DTFVFSGYPHLEEAYRVSELLFPHLDLATT---ELPTQRP----ATQPQGEVVANIYVPQ
SSUD_YERPS            DTFVFSGYPHLEEAYRVSELLFPHLDLATT---ELPTQRP----ATQPQGEVVANIYVPQ
SSUD_YERPY            DTFVFSGYPHLEEAYRVSELLFPHLDLATT---ELPTQRP----ATQPQGEVVANIYVPQ
SSUD_YERP3            DTFVFSGYPHLEEAYRVSELLFPHLDLATT---ELPTQRP----ATQPQGEVVANIYVPQ
SSUD_YERPA            DTFVFSGYPHLEEAYRVSELLFPHLDLATT---ELPTQRP----ATQPQGEVVANIYVPQ
SSUD_YERPE            DTFVFSGYPHLEEAYRVSELLFPHLDLATT---ELPTQRP----ATQPQGEVVANIYVPQ
SSUD_YERPN            DTFVFSGYPHLEEAYRVSELLFPHLDLATT---ELPTQRP----ATQPQGEVVANIYVPQ
SSUD_YERPP            DTFVFSGYPHLEEAYRVSELLFPHLDLATT---ELPTQRP----ATQPQGEVVANIYVPQ
SSUD_SERP5            DTFILSGYPHLEEAYRVGELLFPHLDLVEN---QAPAPRR----PAKAQGEVVANIYIPQ
D2BXP8_DICZ5          DTFVLSGYPHLEEAYRVGELLFPHLDVAVP---EVPQPQ-----PLRSQGEIVGNEFVPL
C6CFJ9_DICC1          DTFVLSGYPHLEEAYKVGELLFPLLDVAVP---EVPQPQ-----PLRSQGEIVGNEFVPL
C6C3U5_DICP7          DTFVLSGYPHLEEAYHVAELLFPHLDVAIP---DIPQPR-----SLGATGEIVGNEFVPL
SSUD_PSEPK            DTFIFSGYPHLEESYRVAELLFPHLDVQRP---EQPKAGG----YVSPFGEMVANDILPK
SSUD_PSEP1            DTFIFSGYPHLEESYRVAELLFPHLDVQRP---EQPKTGG----YVSPFGEMVANDILPK
SSUD_PSEPG            DTFIFSGYPHLEESYRVAELLFPHLDVQRP---EQPKTGG----YVSPFGEMVANDILPK
SSUD_PSEPW            DTFIFSGYPHLEESYRVAELLFPHLDVQRP---EQPQTGG----YVSPFGEMVANDILPK
SSUD_PSEE4            DTFIFSGYPHLEESYRVAELLFPHLDVQRP---EQPKSGG----YVSPFGEMVANDILPK
SSUD_PSEAE            DTFIFSGYPHLEESYRVAELLFPHLDVQRP---AQPEGRG----YVSPFGEMVANDILPR
A6V1Y2_PSEA7          DTFIFSGYPHLEESYRVAELLFPHLDVQRP---AQPEGRG----YVSPFGEMVANDILPR
SSUD_PSEMY            DTFIFSGYPHLEESYRVAELLFPHLDVAPP---ARPESRG----YVSPFGEMISSDILPK
Q3K504_PSEPF          DTFIFSGYPHLEESYRVAELLFPHLDVERP---ELPKSAG----YVSPFGEMVANDILPK
C3K3U8_PSEFS          DTFIFSGYPHLEESYRVAELLFPHLDIERP---ELPKSAG----YVSPFGEMVANDILPK
Q4K439_PSEF5          DTFIFSGYPHLEEAYRVAELLFPHLDIERP---KLPEAAG----YVSPFGEMVANDIIPK
SSUD_AZOVD            DTFVLSGYPHLEESYRVAELLFPHLDLARP---AGVEGRG----QVSPFGEVLANDILPK
Q21XJ7_RHOFT          ETFVLSGYPHLEEAYRFAELVFPHISIQAP---GAAPGQN----LVRPAGEVLGNGIVPS
SSUD_AGRFC            DTVIASGYPHLEEAYRLSELLFPEIGIDGP---RNQ--IR----SSFGAKQVFGGGGHGG
SSUD_RHIE6            DTVIASGYPHLEEAYRVSELLFPEIGLPGP---HGQ--IR----SSFGERRVFGGGGHGG
C3MH35_SINFN          DTVIASGYPHLEEAYRVSELLFPEIGLGGP---RNQ--IR----SSFGERQVFGGGGHAG
C6B0T4_RHILS          DTVIGSGYPHLEEAYRVAELLFPELGITRE---QQRLGFN----NEFGRKQVFAGGSHGG
Q1MFL6_RHIL3          DTVIGSGYPHLEEAYRVAELLFPELGITRE---QQRLGFN----NEFGRKQVFAGGSHGG
B5ZSB3_RHILW          DTVIGSGYPHLEEAYRVAELLFPELGITRE---QQRLAFN----NEFGRKQVFAGGSHGG
Q2K7H6_RHIEC          DTVIGSGYPHLEEAYRVAELLFPELGITRE---QQRLAFN----NEFGRKQIFAGGSHGG
B9JG07_AGRRK          ETVIGSGYPHLEEAYRVAELLFPEIGLSRE---EQRAGFR----NEFGAKQIFAGGSHGG
B9K142_AGRVS          DTVIGSGYPHLEEAYRVAELLFPKLGLGRS---NENDIKH----SDFADSKVFAGGGHSG
A8I8W6_AZOC5          DTFIGSGYPHLEEAYRVAELLFPALGIDGR---RRG--------VRTQIVNEFAVGSHGP
A7IKZ2_XANP2          ETFIGSGYPHLEEAYRVAELLFPELGVDGR---RRK--------VSDNIVNEFAVGSHLA
SSUD2_RHILO           DTIIGSGYPHLEEAYRVAELLFPRLGLGTR---RQQ--------AHRDIANEFSVGFHGA
C1DGL2_AZOVD          DSFVLSGYPHLEEAIRFAELVFPLLPGKQP---VT----V----EEELTGGAFDVRATKS
A1VJQ2_POLNA          DTFVLSGYPHLEESIRFAELVFPLLPGKEP---VTL---I----DQVLTGGAFDVRATAP
A9BUV1_DELAS          DSFVLSGYPHLEESIRFAELVFP-LLGKRA---VTT---S----DQAQTGGAFDIRSIQR
D8IQ40_HERSS          DTFVLSGYPHLEEAIRFAELVFP-LLGKNA---VTL---R----DRAQTGGAFDIRAAA-
A5EEY6_BRASB          DTFVLSGYPHLEEAIRFAELAFPRIAGKTP---VTL---L----NTTQTGGAFDIRTTTS
SSUD_ACIAC            DTFVLSGYPHLEEAYRFAELVFPLLPAEVR---ERIGGGRAAGPLTGPFGEIVGNQYVPR
SSUD_DELAS            DTFVLSGYPHLEEAYRFAELVFPLLPLSVR---DRLAGG-----VGGPLGETVANLYSPR
SSUD_POLNA            DTFVFSGYPHLEEAYRFAELVFPLLPRKLR---QKLPGT----GLTGPFGEVVANSYLPR
SSUD_VARPS            DKFILSGYPHLEEAYRFAELVFPLLSRKAQ---SRLAGG----SLSGPFGEVVANLDAPS
SSUD_RALPJ            DTFVLSGYPHLEEAYRFAELVFPLLPRSVR---DKLPGN----VLNGPFGEVIATGIVPR
C6BH37_RALP1          DTFVLSGYPHLEEAYRFAELVFPLLPRSVR---DKLPGN----VLNGPFGEVIATGIVPR
SSUD_RALSO            DTFVLSGYPHLEEAYRFAELVFPLLPRAVR---DTLPGS----VLNGPFGEVIATGIVPR
SSUD_CUPNH            DTFVLSGYPHLEEAYRFAELVFPLLPRSVR---DKLPGK----VLSGPFGEVMATGIVPR
SSUD_CUPTR            DTFVLSGYPHLEEAYRFAELVFPLLPRAVRAKFDNLPGK----VLSGPFGEVMATGIVPR
SSUD_CUPMC            DTFVLSGYPHLEEAYRFAELVFPLLPRKVR---DKLPGQ----VLSGPFGEVMATGIVPI
SSUD_XANAC            DTFIFSGYPHLEEAYRFAELVFPLLPRTVK---QKLPGQ----ALSGPFGEVIANTIVPR
A2SBY8_METPP          DHFILSGYPHLEEAHRVAELVFPLLPLQRETGAAAATH-----VLSGPFGEIVANSFVPP
SSUD_PARPJ            DTFILSGYPHLEESYRFAELVFPLL-PNRR--NKVSNGP-----LSGPFGEIVGNNYLPK
D5W7K4_BURSC          ETFILSGYPHLEESYRFAELVFPLL-PQRF--SKVANGP-----LSGPFGEIVGTSDLPK
SSUD_PARP8            ETFILSGYPHLEESYRFAELVFPLL-PGRQ--RANANGP-----LSGPFGEIVGNHYAPK
Q63TV9_BURPS          ETFILSGYPHLEESYRFAELVFPLV-KGGG--NTRRAGP-----LSGPFGEVVGNQYLPK
A3NUT1_BURP0          ETFILSGYPHLEESYRFAELVFPLV-KGGG--NTRRAGP-----LSGPFGEVVGNQYLPK
A2S363_BURM9          ETFILSGYPHLEESYRFAELVFPLV-KGGG--NTRRAGP-----LSGPFGEVVGNQYLPK
SSUD_BURP1            ETFILSGYPHLEESYRFAELVFPLV-KGGG--NTRRAGP-----LSGPFGEVVGNQYLPK
A3N936_BURP6          ETFILSGYPHLEESYRFAELVFPLV-KGGG--NTRRAGP-----LSGPFGEVVGNQYLPK
A0A0H2XNI1_BURCA      ETFILSGYPHLEESYRFAELVFPLI-KGEG--VKKAAGP-----LSGPFGEIVGNNYLPK
B1K0T2_BURCC          ETFILSGYPHLEESYRFAELVFPLI-KGEG--VKKAAGP-----LSGPFGEIVGNNYLPK
B4E8P2_BURCJ          ETFILSGYPHLEESYRFAELVFPLI-KGKG--VEKAAGP-----LSGPFGEIVGNNYLPK
Q39GW7_BURL3          ETFILSGYPHLEESYRFAELVFPLI-KGNG--AAKATGP-----LSGPFGEIVGNSYLPK
Q0BFQ2_BURCM          ETFILSGYPHLEESYRFAELVFPLI-KGEG--AKRPSGP-----LSGPFGEIVGNNYLPK
B1YPJ4_BURA4          ETFILSGYPHLEESYRFAELVFPLI-KGEG--AKRPSGP-----LSGPFGEIVGNNYLPK
A4JE30_BURVG          ETFILSGYPHLEESYRFAELVFPLI-KSSG--AKRASGP-----LSGPFGEIVGNNYLPK
A0A0H3KF22_BURM1      DTFILSGYPHLEESYRFAELVFPLI-KGKQ--AQRPTGP-----LSGPFGEIVGNSYLPK
C5AGU6_BURGB          ETFILSGYPHLEESYRFAELVFPLINKGEG--SRRRTGP-----LSGPFGEVIGNHYVPQ
A9IMS5_BORPD          DTFILSGYPHLEESFRFAELVFPLLPGRQA--AQAGQGV-----LTGPFGEVIGTELAPV
A6SVY3_JANMA          ETFILSGYPHLEESYRFAELVFPLLGKGKA--RS-GEAV-----LTGPFGEVISNDILPK
D8IQQ1_HERSS          DTFILSGYPHLEESYRFAELVFPLLPRGQR--EGGSGQQ-----LPGPFGEIVGNTELPK
B0V5V9_ACIBY          DTFIFSGYPHLEESIRFAELVFPLLPIETR---AKLAQP----NLTGPFGEIIANNYVPD
A0A0J1A8C8_ACIBA      DTFIFSGYPHLEESIRFAELVFPLLPIETR---AKLAQP----NLTGPFGEIIANNYVPD
B0VMM8_ACIBS          DTFIFSSYPHLEESIRFAELVFPLLPIETR---AKLAQP----NLTGPFGEIIANNYVPD
D8JJB2_ACISD          DTFIFSGYPHLEESIRFAELVFPLLPIETR---AKLAQP----NLTGPFGEIIANNYVPD
Q6FFY9_ACIAD          DTFIFSGYPHLEESIRFAELVFPLLPLKTR---ERLAQP----NLTGPFGEIIANNYVPD
SSUD_PSE14            DSFIFSGYPHLEEAYRFAELVFPLLPEPY-----ASLAGRGITNLTGPFGEMIANDLPP-
SSUD_PSESM            ESFIFSAYPHLEEAYRFAELVFPLLPEPY-----ASLAGRGITNLTGPFGEMIANDLPP-
SSUD_PSEU2            ESFIFSGYPHLEEAYRFAELVFPLLPEPY-----ASLAGRGITNLTGPFGEMIANDLPP-
Q4K935_PSEF5          ESFIFSGYPHLEEAYRFAELVFPLLPEPY-----ASLAGRGVTNLTGPFGEMIANDVLP-
C3K524_PSEFS          ESFIFSGYPHLEEAYRFAELVFPLLPEPY-----ASLAGRGITNLTGPFGEMIANDVLP-
Q3K9A1_PSEPF          ESFIFSGYPHLEEAYRFAELVFPLLPEPY-----ASLAGRGVTNLTGPFGEMIANDVLP-
MSUD_PSEAE            DSFIFSGYPHLEEAYRFAELVFPLLPEPY-----ASLAGRGLTNLTGPFGEMIANDVLP-
A0A0H2ZBA9_PSEAB      DSFIFSGYPHLEEAYRFAELVFPLLPEPY-----ASLAGRGLTNLTGPFGEMIANDVLP-
A6V5D1_PSEA7          DSFIFSGYPHLEEAYRFAELVFPLLPEPY-----ASLAGRGLTNLTGPFGEMIANDVLP-
SSUD_SORC5            ETFILSGYPHLEEAYRVAELLFPRLPVER-----RTAGVS--PNLTGPFGEIIANDIVP-
C5AZ36_METEA          DRFILSGYPHLEEAYRFAELVFPKLPLRA----TTGTAP-STARNNGPFGEVIANDIVP-
A9W7M5_METEP          DRFILSGYPHLEEAYRFAELVFPKLPLRA----TTGTAP-STARNNGPFGEVIANDIVP-
SSUD_METC4            DRFILSGYPHLEEAYRFAELVFPKLPLRA----TTGTAP-STARNNGPFGEVIANDIVP-
C7CDS9_METED          DRFILSGYPHLEEAYRFAELVFPKLPLRA----TTGTAP-STARNNGPFGEVIANDIVP-
B1ZLP7_METPB          DRFILSGYPHLEEAYRFAELVFPKLPLRA----TTGNAP-STARNNGPFGEVIANDIVP-
B8ILH7_METNO          DRFILSGYPHLEEAYRFAELVFPKLPLRS----TTGTGP-RVARNDGPFGEVIANDIVP-
B0UGA6_METS4          DRFILSGYPHLEEAYRFAELVFPKLPLRD----TTGTAP-RRARNDGPFGEVIANDIVPT
B1M3N9_METRJ          DRFILSGYPHLEEAYRFAELVFPKLPLRA----TTGRPA-SNARNDGPFGEIIANDLVP-
Q0BVJ8_GRABC          DRFILSGYPHLEECYRFAELVFPLLPLRE----TTGNRTLGTARNAGPFGEVIANVTAP-
A8IC39_AZOC5          DTFVLSGYPHLEEAYRFAESVFPLLPLAA----TTGRAK-GEILHRGPFGEMIGNTIVP-
A7IEL9_XANP2          DTFVLSGYPHLEEAYRFGEGVLPLLPLAS----GTGRPK-AATNHRGPFGEIIGNAIVPQ
B2IFA8_BEII9          DTFILSGYPHLEEAYRFAELVLPRLPLSA----GTHAPH-AASAHRGPFGEMVGNTFAPQ
SSUD_RHOPA            DTFILSGYPHLEEAYRFAELVFPLVKP------QHAGNVTPLRANTGPFGETIANEHLP-
SSUD_RHOPT            DTFILSGYPHLEEAYRFAELVFPLVKS------LHAGNVTPLRANTGPFGETIANEHLP-
Q07LQ6_RHOP5          DTFILSGHPHLEEAYRFAELVFPHFSL------EHGDNVTPLRVNTGPFGETIANEHLP-
A5ED25_BRASB          DTFILSGYPHLEEAYRFAELVFPKLGLNVT---EQGGNVTKLRANTGPFGETIANEHRP-
A4Z097_BRASO          DTFILSGYPHLEEAYRFAELVFPKLGLNVA---EQGGNVTKLRANTGPFGETIANEHRP-
SSUD_BRADU            DTFIMSGYPHLEEAYRFAELVFPLLSL------DHGSNVTRLHHNSGPFGETVGNDYRP-
Q3SUU3_NITWN          DTFILSGYPHLEEAYRFAELVFPLLSQ------PARDKVDTIRLNTGPFGETIANESRP-
D3P029_AZOS1          DTFILSGYPHLEEAYRFAELVFPLLPL--A---TTTGRPRSRVANGGPFGESIANNLPP-
B8EQZ6_METSB          DTFILSGYPHLEEAYRVAELVLPRLRL------NHGVRKSELSVNTGPFGETIANDYRP-
D7A632_STAND          DSFILSGYPHLEEAYRVAELVLPRLKL------NHGITQAATSVNTGPFGETIANDYRP-
SSUD1_RHILO           DTFILSGYPHLEEAYRFGELVLPKLPTDH----PVKATGS--SVNTGPFGETIAGDHRP-
C7JHV8_ACEP3          DTFIFSGYPHLEEAYQFGELVLPNLPTAH----PVRGKTN--LNNMGPFGETIAGDHRP-
D4I2P7_ERWAC          DNFIFSGYPHLEEAHRFADLVMPLLPLAL----HGDKRQR--TVNTGPFGETIGGDRRP-
E5B5C2_ERWAM          DNFIFSGYPHLEEAHRFADLVMPLLPLAL----HGDKRQR--TVNTGPFGETIGGDRRP-
D4GGW4_PANAM          DNFILSGYPHLEEAHRVADLLMPLLPLST----PAGNKQR--TVNTGPFGETIGGDRRP-
B5XUZ3_KLEP3          SNFIFSGYPHLEEAHRFAELVMPLLPLEN----AASSKAR--SVNTGPFGETIGGDKRP-
A6TD77_KLEP7          SNFIFSGYPHLEEAHRFAELVMPLLPLEN----GASSKAR--SVNTGPFGETIGGDKRP-
Q1AV42_RUBXD          DSFILSGYPHLEEAYRFAELVMPLLPVEGG---RAAAEVR--AANTGPFGETIANDRLP-
SSUD_BACVZ            ESFIFSGYPHLEEAYYLAELVFPLLPFQN----E------RTKKLERRLGEAMGNDHFA-
SSUD_BACSU            ESFIFSGYPHLEEAYYFAELVFPLLPFEN----D------RTRKLQNKRGEAVGNTYFV-
SSUD_BACLD            ESFIFSGYPHLEEAYHFAEKVFPLLPF-------------RTKLQSKASGEVIGNDHFP-
D5DLP6_BACMD          ESFILSGYPHLEEAYNVGELLFPLLNID------------DGEGKSESIGEIIANDRFP-
D5DTN9_BACMQ          ESFILSGYPHLEEAYHVGELLFPLLNID------------DGEGKSESTGEIIANDRFP-
C3GK80_BACTU          DTFVLSGYPHLEEAYEVAELLFPLLKED-------------KKQENKIVGEMIADAYAL-
A0A6L7HK57_BACAN      DTFVLSGYPHLEEAYEVAELLFPLLKED-------------KKQENKIVGEMIADAYAL-
A0RFA1_BACAH          DTFVLSGYPHLEEAYEVAELLFPLLKED-------------KKQENKIVGEMIADAYAL-
Q63A41_BACCZ          DTFVLSGYPHLEEAYEVAELLFPLLKED-------------KKQENKIVGEMIADAYAL-
Q6HHJ0_BACHK          DTFVLSGYPHLEEAYEVAELLFPLLKED-------------KKQENKIVGEMIADAYAL-
Q736E3_BACC1          DTFVLSGYPHLEEAYEVAELLFPLLKED-------------KKQENKIVGEMIADAYAL-
B7JSS0_BACC0          DTFVLSGYPHLEEAYEVAELLFPLLKED-------------KKQENKIVGEMIADAYAL-
D8H1E6_BACAI          DTFVLSGYPHLEEAYEVAELLFPLLKED-------------KKQENKIVGEMIADAYAL-
B9J439_BACCQ          DTFVLSGYPHLEEAYEVAELLFPLLKED-------------KKQENKIVGEMIADAYAL-
B7HUM3_BACC7          DTFVLSGYPHLEEAYEVAELLFPLLKED-------------KKQENKIVGEMIADAYAL-
B7H609_BACC4          DTFVLSGYPHLEEAYEVAELLFPLLKDK-------------KKEENKIVGEMIADAYAL-
Q81C71_BACCR          DTFVLSGYPHLEEAYEVAELLFPLLKDK-------------KKEENKIVGEMIADAYAL-
B7IKQ8_BACC2          DTFVLSGYPHLEEAYEVAELLFPLLKNE-------------KKEENKMVGEMIADAYAL-
A7GQ63_BACCN          DTFILSGYPHLEEAYQVAELLFPLLPVS-------------QNEKDKIVGEMIADAYAL-
C5D5P5_GEOSW          RYFILSGYPHLEEAYRVAELLFPLLPLNH-----------GKQAASSIQGEIVGNEFFP-
A4IRJ7_GEOTN          RYFILSGYPHLEEAYRVAELLFPLLPLT------------SRRTSSAIQGEVVGNEFFP-
D5DB81_BACMD          ETFILSGYPHLEEAYRTAELLFPRLPVKR----KH--DENER-TFISPFGEVKANDKTP-
D5E199_BACMQ          ETFILSGYPHLEEAYRTAELLFPRLPVKC----KH--DENER-TFISPFGEVKVNDKAP-
C8WUN5_ALIAD          ETFILSGYPHLEEAYRFAELVFPLVR-RS----DT--NASKR-TFTGPFGEIVANAWIP-
Q5WKG6_BACSK          ETFIMSGYPHLEEAYRFAELVFPYFQ-EE----KE--AVPEK-QWTSPFGGIAAR-----
Q3M323_TRIV2          DTFIFSGYPHLEEAYRVAELLFPRLPLQH----QP--TVAP--QLLSPFGEVVANQDFP-
B0JKK3_MICAN          ETFILSGYPHLEEAYRAAELLFPRLPVES----AP--IRPQPVQVLAPFGEIVAHI----
B2JAA3_NOSP7          ETFVFSGYPHLEEAYRTAELLFPRLPLQR----ET--APLTP-PVLSTVSEIVSSEKFA-
A9B1Y4_HERA2          DTFVLSGYPHLEEAYRVAELLFPRLPLGS----KP--TAPT--NQTGIFGELLQLHEFS-
A6SWR5_JANMA          DYFILSGIPHLEEAYHFHENVFHRLPVHQ--------KQR--EVPNLPMGMFGDKNLSK-
A0A0K1JRS4_9BACL      DTFILSGYPHLEEAYRISELLFPRLPVTY--------PQRPKETEWTPMGELLAENIKP-
D1CHA3_THET1          DTFIFSGYPHLEEAHRFAELVFPLLGLHK----RL--EGYNYTNYYGPIGEIVAEGGLI-
D7DP41_METV0          DYFIFSGYPHLEESYRVAELLFPLLPLAL----KPSSEDAIKTNMTGPFGESITEHQPQ-
C6X755_METGS          DHFIFSGYPHLEESYRVAELLFPLLPLSV----KAGSEAAIKTNLTGPFGEALPNRGPQ-
                        .: *. *****.    :  :  .                                   

SSUD_ECO55            ------------------KVAQS------------------------
SSUD_ECOSE            ------------------KVAQS------------------------
SSUD_ECO24            ------------------KVAQS------------------------
A0A5B7PH51_ECOLX      ------------------KVAQS------------------------
C8ULF8_ECO1A          ------------------KVAQS------------------------
SSUD_ECO8A            ------------------KVAQS------------------------
SSUD_SHIFL            ------------------KVAQS------------------------
D2ABI8_SHIF2          ------------------KVAQS------------------------
SSUD_SHIF8            ------------------KVAQS------------------------
SSUD_ECOLU            ------------------KVAQS------------------------
D3H0G4_ECO44          ------------------KVAQS------------------------
SSUD_ECO27            ------------------KVAQS------------------------
SSUD_ECOL5            ------------------NVAQS------------------------
SSUD_ECOBW            ------------------KVAQS------------------------
A0A070SVD4_ECOLX      ------------------KVAQS------------------------
SSUD_ECODH            ------------------KVAQS------------------------
SSUD_ECOHS            ------------------KVAQS------------------------
SSUD_ECOLC            ------------------KVAQS------------------------
SSUD_ECOLI            ------------------KVAQS------------------------
SSUD_ECO57            ------------------RVAQS------------------------
SSUD_ECO5E            ------------------RVAQS------------------------
D3QPD2_ECOCB          ------------------RVAQS------------------------
SSUD_ECO45            ------------------NVAQS------------------------
SSUD_ECOK1            ------------------NVAQS------------------------
SSUD_ECOUT            ------------------NVAQS------------------------
A0A0E2L880_ECOU3      ------------------NVAQS------------------------
SSUD_ECOL6            ------------------NVAQS------------------------
SSUD_ECO81            ------------------NVAQS------------------------
W8ZQD3_ECOLX          ------------------NVAQS------------------------
SSUD_ECOSM            ------------------NVAQS------------------------
SSUD_ECO7I            ------------------NVAQS------------------------
SSUD_ESCF3            ------------------NVAQS------------------------
SSUD_CITK8            ------------------KAAQS------------------------
D2TS72_CITRI          ------------------KVAQS------------------------
SSUD_ENT38            ------------------KTAQS------------------------
A0A0H3CK28_ENTCC      ------------------KVAQS------------------------
A0A1F2LQS7_9ENTR      ------------------KVAQS------------------------
B5XY62_KLEP3          ------------------KVAQS------------------------
A6T736_KLEP7          ------------------KVAQS------------------------
SSUD_CROS8            ------------------RVAQS------------------------
C9Y0N2_CROTZ          ------------------RVAQS------------------------
SSUD_ERWT9            ------------------KVSQS------------------------
D4I0B4_ERWAC          ------------------KVSQS------------------------
SSUD_PECCP            ------------------KVSQS------------------------
A0A0H3I306_PECPM      ------------------KVSQS------------------------
SSUD_PECAS            ------------------KVSQS------------------------
SSUD_YERPB            ------------------KVSQS------------------------
SSUD_YERPS            ------------------KVSQS------------------------
SSUD_YERPY            ------------------KVSQS------------------------
SSUD_YERP3            ------------------KVSQS------------------------
SSUD_YERPA            ------------------KVSQS------------------------
SSUD_YERPE            ------------------KVSQS------------------------
SSUD_YERPN            ------------------KVSQS------------------------
SSUD_YERPP            ------------------KVSQS------------------------
SSUD_SERP5            ------------------KASQS------------------------
D2BXP8_DICZ5          L-----------------KAAQS------------------------
C6CFJ9_DICC1          L-----------------KAAQS------------------------
C6C3U5_DICP7          L-----------------KAAQS------------------------
SSUD_PSEPK            ------------------SVSQS------------------------
SSUD_PSEP1            ------------------SVSQS------------------------
SSUD_PSEPG            ------------------SVSQS------------------------
SSUD_PSEPW            ------------------SVSQS------------------------
SSUD_PSEE4            ------------------SVSQS------------------------
SSUD_PSEAE            ------------------QAAQS------------------------
A6V1Y2_PSEA7          ------------------QAAQS------------------------
SSUD_PSEMY            ------------------AAAAS------------------------
Q3K504_PSEPF          ------------------AASQS------------------------
C3K3U8_PSEFS          ------------------AASQS------------------------
Q4K439_PSEF5          ------------------AVSQS------------------------
SSUD_AZOVD            ------------------AAAQS------------------------
Q21XJ7_RHOFT          T-----------------LRAA-------------------------
SSUD_AGRFC            N-----------------VKLVSGS----------------------
SSUD_RHIE6            N-----------------VKIASAS----------------------
C3MH35_SINFN          N-----------------LRVVAGS----------------------
C6B0T4_RHILS          N-----------------LKVVSGS----------------------
Q1MFL6_RHIL3          N-----------------LKVVSGS----------------------
B5ZSB3_RHILW          N-----------------LKVVSGS----------------------
Q2K7H6_RHIEC          N-----------------LKMVSGS----------------------
B9JG07_AGRRK          N-----------------LKVVSGS----------------------
B9K142_AGRVS          G-----------------FRVVSGS----------------------
A8I8W6_AZOC5          A-----------------ANATIRAAE--------------------
A7IKZ2_XANP2          E-----------------RRRAAVS----------------------
SSUD2_RHILO           A-----------------RLQASS-----------------------
C1DGL2_AZOVD          E-----------------AAA--------------------------
A1VJQ2_POLNA          A-----------------VAPQSAEKAAEKPASAAGQAIAAERAVAV
A9BUV1_DELAS          S-----------------QSAS-------------------------
D8IQ40_HERSS          -------------------SAS-------------------------
A5EEY6_BRASB          A-----------------DVAAS------------------------
SSUD_ACIAC            A-----------------AQS--------------------------
SSUD_DELAS            A-----------------SQS--------------------------
SSUD_POLNA            V-----------------SQS--------------------------
SSUD_VARPS            R-----------------LASQS------------------------
SSUD_RALPJ            V-----------------AAS--------------------------
C6BH37_RALP1          V-----------------AAS--------------------------
SSUD_RALSO            V-----------------AAS--------------------------
SSUD_CUPNH            A-----------------AQS--------------------------
SSUD_CUPTR            A-----------------AQS--------------------------
SSUD_CUPMC            A-----------------SQS--------------------------
SSUD_XANAC            A-----------------SAR--------------------------
A2SBY8_METPP          P-----------------AVAPVRVSAS-------------------
SSUD_PARPJ            A-----------------ASSS-------------------------
D5W7K4_BURSC          A-----------------ASAS-------------------------
SSUD_PARP8            A-----------------SQS--------------------------
Q63TV9_BURPS          A-----------------SQS--------------------------
A3NUT1_BURP0          A-----------------SQS--------------------------
A2S363_BURM9          A-----------------SQS--------------------------
SSUD_BURP1            A-----------------SQS--------------------------
A3N936_BURP6          A-----------------SQS--------------------------
A0A0H2XNI1_BURCA      T-----------------SQS--------------------------
B1K0T2_BURCC          T-----------------SQS--------------------------
B4E8P2_BURCJ          T-----------------SQS--------------------------
Q39GW7_BURL3          A-----------------AQS--------------------------
Q0BFQ2_BURCM          A-----------------SQS--------------------------
B1YPJ4_BURA4          A-----------------SQS--------------------------
A4JE30_BURVG          A-----------------SQS--------------------------
A0A0H3KF22_BURM1      T-----------------SQS--------------------------
C5AGU6_BURGB          A-----------------SQS--------------------------
A9IMS5_BORPD          R-----------------AAAR-------------------------
A6SVY3_JANMA          V-----------------SQS--------------------------
D8IQQ1_HERSS          A-----------------APVRVSAS---------------------
B0V5V9_ACIBY          E-----------------KKQ-----NSSVKEPA-------------
A0A0J1A8C8_ACIBA      E-----------------KKQ-----NSSVKEPA-------------
B0VMM8_ACIBS          G-----------------KKQ-----NSSVKEPA-------------
D8JJB2_ACISD          E-----------------KKQ-----NSSVKEPA-------------
Q6FFY9_ACIAD          E-----------------DKKKKLSKDQNPKETA-------------
SSUD_PSE14            ------------------QAK--------------------------
SSUD_PSESM            ------------------QAK--------------------------
SSUD_PSEU2            ------------------QAK--------------------------
Q4K935_PSEF5          ------------------NSR--------------------------
C3K524_PSEFS          ------------------TTKA-------------------------
Q3K9A1_PSEPF          ------------------AKANA------------------------
MSUD_PSEAE            ------------------ARAGA------------------------
A0A0H2ZBA9_PSEAB      ------------------ARAGA------------------------
A6V5D1_PSEA7          ------------------ARAGA------------------------
SSUD_SORC5            ------------------HRSQS------------------------
C5AZ36_METEA          -----------------TRRVSAH-----------------------
A9W7M5_METEP          -----------------TRRVSAH-----------------------
SSUD_METC4            -----------------TRRVSAH-----------------------
C7CDS9_METED          -----------------TRRVSAH-----------------------
B1ZLP7_METPB          -----------------TRRVGAH-----------------------
B8ILH7_METNO          -----------------ARRVGAH-----------------------
B0UGA6_METS4          PGAGAAPGIGATRSVAEARRVGAR-----------------------
B1M3N9_METRJ          -----------------THRVGAH-----------------------
Q0BVJ8_GRABC          -----------------THRVSAS-----------------------
A8IC39_AZOC5          -----------------EPKVSAS-----------------------
A7IEL9_XANP2          -----------------ERQRSAS-----------------------
B2IFA8_BEII9          -----------------DRRVSAS-----------------------
SSUD_RHOPA            -----------------NAKQAVKP----------------------
SSUD_RHOPT            -----------------NAKQAVKP----------------------
Q07LQ6_RHOP5          -----------------RAKQAANP----------------------
A5ED25_BRASB          -----------------LQRASQS-----------------------
A4Z097_BRASO          -----------------LQRASQS-----------------------
SSUD_BRADU            -----------------SRLASQS-----------------------
Q3SUU3_NITWN          -----------------TEARPLQRETVRS-----------------
D3P029_AZOS1          -----------------ALRQSAQ-----------------------
B8EQZ6_METSB          -----------------ASRAVAQS----------------------
D7A632_STAND          -----------------PIRAAQS-----------------------
SSUD1_RHILO           -----------------KSLASAS-----------------------
C7JHV8_ACEP3          -----------------TRAA--------------------------
D4I2P7_ERWAC          -----------------EKTSSTR-----------------------
E5B5C2_ERWAM          -----------------EKTSSTR-----------------------
D4GGW4_PANAM          -----------------EKQASAS-----------------------
B5XUZ3_KLEP3          -----------------VRQVSAS-----------------------
A6TD77_KLEP7          -----------------VRQVSAS-----------------------
Q1AV42_RUBXD          -----------------GAGSGGGG----------------------
SSUD_BACVZ            ------------------RGKKAKV----------------------
SSUD_BACSU            ------------------KEKNA------------------------
SSUD_BACLD            ------------------SRQKEKTV---------------------
D5DLP6_BACMD          ------------------KASTS------------------------
D5DTN9_BACMQ          ------------------KASTS------------------------
C3GK80_BACTU          ------------------KK---------------------------
A0A6L7HK57_BACAN      ------------------KK---------------------------
A0RFA1_BACAH          ------------------KK---------------------------
Q63A41_BACCZ          ------------------KK---------------------------
Q6HHJ0_BACHK          ------------------KK---------------------------
Q736E3_BACC1          ------------------KK---------------------------
B7JSS0_BACC0          ------------------KK---------------------------
D8H1E6_BACAI          ------------------KK---------------------------
B9J439_BACCQ          ------------------KK---------------------------
B7HUM3_BACC7          ------------------KK---------------------------
B7H609_BACC4          ------------------KR---------------------------
Q81C71_BACCR          ------------------KK---------------------------
B7IKQ8_BACC2          ------------------KK---------------------------
A7GQ63_BACCN          ------------------EKK--------------------------
C5D5P5_GEOSW          ------------------SFIKV------------------------
A4IRJ7_GEOTN          ------------------TFIKV------------------------
D5DB81_BACMD          ------------------AKR--------------------------
D5E199_BACMQ          ------------------AKR--------------------------
C8WUN5_ALIAD          ------------------EERRAAKA---------------------
Q5WKG6_BACSK          -----------------------------------------------
Q3M323_TRIV2          ------------------KQQIATVD---------------------
B0JKK3_MICAN          -----------------------------------------------
B2JAA3_NOSP7          ------------------KQLTSAS----------------------
A9B1Y4_HERA2          ------------------RREPAPTGQ--------------------
A6SWR5_JANMA          ------------------SSVS-------------------------
A0A0K1JRS4_9BACL      ------------------KSS--------------------------
D1CHA3_THET1          ------------------RNGGREVKR--------------------
D7DP41_METV0          ------------------VSAH-------------------------
C6X755_METGS          ------------------VSAS-------------------------