CLUSTAL format seed alignment for MF_01237

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NANA_HAEIN       -MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEK
NANA_PASMU       -MKNLKGIFSALLVSFNADGSINEKGLRQIVRYNIDKMKVDGLYVGGSTGENFMLSTEEK
NANA_FUSNN       ----MKGIYSALMVPYNEDGSINEKGLREIIRYNIDKMKVDGLYVGGSTGENFMISTEEK
NANA_CLOPE       ----MKGIYSALLVSFDKDGNINEKGLREIIRHNIDVCKIDGLYVGGSTGENFMLSTDEK
NANA_STAAM       MNKDLKGLYAALLVPFDENGQVNEQGLKQIAQNAIETEELDGLYVNGSSGENFLLNTEQK
NANA_STAAW       MNKDLKGLYAALLVPFDENGQVNEQGLKQIAQNAIETEELDGLYVNGSSGENFLLNTEQK
NANA_LACPL       --MSKKLLYAAQMTAFDKDGNINLDGIRALVRYNIDVNKVDGLYVCGSTGEAFMLNTDEK
NANA_ECOLI       MATNLRGVMAALLTPFDQQQALDKASLRRLVQFNIQ-QGIDGLYVGGSTGEAFVQSLSER
NANA1_ECOL6      MATNLRGVMAALLTPFDQQQALDKASLRRLVQFNIQ-QGIDGLYVGGSTGEAFVQSLSER
NANA_SALTI       MAKALQGVMAALLTPFDHQQQLDSESLRRLVRFNIG-QGIDGLYVGGSTGEAFVQSLAER
NANA_SALTY       MAKALQGVMAALLTPFDHQQQLDSESLRRLVRFNIG-QGIDGLYVGGSTGEAFVQSLAER
NANA2_ECOL6      MQCEFKGVISALPTPYDQSQQIDMESLRKLIRFNIE-QNIKGLYVGGSTGEAFLQNVAER
NANA_RHIME       --MKLEGIYSALLTPFSEDESIDRQAIGALVDFQVR-LGIDGVYVGGSSGEAMLQSLDER
                      . : :*  ..:. .  ::  .:  :    :    :.*:** **:** :: .  ::

NANA_HAEIN       KEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIK
NANA_PASMU       KEIFRIAKDEAKDEIALIAQVGSVNLQEAIELGKYATELGYDSLSAVTPFYYKFSFPEIK
NANA_FUSNN       KRVFEIAIDEAKDSVNLIAQVGSINLNEAVELGKYVTKLGYKCLSAVTPFYYKFDFSEIK
NANA_CLOPE       KRIFEIAMDEAKGQVKLIAQVGSVNLKEAVELAKFTTDLGYDAISAVTPFYYKFDFNEIK
NANA_STAAM       KQVFKVAKEAVGDKVKLIAQVGSLDLNEAIELGKYATELGYDALSAVTPFYYPFTFEEIR
NANA_STAAW       KQVFKVAKEAVGDKVKLIAQVGSLDLNEAIELGKYATELGYDALSAVTPFYYPFTFEEIR
NANA_LACPL       KQVMETVYDEANGAIDLVAQVGSLNLKEAKELAKFATDLGYPKLSAVTPFYYNFTFEQIK
NANA_ECOLI       EQVLEIVAEEAKGKIKLIAHVGCVSTAESQQLAASAKRYGFDAVSAVTPFYYPFSFEEHC
NANA1_ECOL6      EQVLEIVAEEAKGKIKLIAHVGCVSTAESQQLAASAKRYGFDAVSAVTPFYYPFSFEEHC
NANA_SALTI       EQVLEIVAEEAKGKITLIAHVGTVSTAESQQLASAAKRYGFDAVSAVTPFYYPFSFEEHC
NANA_SALTY       EQVLEIVAEEAKGKITLIAHVGTVSTAESQQLASAAKRYGFDAVSAVTPFYYPFSFEEHC
NANA2_ECOL6      EKILETVADESDGRLTLIAHVGGISTAESEVLAKAAKKYGYHAISAVTPFYYPFSFEEHC
NANA_RHIME       ADYLSDVAAAASGRLTLIAHVGTIATRDALRLSQHAAKSGYQAISAIPPFYYDFSRPEVM
                    :  .     . : *:*:** :   ::  *.  .   *:  :**:.**** *   :  

NANA_HAEIN       HYYDTIIA-ETGNNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKK
NANA_PASMU       HYYDSIIE-ATGNYMIVYSIPFLTGVNIGVEQFGELYKNPKVLGVKFTAGDFYLLERLKK
NANA_FUSNN       DYYETIVR-ETGNYMIIYSIPFLTGVNMSLSQFGELFENEKIIGVKFTAGDFYLLERVRK
NANA_CLOPE       HYYETIIN-SVDNKLIIYSIPFLTGVNMSIEQFAELFENDKIIGVKFTAADFYLLERMRK
NANA_STAAM       DYYFDIIE-ATQNNMIIYAIPDLTGVNISIEQFSELFNHEKIVGVKYTAPNFFLLERIRK
NANA_STAAW       DYYFDIIE-ATQNNMIIYAIPDLTGVNISIEQFSELFNHEKIVGVKYTAPNFFLLERIRK
NANA_LACPL       DYYNEILK-DVDNKLLIYSIPALTGVALTTDQFAELFENPKIIGIKYTNADFYLLERVRN
NANA_ECOLI       DHYRAIIDSADGLPMVVYNIPALSGVKLTLDQINTLVTLPGVGALKQTSGDLYQMEQIRR
NANA1_ECOL6      DHYRAIIDSADGLPMVVYNIPALSGVKLTLDQIDTLVTLPGVGALKQTSGDLYQMEQIRR
NANA_SALTI       DHYRAIIDSADGLPMVVYNIPALSGVKLTLDQINTLVTLPGVNALKQTSGDLFQMEQIRR
NANA_SALTY       DHYRAIIDSADGLPMVVYNIPALSGVKLTLDQINTLVTLPGVSALKQTSGDLFQMEQIRR
NANA2_ECOL6      IHYRKIIDSADGLPMVVYNIPALSGVRFSLDQINELVTIPRVCALKQTSGDLFQMEQIKR
NANA_RHIME       AHYRELAD-VSALPLIVYNFPARTS-GFTLPELVELLSHPNIIGIKHTSSDMFQLERIRH
                  :*  :        :::* :*  :.  :   ::  *     : .:* *  ::: :*:::.

NANA_HAEIN       AYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLAEALEIQHVT
NANA_PASMU       AYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTQAGKLKEALEIQHVT
NANA_FUSNN       AFPDKLIFAGFDEMLLPATVLGVDGAIGSTYNINGIRAKQIFELAKNSKIDEALKIQHTT
NANA_CLOPE       AFPDKLIFAGFDEMMLPATVLGVDGAIGSTFNVNGVRARQIFEAAQKGDIETALEVQHVT
NANA_STAAM       AFPDKLILSGFDEMLVQATISGVDGAIGSTYNVNGRRARKIFDLARQGQIQEAYQLQHDS
NANA_STAAW       AFPDKLILSGFDEMLVQATISGVDGAIGSTYNVNGRRARKIFDLARQGQIQEAYQLQHDS
NANA_LACPL       AFPDKLILSGFDEMLLPALALNVDGCIGSTYNLNAPRVREEMDAFEAGDIDKARQLQNIS
NANA_ECOLI       EHPDLVLYNGYDEIFASGLLAGADGGIGSTYNIMGWRYQGIVKALKEGDIQTAQKLQTEC
NANA1_ECOL6      EHPDLVLYNGYDEIFASGLLAGADGGIGSTYNIMGWRYQGIVKALKEGDIQTAQKLQTEC
NANA_SALTI       AHPDLVLYNGYDEIFASGLLAGADGGIGSTYNIMGWRYQGIVQALREGDVAKAQRLQTEC
NANA_SALTY       AHPDLVLYNGYDEIFASGLLAGADGGIGSTYNIMGWRYQGIVQALREGDVAKAQRLQTEC
NANA2_ECOL6      NHPELVLYNGYDEIFASGLIAGADGGIGSTYNIMGWRYLEIFEAVKNNDVIKAKEMQVAC
NANA_RHIME       AVPDAIVYNGYDEMCLAGFAMGAQGAIGTTYNFMGDLFVALRDCAAAGRIEEARRLQAMA
                   *: ::  *:**:   .   ..:* **:*:*. .       .    . :  * .:*   

NANA_HAEIN       NDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATEEQLAKAKDLKAKFLS-----
NANA_PASMU       NDLIEGILANGLYLTIKELLKLDGVEAGYCREPMTKELSPEKVAFAKELKAKYLS-----
NANA_FUSNN       NDLIEGILSNGLYQTIKEILKLEGVDAGYCRKPM-KKISQKQIEFAKELHKKFLKN----
NANA_CLOPE       NDLITDILNNGLYQTIKLILQEQGVDAGYCRQPM-KEATEEMIAKAKEINKKYF------
NANA_STAAM       NDIIETVLSMGIYPTLKEILRHRDIDAGLPKRPF-KPFNEAHRQTLDQLIAKYDL-----
NANA_STAAW       NDIIETVLSMGIYPTLKEILRHRGIDAGLPKRPF-KPFNEAHRQTLDQLIAKYDL-----
NANA_LACPL       NDMITDLIANDIYPTLKLVMKHMGVDAGYVKKPM-SHPTPEMEAGATAIYEKYFKN----
NANA_ECOLI       NKVIDLLIKTGVFRGLKTVLHYMDVVSVPLCRKPFGPVDEKYLPELKALAQQLMQERG--
NANA1_ECOL6      NKVIDLLIKTGVFRGLKTVLHYMDVVSVPLCRKPFGPVDEKYLPELKALAQQLMQERG--
NANA_SALTI       NKVIDLLIKTGVFRGLKTVLHYMDVVSVPLCRKPFAPVDEKYLPALKALAQQLMEEKA--
NANA_SALTY       NKVIDLLIKTGVFRGLKTVLHYMDVVSVPLCRKPFAPVDEKYLPALKALAQQLMEEKA--
NANA2_ECOL6      NQVIDTLIQSGVLAGIKTLLYYMGIINTPVCRSPFSPVKEKNLDVLSKLAERLFEEHDRN
NANA_RHIME       NRVIQVLIKVGVMPGSKALLGIMGLPGGP-SRRPFRKVEEADLAALREAVAPVLAWREST
                 * :*  ::  .:    * ::   .:      .                            

NANA_HAEIN       ------
NANA_PASMU       ------
NANA_FUSNN       ------
NANA_CLOPE       ------
NANA_STAAM       ------
NANA_STAAW       ------
NANA_LACPL       ------
NANA_ECOLI       ------
NANA1_ECOL6      ------
NANA_SALTI       ------
NANA_SALTY       ------
NANA2_ECOL6      KKMKII
NANA_RHIME       SRKSM-