CLUSTAL format seed alignment for MF_01250

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PPAX_BACHK      ---MKINTVLFDLDGTLINTNELIISSFLHTLHTYYPNQ-YKREDVLPFIGPSLHDTFSK
PPAX_BACC1      ---MKINTVLFDLDGTLINTNELIISSFLHTLHTYYPNQ-YKREDVLPFIGPSLHDTFSK
PPAX_BACAN      ---MKINTVLFDLDGTLINTNELIISSFLHTLHTYYPNQ-YKREDVLPFIGPSLHDTFSK
PPAX_BACCR      ---MRINTVLFDLDGTLINTNELIISSFLHTLNTYYPNQ-YKREDVLPFIGPSLHDTFSK
PPAX_BACHD      ---MEINTVLFDLDGTLINTNELIISSFLHTFETYYPGK-YGRKDAIECIGPPLTDSFKR
PPAX_LISMF      MTGK-ITTLLFDLDGTLINTNELIIKTFQVTFQEFMPDRVFTREDILPFIGPSLMETFRE
PPAX_LISMO      MTGK-ITTLLFDLDGTLINTNELIIKTFQVTLQEFLPDRVFTREDILPFIGPSLMETFRE
PPAX_LISIN      MTGK-ITTLLFDLDGTLINTNELIIKTFQATLQEFLPDRVFTREDILPFIGPSLMETFRE
PPAX_BACSU      MSDKQVTTILFDLDGTLINTNELIIASFLHTLEHYYPSK-YKREDVLAFIGPSLFDTFSS
PPAX_OCEIH      ---MSIRTILFDLDGTLIDTNTLIKASFEHTFKEYNLNF--SNEEILKFNGPPLVDTFNK
PPAX_CLOPE      ----MIKAVLFDLDGTLINTNDLILKSFKHTFKTMLDLE-PSEEEITMNYGRPLQEIFKS
PPAX_CALS4      ---MKITAVLFDLDGTIIDTNQLIIKSFVYTVEKHLGYK-IGAEEVIPYFGEPLPLTLQR
                     : ::*******:*:** **  :*  *..          ::     * .*   :  

PPAX_BACHK      IDESKVEELITSYRQFNHDHHDELVEEYETVYETVQELKKQGYKVGIVTTKARQTVEMGL
PPAX_BACC1      IDESKVEELITSYRQFNHDHHDELVEEYETVYETVQELKKQGYKVGIVTTKARQTVEMGL
PPAX_BACAN      IDESKVEELITSYRQFNHDHHDELVEEYETVYETVQELKKQGYKVGIVTTKARQTVEMGL
PPAX_BACCR      IDESKVEEMITSYREFNHDHHDELVEEYETVYETVRELKKQGYKVGIVTTKARQTVEMGL
PPAX_BACHD      LDPERVEEMVATYRKHNHAHHDKLVEPYEGVYETVKTLHEQGFKLAIVTTKIRETAMKGL
PPAX_LISMF      INPAHADEMRAFYREYNLKHHDDLILEYDGVYEAIRALYEEDYKLGIVSTKMYDTIMRGL
PPAX_LISMO      INPAHADEMRAFYREYNLKHHDDLILEYDGVYEAIRALYEEDYKLGIVSTKMYDTIMRGL
PPAX_LISIN      INPAHAEEMRVFYREYNLKHHDDLILEYDGVYEAIRALYEEDYKLGIVSTKMYDTIMRGL
PPAX_BACSU      MDPDKCEDMIAMYRAYNHDMHDSLVTEYETVYETLDALKKAGFTLGIVTTKLRDTVNMGL
PPAX_OCEIH      IDETKADRMITTFREHNIREHDNFVTAFPHVYDTLEELQNRNISLGIVSTKMRHTVHMGL
PPAX_CLOPE      YDENRIEEMINCYRKINLELHDDECKEFADVDLMLKTLKSKGIKIGVVTSKKSDMAERGA
PPAX_CALS4      FSKDKWEIMLKTYRDYNEKYHDRYTKIREDVKEVLARLKEEGIKTAVVTSKRRELAKRGL
                 .  : : :   :*  *   **        *   :  * . . . .:*::*  .    * 

PPAX_BACHK      KLSKLDEFFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGT
PPAX_BACC1      KFSKLDEFFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGT
PPAX_BACAN      KLSKLDEFFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGT
PPAX_BACCR      QLSKLDEFFDVVVTIDDVEHVKPHPEPLQKALELLDAKPEEALMVGDNHHDIVGGQNAGT
PPAX_BACHD      KLFGLDEFFDVIVALDDVENVKPNPEPLEKAMNALGAKKEETIMVGDNSHDILGGKNAGV
PPAX_LISMF      KVTGLDKFFQVVIGLDQVSNAKPDPEGIEMALSLLNATKEEAIMIGDNYHDIEAGKNAET
PPAX_LISMO      KVTGLDKFFQVVIGLDQVSNAKPDPEGIEMALSLLNATKEEAIMIGDNYHDIEAGKNAET
PPAX_LISIN      KVTGLDKFFQVVIGLDQVSNAKPDPEGIEMALSLLNATKEEAIMIGDNYHDIEAGKNAET
PPAX_BACSU      KLTGIGEFFETVVTLDDVTNAKPDPEPVLLALKQLGSEPAEAIMVGDNYHDVLAGKNAGT
PPAX_OCEIH      ELTGISKFFSTIITYDDVTHAKPHPEPVQMAMQKLGAHPEHTLMVGDNHHDIVSGQRANV
PPAX_CLOPE      KLMGIFKYFDTFITPEITTKHKPDGEPVLKACENLGVSPSEALMVGDSPYDILAGKNAGA
PPAX_CALS4      KLFELDKYFDVLVGLEDTEKHKPEPDPVLKALELLKSPREEALMVGDSPYDILSARSAGV
                :.  : ::*...:  : . : **. : :  * . *     .::*:**. :*: ..: * .

PPAX_BACHK      KTAAVSWTLKGRAYLEAYKPDFMLDKMSDLLPILSDMNRS----
PPAX_BACC1      KTAAVSWTLKGRAYLEAYKPDFMLDKMSDLLPILSDMNRS----
PPAX_BACAN      KTAAVSWTLKGRAYLETYKPDFMLDKMSDLLLILSDMNRS----
PPAX_BACCR      KTAAVSWTLKGRAYLEAYKPDFMLDKMSDLLPILSNMNRS----
PPAX_BACHD      KTAVVGYAIRGEDYVRQFDPDYVLRSMPDLLDIVGVKAR-----
PPAX_LISMF      LTAGVAWAIKGPEHLAQFQPDFMLEKMSDLLAIVRDEE------
PPAX_LISMO      LTAGVAWAIKGPEHLAQFQPDFMLEKMSDLLAIVRDEE------
PPAX_LISIN      LTAGVAWAIKGPEHLAQFQPDFMLEKMSDLLAIVRDEE------
PPAX_BACSU      KTAGVAWTIKGPEMLAKHEPDFMLEKMSDLLQIVGVK-------
PPAX_OCEIH      QTAAVAWSLKDTNYLKSFHPDYIIEDIKDIITIVGDSFA-----
PPAX_CLOPE      KTCGVKYTALPLEKLGESNPDFYVDKPLEILDLVEKLNS-----
PPAX_CALS4      RSVAVKWSVLPFELLKKEKPDYFIEDMWQLLKIIKGCDEDEHEQ
                 :  * ::      :   .**: : .  ::: ::