CLUSTAL format seed alignment for MF_01235

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NANE_ECOLI       ------MSLLAQLDQKIAANGGLIVSCQPVPDSPLDKPE--IVAAMALAAEQAGAVAIRI
NANE_SHIFL       ------MSLLAQLDQKIAANGGLIVSCQPVPDSPLDKPE--IVAAMALAAEQAGAVAIRI
NANE_ECO57       ------MSLLAQLDQKIAANGGLIVSCQPVPDSPLDKPE--IVAAMALAAEQAGAVAIRI
NANE2_SALTY      ------MSLLEQLDKNIAASGGLIVSCQPVPGSPLDKPE--IVAAMALAAEQAGAVAVRI
NANE_KLEAE       ------MSLLAQLDQRIRHHGGLIVSCQPVPGSPLDNPA--IVAAMALAAEQAGAVALRI
NANE1_SALTY      ------MSLLARLEQSVHENGGLIVSCQPVPGSPMDKPE--IVAAMAQAAASAGAVAVRI
NANE_YERPE       ------MSNLSNLRHKLQ--NGLIASCQPVPGSAMDTPE--IVAAMACAALAGGAVGLRI
NANE_HAEIN       ------MSKLSYQEVLSQIQYGLISSCQPVDDGPMDKPE--IVSAMAQASVMGGRSGLRI
NANE_PASMU       ------MSKLSHPQVLEQIKYGLIASCQPVDNGPMDSPE--IVAAMAQASVIGGAAGLRI
NANE_VIBCH       MRPVVRKNFLNIEELKRFLNGQTVVSIQPVTGSPLDKTD--FIVAMAIAVEQAGAKALRI
NANE_VIBVU       -----------------MLSGQTVVSIQPVVGSPLDKTE--FIVAMAVAAEQAGAKALRI
NANE_THEEB       ------------MNLATQIRGGLIVSCQAPADSPLAAPE--IIAAMAKAAVLRGAVAVRI
NANE_STRA3       -----MP-HLSKEAFKKQIKNGIIVSCQALPGEPLYTESGGVMPLLALAAQEAGAVGIRA
NANE_STRSU       -----MG-KISKEALKEQIKDGIIISCQALPGEPLYREEGGIMPLLVKAAQEAGAVGIRA
NANE2_STRPN      -----MP-QISKEALIEQIKDGIIVSCQALPHEPLYTEAGGVIPLLVKAAEQGGAVGIRA
NANE1_STRR6      -----MS-QISKEALIEQIKDGIIVSCQALPHEPLYTEAGGVIPLLVKAAEQGGAVGIRA
NANE_STRP3       -----MPDKPTKEKLMEQLKGGIIVSCQALPGEPLYSETGGIMPLLAKAAQEAGAVGIRA
NANE_STRP1       -----MPDKPTKEKLMEQLKGGIIVSCQALPGEPLYSETGGIMPLMAKAAQEAGAVGIRA
NANE_ENTFA       ---------MNKAKFLEVISGGLIVSCQALPGEPFYTEEGGLMPYFALAAKNAGAVGIRA
NANE_LACLA       ---------MKKEVFLDKVKNGIIVSCQALPGEALYSEKGGIMPLMAKAAAQAGAVGIRA
NANE1_STRPN      -----MSQIWTKEKFISQVQGGVIVSCQALPGEALYNEEFSLMPFMAKAALEAGAVGIRA
NANE_CLOPE       --------------MLDVVKGNLIVSCQALSDEPLHSSF--IMGRMAIAAKQGGAAAIRA
NANE_CALS4       ----------MQMDIIQKLENGLIVSCQALEGEPLHSPF--IMAKMAKAAEIGGAVAIRA
NANE_BORBU       ------------MIIIVKIKRGLIVSCQALENEPLHSSF--IMSKMALAAKIGGAIGIRA
NANE_FUSNN       -----------MNKILESIRGKLIVSCQALEDEPLHSSF--IMGRMAYAAYSGGAAGIRA
NANE_LISIN       ----------MGNSVMEKIKGGLVVSCQALEDEPLHSAF--IMSKMALAAVQGGAVGIRA
NANE_LISMO       ----------MGNSVMEKIKGGLVVSCQALEDEPLHSAF--IMSKMALAAVQGGAVGIRA
NANE_LACPL       ----------MKNTFLNTVKGSLIISCQALPNEPLHSSF--IMSRMALAAKGAGAAGIRA
NANE_STAAM       -----------------MLPHGLIVSCQALADEPLHSSF--IMSKMALAAYEGGAVGIRA
NANE_STAAW       -----------------MLPHGLIVSCQALPDEPLHSSF--IMSKMALAAYEGGAVGIRA
NANE_OCEIH       --------------MLDQIKNSLIVSCQALPDEPLHSSF--IMSKMALAAKQGGAKGIRA
NANE_MYCPE       ----------MKDVILRKIKNNLVVSCQAVGEETLNNDI--AITLMAKACLEGGAKVLRL
NANE_MYCPU       ----------------MFEKKLFFVSCQALKGEALYGKD--IVVKLAKAAIQGGAQGLRT
NANE_CORGL       -----MDLNTQRSKLYAQLQGQLIVSVQAPDGHAMRDTH--TLTHVAAACVDGGAPAIRC
                                        . * *.    .:       :  .. *    *   :* 

NANE_ECOLI       EGVANLQATRAVV---SVPIIGIVKRDLEDSPVRITAYIEDVDALAQAGADIIAIDGTDR
NANE_SHIFL       EGVANLQATRAVV---SVPIIGIVKRDLEDSPVRITAYIEDVDALAQAGADIIAIDGTDR
NANE_ECO57       EGVANLQATRAVV---SVPIIGIVKRDLEDSPVRITAYIEDVDALAQAGADIIAIDGTDR
NANE2_SALTY      EGIDNLRMTRSLV---SVPIIGIIKRDLDESPVRITPFLDDVDALAQAGAAIIAVDGTAR
NANE_KLEAE       EGQANLQAVRPLV---TVPVIGLIKRDLPDSPVRITPWLEDIDALAQGGADIIAIDGTQR
NANE1_SALTY      EGIENLRTVRPHL---SVPIIGIIKRDLTGSPVRITPYLQDVDALAQAGADIIAFDASFR
NANE_YERPE       EGISNIQAVRRAT---DAPIIGIIKRDLPDSEVRITPWLEDIDALSAAGADIIAFDVTCR
NANE_HAEIN       EGVDNLKATRPFV---NVPIIGIVKRDLPDSPVRITPFLQDIEDLANAGADIIAVDGTSR
NANE_PASMU       EGIENLKATRNVV---NVPIIGIVKRDLPDSPVRISPFLQDIEELAAAGADIIAFDGTDR
NANE_VIBCH       EGVNNVAAVSAAV---TIPIIGIVKRDLPDSPIRITPFVSDVDGLANAGATVIAFDATDR
NANE_VIBVU       EGVENVRHVSQAT---NVPIIGIVKRDLQDSPVRITPFVCDVDALATAGATIIAFDATDR
NANE_THEEB       NTPAHIQAVRQAV---NVPIIGLWKQTLPAYPVYITPRFADAVAVAAAGADIIALDATAR
NANE_STRA3       NSVRDIKEIQEVT---NLPIIGIIKREYPPQEPFITATMTEVDQLASLDIAVIALDCTLR
NANE_STRSU       NSVRDIKEIKEVT---TLPIIGIIKRDYPPQEPFITATMREVDELAALDIEVIALDCTKR
NANE2_STRPN      NSVRDIKEIKEVT---KLPIIGIIKRDYPPQEPFITATMKEVDELAELDIEVIALDCTKR
NANE1_STRR6      NSVRDIKEIKEVT---KLPIIGIIKRDYPPQEPFITATMKEVDELAELDIEVIALDCTKR
NANE_STRP3       NSVRDIKEIQAIT---DLPIIGIIKKDYPPQEPFITATMAEVDQLAALNIAVIAMDCTKR
NANE_STRP1       NSVRDIKEIQAIT---DLPIIGIIKKDYPPQEPFITATMTEVDQLAALNIAVIAMDCTKR
NANE_ENTFA       NSVRDIKEIKEKV---SLPIIGIIKRDYPPEEPFITATMREVDELVAIGVEVIALDCTLR
NANE_LACLA       NSVRDIKEIQKIV---DLPIIGIIKRDYPPQKPFITATMKEIDELVATSCEVIALDCTSR
NANE1_STRPN      NSVRDIKAIQKVV---DLPIIGIIKRDYPPQEPYITATMKEVDELVECGTTVIAFDATLR
NANE_CLOPE       QGVNDINEIKEVT---KLPIIGIIKRNYDDSEIYITPTMKEVDELLKTDCEMIALDATKR
NANE_CALS4       NGYEDIVAIKKEV---SIPVIGLIKKRYEGYAPYITPTMEEVDKVIEAGADIVAIDATKA
NANE_BORBU       NGVNDISQIKLEV---DLPIIGIIKKNYNNCDVFITPTMKEIDELCNEGVDIIALDATFR
NANE_FUSNN       NTVEDIKEIKKNV---SLPIIGIIKKVYNNSDVYITPTIKEVEDLINEGVQIIAIDATKR
NANE_LISIN       NTAKDIRAIQSEV---DVPIIGIYKKDYDDSDVFITPTLKEVREICETGVEIVAMDATTR
NANE_LISMO       NTAKDIRAIQSEI---DVPIIGIYKKDYDDSDVFITPTLKEVREICETGVEIVAMDATTR
NANE_LACPL       NSVVDIQAIQDEV---DLPLIGLSKVDYPDSPVYITPTIKEMRAVAATGCAVVACDVTGQ
NANE_STAAM       NTKEDILAIKETV---DLPVIGIVKRDYDHSDVFITATSKEVDELIESQCEVIALDATLQ
NANE_STAAW       NTKEDILAIKETV---DLPVIGIVKRDYNHSDVFITATSKEVDELIESQCEVIALDATLQ
NANE_OCEIH       NTKEDIIQIKEEV---NLPVVGIVKRDYKDSEVFITATYKEIDELLESNCEMIAIDATTR
NANE_MYCPE       SQYSHIKSIKSISG--KTPIIGLIKSNYENSEVIITPSIKEVDLLLSLNVDCIAIDATNR
NANE_MYCPU       SQIKNIKALIRANF--NVPIIGIIKQNYPNSDVYISPTLKEMKKLIKTGVQIIAIDATLR
NANE_CORGL       GGYGGLEDIRSISNRVDVPVFGLTKEGSEG--VYITPTRDSVRAVAESGATVVCADATFR
                      :            *:.*: *         *:.   .   :       :. * :  

NANE_ECOLI       PRPVP--VETLLARIHH---HGLLAMTDCSTPEDGLACQKLGAEIIGTTLSGYTTPETPE
NANE_SHIFL       PRPVP--VETLLARIHH---HGLLAMTDCSTPEDGLACQKLGAEIIGTTLSGYTTPETPE
NANE_ECO57       PRPVP--VETLLARIHH---HGLLAMTDCSTPEDGLACQKLGAEIIGTTLSGYTTPETPE
NANE2_SALTY      QRPVA--VEALLARIHH---HHLLAMADCSSVDDGLACQRLGADIIGTTMSGYTTPDTPE
NANE_KLEAE       QRPAS--VSALLAEIHR---LGKVAMADCSSLDDALECWQLGAEIVGTTLSGYTAEETPD
NANE1_SALTY      SRPVD--IDSLLTRIRL---HGLLAMADCSTVNEGISCHQKGIEFIGTTLSGYTGPITPV
NANE_YERPE       ERPVS--VADLYQRARA---TGCLTMADASNIDDGLLAHHLGIDFIGTTLSGYTQATVPT
NANE_HAEIN       PRPVD--IESAVKKIHE---MGCLAMADCSNLEEGLYCKALGFDIVGSTMSGYTGGAVPE
NANE_PASMU       VRPTT--REAIIKRIKE---LGCLAMADCSNFEEGMYCHNLGVEIIGSTMSGYTGGEIPA
NANE_VIBCH       TRPES--RERIAQAIKN---TGCFAMADCSTFEDGLWANSQGVEIVGSTLSGYVGDIEPT
NANE_VIBVU       QRPES--RETIANAIKN---SGCFAMADCSCFADGQWAAQIGVDIIGSTLSGYVGEIEPT
NANE_THEEB       SRPEP--LQDLIQRIHNE--LGKPVMADIDSLENAAAAVAAGADWVGTTLFGYTETTAHT
NANE_STRA3       ERHDGLSVVEFIQKI-KRKYPEQLLMADISTFEEGKNAFEAGVDFVGTTLSGYTDYSRQE
NANE_STRSU       ERYDGLDIVDFINQI-KEKYPEQLFMADISTFEEGLTAYEAGIDFIGTTLSGYTSYSRQE
NANE2_STRPN      ERYDGLEIQEFIRQV-KEKYPNQLLMADTSIFEEGLAAVEAGIDFVGTTLSGYTSYSPKV
NANE1_STRR6      ERYDGLEIQEFIRQV-KEKYPNQLLMADTSIFEEGLAAVEAGIDFVGTTLSGYTSYSPKV
NANE_STRP3       DRHDGLDIASFIRQV-KEKYPNQLLMADISTFDEGLVAHQAGIDFVGTTLSGYTPYSRQE
NANE_STRP1       DRHDGLDIASFIRQV-KEKYPNQLLMADISTFDEGLVAHQAGIDFVGTTLSGYTPYSRQE
NANE_ENTFA       KRHDGLSINTFIEKV-KKKYPQQLLMADISTFEEGKNAYQAGVDFVGTTLSGYTKESKKQ
NANE_LACLA       ERYDGLTINEFIKSI-KEKYPNQLLMADCSTFEECKNAYEAGVDFVGTTLSGYTDESPKQ
NANE1_STRPN      PRYDGLVVSEFIKKI-KEKYPNQLLMADVSNLDEGLYAFKSGVDFVGTTLSGYTSTSVQS
NANE_CLOPE       KRPNGENVKDLVDAI-HAK--GRLAMADISTLEEGIEAEKLGFDCVSTTLSGYTPYSKQS
NANE_CALS4       YKPGGLTTGEFLKRI-KEKYPKILVMADISTYEEGIEAEKLGFDLISTTLSGYTEYSPEL
NANE_BORBU       NRPDGVLLDDFFENI-KKKYPKQCLMADISSLDEAINADKLGFDFIGTTLYGYTKNTNGL
NANE_FUSNN       ERPDRKDLKNFIAEI-KEKYPNQLFMADISSVDEALYAEKIGFDIVGTTLVGYTDYTKNY
NANE_LISIN       KRPHNEDLKDILSAI-RKEFPNTLFMADTGSIEDVYYADSLGFDLIGTTLYGYTEETANK
NANE_LISMO       KRPHNEDLKDILSAI-RKEFPNTLFMADTASIEDVYYADSLGFDLIGTTLYGYTEETANK
NANE_LACPL       PRPNGEKLAEIVATM-RTEFPDTLLMADTDTIENVKVADKLGFDIIGTTMHGYTPATTGA
NANE_STAAM       QRPKE-TLDELVSYI-RTHAPNVEIMADIATVEEAKNAARLGFDYIGTTLHGYTSYTQGQ
NANE_STAAW       QRPKE-TLDELVSYI-RTHAPNVEIMADIATVEEAKNAARLGFDYIGTTLHGYTSYTQGQ
NANE_OCEIH       NRPQDIKLQDLVDYT-KRLNSEVELMADIATLEEAKIAEKLGFDCISTTLHGYTSNTSNH
NANE_MYCPE       KRPSE-TLEVIFKYC-REKSPNTLLMADCATIDDVKNADKLGFDLIGTTLRGYTKETFGK
NANE_MYCPU       KRPKE-SLNQIVDYFFKHKKSHQLLMADCSSIEDVNNAIKLNFDIIGTTLRGYTEDTKNF
NANE_CORGL       PRPDG---STFAELVTVAHDSGILIMADCATPEEVLSAHKAGADFVSTTLAGYTEHREKT
                  :                       *:*     :   .   . : :.:*: **.      

NANE_ECOLI       EPD---LALVKTLSD----AGCRVIAEGRYNTPAQAADAMRHGAWAVTVGSAITRLEHIC
NANE_SHIFL       EPD---LALVKTLSE----AGCRVIAEGRYNTPAQAADAMRHGAWAVTVGSAITRLEHIC
NANE_ECO57       EPD---LTLVKRLSD----AGCRVIAEGRYNTPAQAADAMRHGAWAVTVGSAITRLEHIC
NANE2_SALTY      EPD---LPLVKALHD----AGCRVIAEGRYNSPALAAEAIRYGAWAVTVGSAITRLEHIC
NANE_KLEAE       EPD---LALVQCLSV----AGCRVIAEGRYNTPAQAAEAMRCGAWAVTVGSAITRLEHIC
NANE1_SALTY      EPD---LAMVTQLSH----AGCRVIAEGRYNTPALAANAIEHGAWAVTVGSAITRIEHIC
NANE_YERPE       EPD---LALVTQLAQ----AGCRVIAEGRYHSPALAAAAISAGAYAVTVGSAITRIEHIC
NANE_HAEIN       EPD---YQLVKDLKS----AGCFVMAEGRYNTPELAKVAIEIGADCVTVGSALTRLEHIV
NANE_PASMU       EPD---YQLVKDLNA----AGCRVMAEGRYNTPELAKTAIEIGAYSVTVGSALTRLEHIV
NANE_VIBCH       VPD---FQLVKAFSE----AGFFTMAEGRYNTPELAAKAIESGAVAVTVGSALTRLEVVT
NANE_VIBVU       EPD---LELVKQFSS----AGFFTMAEGRYNTPQLAAKAIENGAVAVTVGSAITRMEVVT
NANE_THEEB       PPPS-WSLLSQLVEH----LSVPILSEGGIASPTMAAKALGLGAWAVVVGTDITGIDLKV
NANE_STRA3       EGP--DIELLNKLCQ----AGIDVIAEGKIHTPKQANEINHIGVAGIVVGGAITRPKEIA
NANE_STRSU       EGP--DIELVDRLCR----AGIDVIAEGKIHYPDQVKIIHDLGVAGIVVGGAITRPKEIA
NANE2_STRPN      DGP--DFELIKKLCD----AGVDVIAEGKIHTPEQAKQILEYGVRGIVVGGAITRPKEIT
NANE1_STRR6      DGP--DFELIKKLCD----AGVDVIAEGKIYTPEQAKQILEYGVRGIVVGGAITRPKEIT
NANE_STRP3       AGP--DVALIEALCK----AGIAVIAEGKIHSPEEAKKINDLGVAGIVVGGAITRPKEIA
NANE_STRP1       AGP--DVALIEALCK----AGIAVIAEGKIHSPEEAKKINDLGVAGIVVGGAITRPKEIA
NANE_ENTFA       NGP--DMKLIKQLVQ----ENICVIAEGKIHTPEQARQIKKLGVAGIVVGGAITRPQEIA
NANE_LACLA       DEP--DFTLLEKLVE----EKIPVIAEGRIHSPEQAKRVYDIGVDAMVIGGAITRPFEIA
NANE1_STRPN      DEP--DFELMKKLAD----FNIPVIAEGKIHYPEQLKKAYSLGVTSVVIGGAITRPKEIA
NANE_CLOPE       NSV--DFELLEELVKT---VKIPVICEGRINTPEELKKALDLGAYSAVVGGAITRPQQIT
NANE_CALS4       EGP--DYELIERLARK---VNVPIIAEGRIWTPEEAVKALEKGAYAVVVGTAITRPHEIT
NANE_BORBU       NIADNDFNFLRTLLNSN--LKSTLIVEGKIDTPLKAQKCFEMGVDLVVVGGAITRPAEIT
NANE_FUSNN       KALEELKKVVKVV-------KIPVIAEGNIDTPLKAKKALEIGAFAVVVGGAITRPQQIT
NANE_LISIN       NISDHDFSHMKEVLKS---TKRPVIAEGKIDSPSKARQVLTLGCYAVVVGGAVTRPQEIT
NANE_LISMO       NISDDDFSHLKEVLKS---TKRPVIAEGKIDSPSKARQVLTLGCYAVVVGGAVTRPQEIT
NANE_LACPL       NIADNDFAYLKEVLQA---TSRPVIAEGKVDTPEKMKRCLDLGCHAVVVGGAITRPLEIA
NANE_STAAM       LLYQNDFQFLKDVLQS---VDAKVIAEGNVITPDMYKRVMDLGVHCSVVGGAITRPKEIT
NANE_STAAW       LLYQNDFQFLKDVLQS---VDAKVIAEGNVITPDMYKRVMDLGVHCSVVGGAITRPKEIT
NANE_OCEIH       KIYDNDFSFLKNLLSE---VKIPIIAEGNILTPEMFKRCIELGAHACVVGGAITRPQEIT
NANE_MYCPE       SNMDNDYSFIKECLSSI---KTPLIAEGGIWEPYQVKDLLDLGCFAVVVGSAITRPKEIT
NANE_MYCPU       SNTDDNYLFLRQVLKICQQNKKYLIAEGGFNSPQNAKDALDIGANAVVVGSAITRPQFIT
NANE_CORGL       VGP--DFDCLREARELV--PDAFLIGEGRFSNPADVAHGRLIGANAIIVGTAITDPGFIT
                                         : **    *         *     :*  :*      

NANE_ECOLI       QWYNTAMKKAVL-------
NANE_SHIFL       QWYNTAMKKAVL-------
NANE_ECO57       QWYNTAMKKAVL-------
NANE2_SALTY      GWYNDALKKAAS-------
NANE_KLEAE       GWYNTALKAAVYPANEQ--
NANE1_SALTY      QWFSHAVKR----------
NANE_YERPE       GWFCDAIKQCETEKLTEY-
NANE_HAEIN       SWFANSVKSAR--------
NANE_PASMU       SWFADAVKSAK--------
NANE_VIBCH       QWFNNATQAAGERKCAH--
NANE_VIBVU       HWFNSATQAVRQNNESISY
NANE_THEEB       QQYVAALKANTDLS-----
NANE_STRA3       ERFISGLS-----------
NANE_STRSU       ERFISALHK----------
NANE2_STRPN      ERFVASLK-----------
NANE1_STRR6      ERFVAGLK-----------
NANE_STRP3       ERFIEALKS----------
NANE_STRP1       ERFIEALKS----------
NANE_ENTFA       KRFVDALNKEEKDV-----
NANE_LACLA       TRFIKAIGEK---------
NANE1_STRPN      QRFINVIK-----------
NANE_CLOPE       KRFTDILK-----------
NANE_CALS4       RRFVTFIKERRYSNVRAK-
NANE_BORBU       KKFVEKINQIKK-------
NANE_FUSNN       KKFVDEMK-----------
NANE_LISIN       TRFTNEIKKI---------
NANE_LISMO       TRFTNEIQKIQEERGK---
NANE_LACPL       QRFISAL------------
NANE_STAAM       KRFVQVMED----------
NANE_STAAW       KRFVQVMED----------
NANE_OCEIH       KRFIG--------------
NANE_MYCPE       KYFLKALDN----------
NANE_MYCPU       KMFYEKINS----------
NANE_CORGL       GQFASLLH-----------
                   :