CLUSTAL format seed alignment for MF_01241

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NAGB_BACHD      ----MKIIEAKHFDDMSLKAAQFMIEKIQRDP-----TITLGLATGGTPQKMYELLINDH
NAGB_OCEIH      ----MKIIQTENYQSMSKLASQHVINTIKQLN-----KPVLGLATGSTPEGLYQHLIKAY
NAGB_BACSU      ----MKVMECQTYEELSQIAARITADTIKEKP-----DAVLGLATGGTPEGTYRQLIRLH
NAGB_CLOPE      ----MRLIVTKNYEEMSKVAAKEMAEDIKRNP-----EIVLGLATGGTPVGMYKELIRMY
NAGB_CLOTE      ----MKVLIKDNYDELSEVAALEILELIDKKP-----DCVLGLATGSTPVGTYQKLIEYY
NAGB_CALS4      ----MKVMIVRDYDEMSRRAAEIVKEQILKKP-----DTVLGLATGSTPLGMYKYLIEMH
NAGB_CLOAB      ----MKIVTVNDYDEMSKFAAKIIASQIILKE-----NSVLGLATGGTPLGMYKELINLY
GAMA_BACSU      ----MKILIAEHYEELCKLSAAIIKEQIQAKK-----DAVLGLATGSTPVGLYKQLISDY
NAGB_LACLA      ----MKVIVVKNQLEGGKIGLDLLKKSMANG------AKTLGLATGSTPVEFYNQIV---
NAGB_LACPL      ----MKVIVVKDQAAGGKEGFKVFKNALDNG------AKVFGLATGSTPVTTYKEIV---
NAGB_STRP3      ----MKIIRVQDQIEGGKIAFTLLKDSLAKG------AKTLGLATGSSPISFYQEMV---
NAGB_STRP8      ----MKIIRVQDQIEGGKIAFTLLKDSLAKG------AKTLGLATGSSPISFYQEMV---
NAGB_STRP1      ----MKIIRVQDQIEGGKIAFTLLKDSLAKG------AKTLGLATGSSPISFYQEMV---
NAGB_STRA3      ----MRVITVKNDIEGGKIAFTLLEEKMKAG------AQTLGLATGSSPITFYEEIV---
NAGB_STRPN      ----MKVIKVENQVQGGKVAFEILKEKLANG------AQTLGLATGSSPLEFYKEIV---
NAGB_STRR6      ----MKVIKVENQVQGGKVAFEILKEKLANG------AQTLGLATGSSPLEFYKEIV---
NAGB_STRMU      ----MKTIKVKNKTEGSKVAFRMLEEEITFG------AKTLGLATGSTPLELYKEIR---
NAGB_ENTFA      ----MQIIRVANAEEGGKKAFELIKEGMNNG------AKVLGLATGSTPETLYKEMT---
NAGB_LISIN      ----MQLITTENKLAGSKKALEIIEKGITSGE-----VNTLGLATGSTPETLYAELV---
NAGB_LISMO      ----MQLITTENKLAGSKKALEIIEKGITSGE-----VNTLGLATGSTPETLYAELV---
NAGB_STAAM      ----MKVLNLGSKKQASFYVACELYKEMAFNQ-----HCKLGLATGGTMTDLYEQLVKLL
NAGB_STAES      ----MKIINLDSKNLASFYVACELFKQIQQHP-----HAKLGLATGGTMTDVYHYLVNLL
NAGB_MYCPE      MNNNINFIKCSSYEELSKKTANDFITVIKNKP-----NSVLGLATGSSPMGVYKELIKAY
NAGB_MYCPU      ---MREIYIFKDLQDLHKFSAKQIIDQIKIKK-----DSTLGFATGKTPLKTYQLLVKDH
NAGB_ECOLI      ----MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMH
NAGB_SHIFL      ----MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMH
NAGB_ECOL6      ----MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMH
NAGB_SALTI      ----MRLIPLSTAEQVGKWAARHIVNRINAFKPTTDRPFVLGLPTGGTPLTAYKALVEMH
NAGB_SALTY      ----MRLIPLSTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPLTAYKALVEMH
NAGB_YERPE      ----MRLIPLRNTAEVGKWAARHIVNRINAFKPTAERPFILGLPTGGTPMEAYKYLIAMH
NAGB_HAEIN      ----MRFIPLQTEQQVSCWAAQHIINRINDFKPTAERPFVLGLPTGGTPLKTYQELIRLY
NAGB_PASMU      ----MRLIPLHNVDQVAKWSARYIVDRINQFQPTEARPFVLGLPTGGTPLKTYEALIELY
NAGB_VIBCH      ----MRLIPLKAAAQVGKWAAAHIVKRINEFQPTAERPFVLGLPTGGTPLATYKALIEMH
NAGB_VIBVU      ----MRLIPLKTAAQVGKWAAAHIAKRINDFQPTAERPFVLGLPTGGTPLATYKALIELY
NAGB_VIBPA      ----MRLIPLTRAAQVGKWAAAHIAKRINDFKPTAERPFVLGLPTGGTPLATYKALIELY
NAGB_BORBU      ----MRLIIRPTYEDISKWAANHVAQKINEFSPTKENPFILGLPTGSSPIGMYKNLIELN
NAGB_BACTN      ----MRLIIQPDYQSVSQWAAHYVAAKIKAANPTPEKPFVLGCPTGSSPLGMYKALIDLN
NAGB_FUSNN      ----MRFIVTGN-KRAADWGAVYIVKKIKEFNPSPEKKFVLGLPTGSTPLQMYKRLIQFN
NAGB_STRAW      ----MEVVIVPDARAGGELIAEAMAQLLGRKP-----EALLGVATGSTPLPIYEALAAQV
NAGB_STRCO      ----MEVVIVPDAKAGGELIAEAMAQLLRRKP-----DALLGVATGSTPLPVYEALAAKV
NAGB_BIFLO      ---MPEIIIVKNEAEAGEIYGRCVADLIKAKP-----DAVLGLATGSSPLAAYQALAKIV
NAGB_COREF      ----MDIIIRADAQEVGKEAAAIMAPFIKQ-------GRTIGLATGSSPLTTYRELIRMY
NAGB_CORGL      ----MDIIICKDEQEVGKAAAALIAPFATK-------GGTLGLATGSSPLSTYQELIRMY
                                                        :* .** :    *  :    

NAGB_BACHD      RTNGTSYHQVTTFNLDEYIGLDRH-DPNSYYTYMHKALFDHID-IRDEQAFLP---NGTA
NAGB_OCEIH      RMHQISFANVSTFNLDEYVGLHKE-DKNSYHYYMQKFLFNHVD-IPYKNIHLP---NGIA
NAGB_BACSU      QTENLSFQNITTVNLDEYAGLSSD-DPNSYHFYMNDRFFQHID-SKPSRHFIP---NGNA
NAGB_CLOPE      NEGELDFSKVTSINLDEYVGLSGD-HDQSYRYFMNTNLFNHIN-IDKNNTFVP---NGLA
NAGB_CLOTE      KKGKVDFSKVTSFNLDEYRGLNGE-HPQSYKFFMNNTLFNHIN-IDKKNTFIL---DGLS
NAGB_CALS4      KNGEIDFSNVITFNLDEYIGLSPD-HPQSYHYFMYENLFNHIN-IKKENIHIP---NGVA
NAGB_CLOAB      NKENLNFSKVQTFNLDEYYGVSDD-NPQSYHYYMKNNFFKFTN-IKNENINIL---DGTT
GAMA_BACSU      QAGEIDFSKVTTFNLDEYAGLSPS-HPQSYNHFMHEHLFQHIN-MQPDHIHIP---QGDN
NAGB_LACLA      -NSDLDFTDMVSVNLDEYVGLDGS-NDQSYRYFMTKHLFGEKP-FKEN--FLP---NGKA
NAGB_LACPL      -NSDLDFSDCTSVNLDEYVGIAPD-NDQSYKYFMQTHLFNDKP-FKES--FLP---NGLA
NAGB_STRP3      -KSPLDFSDLTSINLDEYVGLSVE-SDQSYDYFMRQNLFNAKP-FKKN--YLP---NGLA
NAGB_STRP8      -KSPLDFSDLTSINLDEYVGLSVE-SDQSYDYFMRQNLFNAKP-FKKN--YLP---NGLA
NAGB_STRP1      -KSPLDFSDLTSINLDEYVGLSVE-SDQSYDYFMRQNLFNAKP-FKKN--YLP---NGLA
NAGB_STRA3      -KSNLDFSNMVSINLDEYVGIAAS-NDQSYSYFMHKHLFDAKP-FKEN--NLP---NGLA
NAGB_STRPN      -ESDLDFSNLTSVNLDEYVGLDGD-NPQSYRYFMQENLFNQKP-FKES--FLP---RGVK
NAGB_STRR6      -ESNLDFSNLTSVNLDEYVGLDGD-NPQSYRYFMQENLFNQKP-FKES--FLP---RGVK
NAGB_STRMU      -ESHLDFSDMVSINLDEYVGLSAD-DKQSYAYFMKQNLFAAKP-FKKS--YLP---NGLA
NAGB_ENTFA      -ASDVDFTEMTSVNLDEYVGLGGE-DEQSYRYFMNKHLFDKKP-FKET--FVP---NGKA
NAGB_LISIN      -KSDVDTKNVTTTNLDEYVGLAAD-DPNSYHYYMNDLLFSKKA-FKES--FLP---NGEA
NAGB_LISMO      -KSDVDTKNVTTTNLDEYVGLAAS-DPNSYHYYMNDLLFSKKA-FKES--FLP---NGEA
NAGB_STAAM      NKNQLNVDNVSTFNLDEYVGLTAS-HPQSYHYYMDDMLFKQYPYFNRKNIHIP---NGDA
NAGB_STAES      IKNKVDVSQVETFNLDEYVGLKAS-HQQSYHTYMNKVLFEQYPHFVKNHIHIP---DGLS
NAGB_MYCPE      ENKEISFRDCVSFNLDEYIGLKKEYEDQTYKYFMNDNLFSKIDINKDNTFFPI---DAFS
NAGB_MYCPU      QENKTSWKDITSFNLDEFVDIDPS-HPESFIKQMKSNLFDHLDINEQK-INIP---KSNS
NAGB_ECOLI      KAGQVSFKHVVTFNMDEYVGLPKE-HPESYYSFMHRNFFDHVDIPAENINLL----NGNA
NAGB_SHIFL      KAGQVSFKHVVTFNMDEYVGLPKE-HPESYYSFMHRNFFDHVDIPAENINLL----NGNA
NAGB_ECOL6      KAGQVSFKHVVTFNMDEYVGLPKE-HPESYYSFMHRNFFDHVDIPAENINLL----NGNA
NAGB_SALTI      KAGEVSFKHVVTFNMDEYVGLPKE-HPESYHSFMHRNFFDHVDIPAENINLL----NGNA
NAGB_SALTY      KAGEVSFKHVVTFNMDEYVGLPKE-HPESYHSFMHRNFFDHVDIPAENINLL----NGNA
NAGB_YERPE      KAGEVSFKHVVTFNMDEYVGLPKE-HPESYYTFMHTNFFDHVDIPAENINLL----NGNA
NAGB_HAEIN      QAGKVSFKHVVTFNMDEYVALPEE-HPESYHSFMYNNFFNHIDILPENINIL----NGNT
NAGB_PASMU      KAGEVSFKHVVTFNMDEYVGLPKE-HPESYHSFMYKNFFDHVDIQEKNINIL----NGNT
NAGB_VIBCH      KAGEVSFKHVVTFNMDEYVGLAAD-HPESYRSFMYNNFFNHIDIQEENINLL----NGNT
NAGB_VIBVU      QEGKVSFKHVVTFNMDEYVGISAD-HPESYRSFMYNNFFNHIDIQEENINLL----NGNA
NAGB_VIBPA      QAGEVSFKHVVTFNMDEYIGIPAD-HPESYRSFMYNNFFNHIDIQEENINLL----NGNT
NAGB_BORBU      KNKKISFQNVITFNMDEYIGIEEN-HPESYHSFMWNNFFSHIDIKKENINIL----NGNA
NAGB_BACTN      KKGIVSFQNVVTFNMDEYVGLPKE-HPESYYSFMWNNFFSHIDIKKENTNIL----NGNA
NAGB_FUSNN      KEGIISFKNVITFNMDEYVGLPKT-HPQSYHYYMYNNFFNHIDIDKENVNIL----NGMA
NAGB_STRAW      KSGAVDASRARIAQLDEYVGLPAE-HPESYRSVLRREVLEPLGLGMDAFMGP----DGTA
NAGB_STRCO      RSGAVDTAQARIAQLDEYVGLPAE-HPESYRSVLRREVLEPLGIDMDAFMGP----DGTA
NAGB_BIFLO      KDEAIDVSGVRGFALDEYIGLPLT-HPESYHATIHRTVVEPLGLDPAKVHVPGDVLNGTP
NAGB_COREF      ESGELTFKTIQAFLLDEYVGLARD-DKNSYFRTIRDEFTAHVDFVDANVHSP----DSTD
NAGB_CORGL      EAGEVSFKNCKAFLLDEYVGLTRD-DENSYFKTIRKEFTDHIDIVDEEVYSP----DGAN
                              :**:  :      :::   :   .                   .  

NAGB_BACHD      SN----FNAECERYEALIQQRGGIDLQVLGIGANGHIGFNEPGTSFESSTHIVKLTDSTR
NAGB_OCEIH      KD----LSVECTSYEDRIQQAGGIHIQVLGIGRNGHIGFNEPGTSFESQTHVVDLDESTR
NAGB_BACSU      DD----LEAECRRYEQLVDSLGDTDIQLLGIGRNGHIGFNEPGTSFKSRTHVVTLNEQTR
NAGB_CLOPE      EN----VEEECMAYDSRIQDMGGIDLQLLGLGANGHIGFNEPGEALSVGTHLTDLKESTI
NAGB_CLOTE      ND----IEKECIEYDKKIDNKGGIDLQILGIGGNGHIGFNEPSEELSISTHLTKLKTKTI
NAGB_CALS4      ED----LEEECKRYEREIRRIGRIDLQILGIGVNGHIGFNEPDESIETKTHIVTLTEETI
NAGB_CLOAB      SD----IENECKSYDNKILSSGGIDIQVLGIGENGHIGFNEPDINFEAKTHLVKLDEKTI
GAMA_BACSU      PQ----LEAACKVYEDLIRQAGGIDVQILGIGANGHIGFNEPGSDFEDRTRVVKLSESTI
NAGB_LACLA      AD----LEAEAKHYDQIIEEN-PIDWQILGIGQNGHIGFNEPGTPAEITTHVVDLQESTI
NAGB_LACPL      SD----PEAEVKRYDKVIDEH-PIDLQILGIGRNGHIGFNEPGTPRDITTHVVDLTESTI
NAGB_STRP3      TD----IEAEAKRYDQIIAEH-PIDFQVLGIGRNGHIGFNEPGTSFEEETHVVDLQESTI
NAGB_STRP8      TN----IEAEAKRYDQIIAEH-PIDFQVLGIGRNGHIGFNEPGTSFKEETHVVDLQESTI
NAGB_STRP1      TD----VEAEAKRYNQIIAEH-PIDFQVLGIGRNGHIGFNEPGTSFEEETHVVDLQESTI
NAGB_STRA3      KD----LKEEIKRYDAVINAN-PIDFQILGIGRNGHIGFNEPGTPFDITTHVVDLAPSTI
NAGB_STRPN      DN----AEAEVERYNQILADH-PVDLQILGIGRNGHIGFNEPGTPFDSQTHLVELDQSTI
NAGB_STRR6      DN----AEAEVERYNQILADH-PVDLQILGIGRNGHIGFNEPGTPFDSQTHLVELDQSTI
NAGB_STRMU      AD----LAKETEYYDQILAQY-PIDLQILGIGRNAHIGFNEPGTAFSSQTHLVDLTPSTI
NAGB_ENTFA      ED----LDAASAEYEKIIDAH-PVDIQILGIGQNGHIGFNEPGTPLDSLTHVVELTESTI
NAGB_LISIN      TD----AEAECARYEGILSEH-PIDIQVLGIGTNGHIGFNEPGTSFDSLTHKVVLTDSTR
NAGB_LISMO      TD----AEAECARYEEILSEH-PIDIQVLGIGTNGHIGFNEPGTSFDSITHKVVLTDSTR
NAGB_STAAM      DD----MNAEASKYNDVLEQQGQRDIQILGIGENGHIGFNEPGTPFDSVTHIVDLTESTI
NAGB_STAES      EN----LEAEAERYNNLLDERGPIDIQILGIGENGHIGFNEPGTDFNSETHVVNLTESTI
NAGB_MYCPE      TN----MNQDFESYDSKIDSYNGLDILILGIGNNGHIGFNEPGSLIDSKTRMIDLTESTI
NAGB_MYCPU      SN----PDQEALNYENKIRKNNGIDLQFISIGVNGHIAYNEPGTPKDSLTHVSNLTKETI
NAGB_ECOLI      PD----IDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTR
NAGB_SHIFL      PD----IDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTR
NAGB_ECOL6      PD----IEAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTR
NAGB_SALTI      PD----IDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTR
NAGB_SALTY      PD----IDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTR
NAGB_YERPE      AD----IDAECRRYEEKIKSYGKIHLFMGGVGVDGHIAFNEPASSLASRTRIKTLTQETR
NAGB_HAEIN      DD----HNAECRRYEEKIKSYGKIHLFMGGVGVDGHIAFNEPASSLSSRTRIKTLTQDTL
NAGB_PASMU      ED----HDAECQRYEEKIKSYGKIHLFMGGVGVDGHIAFNEPASSLSSRTRIKTLTEDTL
NAGB_VIBCH      DD----HEAECKRYEDKIKSYGKINLFMGGVGNDGHIAFNEPASSLSSRTRIKTLTEDTR
NAGB_VIBVU      ED----HEAECQRYEDKIKSYGRINLFMGGVGNDGHIAFNEPASSLSSRTRIKTLTEDTR
NAGB_VIBPA      DN----HEAECKRYEDKIKSYGKINLFMGGVGNDGHIAFNEPASSLSSRTRIKTLTEDTR
NAGB_BORBU      SN----LKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIKTLTQDTI
NAGB_BACTN      PD----LDAECARYEEKIKSYGGIDLFMGGIGPDGHIAFNEPGSSLTSRTRQKTLTTDTI
NAGB_FUSNN      KN----YKEECRKYEEKILEVGGIDLFLGGVGVDGHIAFNEPGSSFKSRTREKQLTEDTI
NAGB_STRAW      ED----VQGACEAYDKALAAAGGVDLQLLGIGTDGHIGFNEPCSSLASRTRIKTLTEQTR
NAGB_STRCO      AD----VQAACEAYDTALGGSGGVDLQLLGIGTDGHIGFNEPCSSLASRTRIKTLTEQTR
NAGB_BIFLO      LEDGDKVALAGPAYDRAIEAAGGIDVQILGIGTDGHVGFNEPGSSLASGTRVKTLAEQTR
NAGB_COREF      PD----PYHAAALYEQKIIDTG-VAIQLLGVGVNGHIGFNEPTSALQGPTKVQALHPQTI
NAGB_CORGL      PD----PYEAAAEYEAKIAAES-VDVQILGIGGNGHIAFNEPSSSLSGLTKVQALHPKTV
                 :           *:  :         . .:* :.*:.:***       *:   *  .* 

NAGB_BACHD      EA--NARYFNDL-SEVPTEAITMGIQSIMN-AKEILLLASGKKKADALYQLIHGK-VDES
NAGB_OCEIH      NA--NARFFDSI-DEVPNQAITMGIQSIMR-AKEILLLVSGSEKAEALEKLVNGN-VSEE
NAGB_BACSU      QA--NARYFPSI-DSVPKKALTMGIQTILS-SKRILLLISGKSKAEAVRKLLEGN-ISED
NAGB_CLOPE      EA--NARFFDSI-DDVPRKAITMGLGGIMK-AKKIMVIASGEGKAEVVKAMMSGK-ITTE
NAGB_CLOTE      KD--NSRFFNSE-EEVPTEAITMGIGSIMK-ARKIILLINGEVKAEIVKKLINGN-VSTK
NAGB_CALS4      NA--NKRFFKSI-EEVPRRAITMGLSSIMK-ARKIMLLASGSNKAKAIKETLKGR-LTTK
NAGB_CLOAB      EA--NSRFFNSK-NEVPTSALSMGIKTIMQ-SKKILLLANGEKKAEAIFKMVNGK-ISPE
GAMA_BACSU      QA--NARFFGGDPVLVPRLAISMGIKTIMEFSKHIVLLASGEEKADAIQKMAEGP-VTTD
NAGB_LACLA      KA--NARFFESE-ADVPRKAISMGLASIMK-SKNIVLMAYGKEKAEAIKGMVEGE-VTTE
NAGB_LACPL      EA--NARFFASE-NDVPKQAFSMGLASIMK-SKHLLLEAFGENKADAVKGMIEGP-DTPE
NAGB_STRP3      EA--NSRFFTSI-EDVPKQAISMGIASIMK-SKMIVLLAFGQEKADAIKGMVFGP-ITED
NAGB_STRP8      EA--NSRFFTSI-EDVPKQAISMGIASIMK-SKMIVLLAFGQEKADAIKGMVFGP-ITED
NAGB_STRP1      EA--NSRFFTSI-EDVPKQAISMGIASIMK-SEMIVLLAFGQEKADAIKGMVFGP-ITEH
NAGB_STRA3      EA--NSRFFNSI-DDVPKQALSMGIGSIMK-SKTIVLVAYGIEKAEAIASMIKGP-ITED
NAGB_STRPN      EA--NARFFAKI-EDVPTQAISMGIKNILD-AKSIILFAYGESKAEAIAGTVSGP-VTEN
NAGB_STRR6      EA--NARFFAKI-EDVPTQAISMGIKNILD-AKSIILFAYGESKAEAIAGTVSGP-VTEN
NAGB_STRMU      AA--NSRFFEKA-EDVPKQAISMGLASIMS-AKMILLMAFGEEKAEAVAAMVKGP-VTEE
NAGB_ENTFA      NA--NKRYFDKV-EDVPTRAVSMGIGSIMK-GKKMILMAYGEAKAEAIKGMIDGP-VTTD
NAGB_LISIN      EA--NKRFFERE-EDVPTHAYSMGIKSIMN-AKKIILLAFGENKAQAIKETIKGP-VDVN
NAGB_LISMO      EA--NKRFFERE-EDVPTHAYSMGIKSIMN-AKKIILLAFGENKAQAIKETIKGP-VDVN
NAGB_STAAM      KA--NSRYFKNE-DDVPKQAISMGLANILQ-AKRIILLAFGEKKRAAITHLLNQE-ISVD
NAGB_STAES      KA--NSRFFDNE-KDVPRQAVSMGVKSILK-AKRIILLAFGPKKKEAISKLLNEQ-VTED
NAGB_MYCPE      KA--NSRFFKSE-NDVPRKSVTMGLSTILK-AKKIVLVVVGDSKKEALNALMNSKSFDSN
NAGB_MYCPU      LDLIAKNKFSSI-DEVPKKAITMGVKTILNQCKKIMMVSFGKEKAQVTKQMLEDK-PNEN
NAGB_ECOLI      VA--NSRFFDNDVNQVPKYALTVGVGTLLD-AEEVMILVLGSQKALALQAAVEGC-VNHM
NAGB_SHIFL      VA--NSRFFDNDVNQVPKYALTVGVGTLLD-AEEVMIMVLGSQKALALQAAVEGC-VNHM
NAGB_ECOL6      VA--NSRFFDNDVNQVPKYALTVGVGTLLD-AEEVMILVLGSQKALALQAAVEGC-VNHM
NAGB_SALTI      VA--NSRFFDGDVNQVPKYALTVGVGTLLD-AEEVMILVLGHQKAQALQAAVEGN-VNHM
NAGB_SALTY      VA--NSRFFDGDVNQVPKYALTVGVGTLLD-AEEVMILVLGHQKAQALQAAVEGN-VNHM
NAGB_YERPE      IA--NSRFFGGDANLVPKYALTVGVGTLLD-AEEVMILVTGHGKAQALQAAVEGS-INHM
NAGB_HAEIN      IA--NSRFFNNDVTQVPKYALTIGVGTLLD-AEEVMILATGHQKALAVQAAVEGS-INHL
NAGB_PASMU      IA--NSRFFDNDVNKVPKYALTIGVGTLLD-AEEVMILVTGYNKAQALQAAVEGS-INHL
NAGB_VIBCH      IA--NSRFFDGDINQVPKYALTIGVGTLLD-AQEIMILVTGHNKALALQAAVEGS-VNHL
NAGB_VIBVU      IA--NSRFFDGDINQVPKYALTIGVGTLLD-SQEIMILVTGHNKALALEAAVEGS-VNHL
NAGB_VIBPA      IA--NSRFFDGDINQVPKYALTIGVGTLLD-AEEVMILVTGHNKALALEAAVEGC-VNHL
NAGB_BORBU      IA--NSRFFEGDVNKVPKNALTVGIGTIMD-SQEVLIIVNGHNKARALKHAIEKG-VNHM
NAGB_BACTN      IA--NSRFFDNDINKVPKTALTVGVGTVLS-AKEVMIIVNGHNKARALYHAVEGS-ITQM
NAGB_FUSNN      IV--NSRFFNNDITKVPQSALTVGVSTIMD-AKEVLIMVEGNNKARALHMGIEEG-INHM
NAGB_STRAW      VD--NARFFDGDIEQVPHHVITQGIGTILE-ARHLVLLATGEGKADAVAATVEGP-VAAV
NAGB_STRCO      ID--NARFFDGDIEQVPHHVITQGIGTILE-ARHVVLLATGEGKADAVAASVEGP-VAAV
NAGB_BIFLO      ID--NARFFDNDINQVPTHCITQGIGTIMK-ARHLVLLAFGAGKAEAIEETVEGG-VSAF
NAGB_COREF      KD--NARFFNDCIENVPTHAMTQGLGTITR-AENIIMVATGEAKADAIHRIVEGP-LTAL
NAGB_CORGL      ED--NARFFNT-IEEVPTHALTQGLGTLSR-AQNIVLVATGEGKADAIRGTVEGP-LTAM
                      . *      **    : *:  :    . :::   *  *                

NAGB_BACHD      FPASVLQRHEQVTIIADREALQKVAVSSN-----------------------
NAGB_OCEIH      FPASILQTHQNVKIIADKAALQDISYHHFSETM-------------------
NAGB_BACSU      FPASALHLHSDVTVLIDREAASLRP---------------------------
NAGB_CLOPE      IPATMLQMHRDVILIVDEDAAKLLK---------------------------
NAGB_CLOTE      VPASLLHLHPNCTVILDKEAAKFI----------------------------
NAGB_CALS4      VPSTVLALHPDVTIIIDKRAASLLTDEELANVELID----------------
NAGB_CLOAB      VPASILQLHNDTTIIIDKAAAKML----------------------------
GAMA_BACSU      VPASILQKHNHVTVIADYKAAQKLKSASFS----------------------
NAGB_LACLA      LPASILQNHANVTVIADEAAVSLLSK--------------------------
NAGB_LACPL      LPASILQNHPDVTVIIDEAAASKLSKKY------------------------
NAGB_STRP3      LPASILQKHDHVIVIVDEAAASQLD---------------------------
NAGB_STRP8      LPASILQKHDHVIVIVDEAAASQLD---------------------------
NAGB_STRP1      LPASILQKHDHVIVIVDEAAASQLD---------------------------
NAGB_STRA3      MPASILQKHDDVVIIVDEAAASKL----------------------------
NAGB_STRPN      LPASSLQNHPDVTIIADAEALSLL----------------------------
NAGB_STRR6      LPASSLQNHPDVTIIADAEALSLLEK--------------------------
NAGB_STRMU      IPASILQTHPKVILIVDEKAGAGI----------------------------
NAGB_ENTFA      MPASALQNHQDVVVIIDDAAASKL----------------------------
NAGB_LISIN      CPASVLQNHPDVTVILDNEAASLL----------------------------
NAGB_LISMO      CPASVLQNHPDVTVILDNEAASLL----------------------------
NAGB_STAAM      VPATLLHKHPNVEIYLDDEACPKNVAKIHVDEMD------------------
NAGB_STAES      VPATILHTHPNVEVYVDDEAAPDCL---------------------------
NAGB_MYCPE      WPCTALVNHDNVVVYYIG----------------------------------
NAGB_MYCPU      VTASFLQEHPNCIYILDKEAASLLNEETLKKAKWI-----------------
NAGB_ECOLI      WTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL---------
NAGB_SHIFL      WTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL---------
NAGB_ECOL6      WTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL---------
NAGB_SALTI      WTISCLQLHPKAVVVCDEPSTMELKVKTLKYFNELEAENIKGL---------
NAGB_SALTY      WTISCLQLHPKAVVVCDEPSTMELKVKTLKYFNELEAENIKGL---------
NAGB_YERPE      WTISCLQLHAKAIMVCDEPSTMELKVKTVKYFRELEAENVKDL---------
NAGB_HAEIN      WTVSALQMHRHFLLVCDEAAQQELKVKTVKYFTELEGAVAGTDYQDK-----
NAGB_PASMU      WTVTALQMHRRAIIVCDEPATQELKVKTVKYFTELEASAIRSVK--------
NAGB_VIBCH      WTVSALQLHPKAVIVCDEPSTQELKVKTVKYFTELEAKNIVGF---------
NAGB_VIBVU      WTVSALQLHPKSVIVCDEPSTQELKVKTVKYFTELEAKNIVGF---------
NAGB_VIBPA      WTVSALQLHPKAVIVCDEPSQQELKVKTVKYFSELEAENIKGF---------
NAGB_BORBU      WTISALQLHKNAIIVSDKNATYELKVGTVEYFNDIERKNFNNDLK-------
NAGB_BACTN      WTISALQMHEKGIIVCDDAATEELKVGTYRYFKDIEAGHLDPESLIK-----
NAGB_FUSNN      WTISALQLHEKAIIVADEDACAELKVATYKYYKDIEKKNYNIDKLIENLYKK
NAGB_STRAW      CPASALQLHPHATVVVDDAAASKLKLADYFRHTYAGKPDWQGI---------
NAGB_STRCO      CPASALQLHPHATVVVDEAAASKLKLADYFRHTYAHKPDWQGI---------
NAGB_BIFLO      CPASALQMHPHATIIVDEEAASRLRHKDYYRYAYTHKPAWQGI---------
NAGB_COREF      CPGSVLQLHADVTIVVDEAAASKLEHADYYRTMERIRL--------------
NAGB_CORGL      CPGSILQMHNNATIIVDEAAASKLENADHYRLMEQLKLR-------------
                 . : *  *