CLUSTAL format seed alignment for MF_01251

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y1196_CLOPE       ----------------------------------------------MSENK---------
Y243_CLOB1        ----------------------------------------------MSNID---------
F5YKN1_TREPZ      -----------------------------------------MGSKILGRPE---------
F4LND7_TREBD      MARFRAACYTAAMKISQSEANAHPALSSARKKTGAHPTAAAAAAHLAARPAPPQSAAASA
E1R6S8_SEDSS      -------------------------------MTPVYSIGFLLYSSAMHKNH---------
F0RZU7_SPHGB      ------------------------------------------MKTYAPRFA---------
Q2FTR4_METHJ      -------------------------------------------MKHPKQPH---------
A2STY7_METLZ      -------------------------------------MPAITPGKITDQPH---------
B8GKX9_METPE      -------------------------------MDQVMKRDERCRGAGRPQPE---------
D1B6J9_THEAS      ----------------------------------------------MRAPR---------
M1PF01_DESSD      ---------------------------------------------MKPADP---------
D6Z0N8_DESAT      -----------------------------------------MRKNATPGSK---------
D8K057_DEHLB      ---------------------------------------MNHITDRSLVTF---------
C0QM91_DESAH      ------------------------------------------------------------
E4TIH6_CALNY      ------------------------------------------------------------
C6JJH8_FUSVA      ------------------------------------------------------------
E6W5W1_DESIS      ------------------------------------------------------------
Y332_THENN        ------------------------------------------------------------
Y1155_METJA       ------------------------------------------------------------
E1RE69_METP4      ------------------------------------------------------------
YGIQ_ECOLI        -----------------------MSSISLIQPDRDLFSWPQYWAACFGPAP---------
Y674_YERPE        ------------------------MSISLIQPERDLFSYQPYWAECYGTAP---------
Y4872_PSEPK       -----------------------------MQAAKPLYDYPKYWAECFGPAP---------
F1VZ76_9BURK      ------------------------------------------------------------
Y934_PORGI        ------------------------------------------MAKHHPLTD---------
F9Z7Z9_ODOSD      -------------------------------------------MNTTQTLQ---------
Q729D8_DESVH      -----------------------------------MQSDTLRFRTPLAQPR---------
E1QEN6_DESB2      -----------------------------------MKS---LHDQTLAQPP---------
C4XQA0_DESMR      -----------------------------------------MARTPLTQPD---------
C6BTQ5_DESAD      -------------------------------------MTKSIIAKKQPQPE---------
Q1JVX9_DESA6      ---------------------------------------MNDRSKNDNLTR---------
                                                                              

Y1196_CLOPE       --------------------FLPICKDDMIER-GWEQCDFVLVTADAYIDHHSFGTAIIS
Y243_CLOB1        --------------------FLPISKEDLKKR-NIDVLDFIIVTGDAYVDHPSFGTAIIG
F5YKN1_TREPZ      -----------------NSRFLPVNSKEMKGR-GWESCDFIFISGDAYVDHPSFAVALVS
F4LND7_TREBD      QSAAAFAASAQSAPAVPRSRFLPVSRADMDER-GIVELDFVFVSGDAYVDHSSFAAAILG
E1R6S8_SEDSS      ------------------AEFLPLTKQEFEAQHGTASPDFIIVSGDAYVDHPSFGTALIG
F0RZU7_SPHGB      --------------------FLPTTQEDLRSR-SWDQIDIAFISADAYVDHPSFGAALLA
Q2FTR4_METHJ      --------------------FLPISHEELRVL-GIDQPDIIMVSGDAYVDHPSFAAALLG
A2STY7_METLZ      --------------------YLPITAEELKNT-GKSTPDIILVSADAYVDHPSFAAALLG
B8GKX9_METPE      --------------------FLPMSMREARKL-GISQFDVILISGDAYVDHPSFGTALIG
D1B6J9_THEAS      --------------------FLPATPEEARSL-PGG-FDFLLITGDAYVDHPTFANALVG
M1PF01_DESSD      ------------------ISPLPATKKECDAR-GWHELDIVLVTGDAYVDHPSFGVALIG
D6Z0N8_DESAT      ------------------LPLLPATASEMHQR-GWETVDVVLVSGDAYIDHPSFGLALIG
D8K057_DEHLB      ------------------DGFLPTSAEEIKAL-GWNQADVIIVTGDSYIDSPFIGAAVIG
C0QM91_DESAH      -------------------MFLPTTHKEMQTL-GWECLDVIFVSGDTYIDSPYTGVALLG
E4TIH6_CALNY      -------------------MFLPINQKDLKKL-GINQLDIIFVTGDCYIDSPYCGVALLG
C6JJH8_FUSVA      -------------------MFLPTTMEEVRKL-GWDSLDIILVSGDTYIDSSYNGSALIG
E6W5W1_DESIS      -----------------------MTPRELRQR-GVDRPDVILVSGDAYIDSPYCGIAVIG
Y332_THENN        -------------------MFLPTTREEMKKL-GWRELDVILVTGDAYVDHPSFGVALIG
Y1155_METJA       -------------------MFLPTTKEEMDEW-GWEELDIIIVTGDAYIDHYLFGASVVG
E1RE69_METP4      -------------------MFLPTSRHEMQKQ-GIEQCDVVIVTPDAYVDHPSFAMAILG
YGIQ_ECOLI        --------------------FLPMSREEMDQL-GWDSCDIILVTGDAYVDHPSFGMAICG
Y674_YERPE        --------------------FLPMSREEMDIL-GWDSCDIIVITGDAYVDHPSFGMAIVG
Y4872_PSEPK       --------------------FLPMSREEMDLL-GWDSCDIIIVTGDAYVDHPSFGMAIIG
F1VZ76_9BURK      ---------------------------------------MILVTGDAYIDHPSFGMALIG
Y934_PORGI        --------------------WLPTSKKEMEAK-GWDEADVILFSGDAYVDHPSFGAAVVG
F9Z7Z9_ODOSD      --------------------WLPTSVREVKER-GWDVPDVILFSGDAYVDHPSFGGAVVG
Q729D8_DESVH      --------------------FLPMSRAEMHAI-GWDALDVLLISGDAYVDHPTFAAALLG
E1QEN6_DESB2      --------------------FLPASRAEMDDL-GWAELDVLLVSGDAHVDHPAFAMALLG
C4XQA0_DESMR      --------------------FLPMTRAEMDAL-GWDCLDVLLVTGDAYVDHPSFGAPLLG
C6BTQ5_DESAD      --------------------FLPMTKKEMDKL-GWDRPDIILVSGDSYIDHPSFGIPLLG
Q1JVX9_DESA6      --------------------FIPTSRAEMDAR-GWQELDVLFVSGDAYVDHPAFGVPLLA
                                                         . ..: * ::*    . .: .

Y1196_CLOPE       RVLENAGYKVGIIAQPDWKSVD--DFKKLGRPRLGFLVNGGNMDPMVNHYTVSKKLRKKD
Y243_CLOB1        RVLEREGFTVGIIAQPNWNNIE--DFKKLGKPKYGFLVNSGNIDSMVNHYTASKKKRHDD
F5YKN1_TREPZ      RYLEAQGFRVGVIPQPDWKTPE--SYTVLGRPRLGFLVGPGAMDSMMAHYTAARKPRSED
F4LND7_TREBD      RLLEKNGYTVGIIAQPDWKSAE--PFKKLGRPRLAFLVSAGAMDSMVSNYTANNKPRSSD
E1R6S8_SEDSS      RLLESRGYRVAIIAQPDWRNTE--DFSRFGRPRLAFLVTSGNLDSMVANYSASRHPRRED
F0RZU7_SPHGB      RLLEKEGYRVGIIAQPDWNSTK--DFLKMGKPRLCCMISGGNIDSMVSHYTANNKPRSED
Q2FTR4_METHJ      RVLWDAGFSVAIIPQPDPKNPE--TFREFGEPRLFFAISGGSVDSMVSNYTAARKKRSDD
A2STY7_METLZ      RTLINAGFSVAIISQPDWKEREGKDFARFGKPNLFFAVLPGAVDPMVSAYTPALRRRHDD
B8GKX9_METPE      RVLWEAGYTVGVIAQPDWHGPD--DLTALGRPRLFFSVSSGSVDSMVNHYTPNKKRRSED
D1B6J9_THEAS      RYLESLGFKVVLAPQPDWNDPG--SLEAYGVPRLAVLVSGGNVDSMVANYTSERHRRSRD
M1PF01_DESSD      RLLESKGYRVAILAQPRYSDNT--DFKMFGRPRLFFGITGGNLDSVVANYTGNGKVREKD
D6Z0N8_DESAT      RWLEAHGYRVAILAQPRYDRPD--DFLRFGRPRLFFGISAGNLDSIVANYTGNVKVRDRD
D8K057_DEHLB      RVLMQAGFKTAIIGQPSTSSAE--NITRLGEPRLFWGVTGGCIDSMVANYTSLKKRRRTD
C0QM91_DESAH      KLLVEKGFRVGVIAQPDITNDA--DIKRLGEPRLFWGVTSGSVDSMVANYTATKKWRKSD
E4TIH6_CALNY      KYLYKNGFTVGIVSQPRLDTDE--DIMKLGTPRLFWGVTAGSVDSMVANYTPLRKKRKED
C6JJH8_FUSVA      KWLYKHGFKVGIIAQPDINSDK--DIKRLGEPNLYWAVSAGCVDSMVANYTATKKKRKSD
E6W5W1_DESIS      RVLESAGYCVAVIAQPSLDTPD--DITALGEPRLFWGISAGCVDSAVANRTALGKPRKSC
Y332_THENN        HYLVSHGFKVGIIAQPDWRTEK--DITRLGRPRLFFGVTAGNVDSMVANYTASKKKRKTD
Y1155_METJA       RYLVEHGYRVGIIAQPDWKNLD--DIKRLGKPNYFFAVTAGNLDSMLAHYTPQKRLRDFD
E1RE69_METP4      RFLEKQGYKVGILSQPDWKNPE--SFLELGVPRIAFAVSGGQADSMVINYTAKKIPRKED
YGIQ_ECOLI        RMLEAQGFRVGIIAQPDWSS-KD-DFMRLGKPNLFFGVTAGNMDSMINRYTADRRLRHDD
Y674_YERPE        RMLEAQGFRVGIIAQPDWTN-KH-DFMRLGEPNLFFGVTAGNMDSMINRYTADRKLRHDD
Y4872_PSEPK       RLLEAQGFRVGIIAQPNWQS-KD-DFMKLGEPNLFFGVAAGNMDSMINRYTADKKIRSDD
F1VZ76_9BURK      RLLEAQGFRVGIIAQPDWLS-VD-AFRALGRPNLYFGVTAGNMDSMVNRYTSDRKIRTDD
Y934_PORGI        RILEAEGLRVAIVPQPNWRDDLR-DFRKLGRPRLFFGVSAGAMDSMVNKYTANRRLRSED
F9Z7Z9_ODOSD      RLLESLGLKVALVPQPNWQDDLR-DFRKLGTPRLFFGVSAGSMDSMVNHYTAARRRRSDD
Q729D8_DESVH      RWLVAHGYRTGIVAQPRWN-TPE-DVLCMGRPRLFAGIAAGAIDSMLAHYTAFRKKRHDD
E1QEN6_DESB2      RWLVAHGFRVGVAAQPDWR-RPD-SVTAMGRPRLLAGVGAGAVDSMLAHRTAFNLPRSDD
C4XQA0_DESMR      RWLVAHGYKTGLVAQPRWEGDAA-DVAAMGRPRLFAGVTAGSLDSMLAHYTAFRKKRSDD
C6BTQ5_DESAD      RVLSAHGFKVAIVCQPDWN-NPK-ALEELGRPRLYAGVSAGALDSMVAHYTSFRKKRSDD
Q1JVX9_DESA6      RWLESLGYRVGIVAQPDWR-RAD-DFLVMGRPRLCVAISSGAMDSMVNHYTAARKKRRDD
                  : *   *  . :  **             * *.    :  *  *. :   :     *   

Y1196_CLOPE       LYTPKGEMG-----------KRPDRATIVYCNKIREAY--KDVNIVIGGIEASLRRFAHY
Y243_CLOB1        FYSPGGKSG-----------YRPDRAVIVYCNKIKEAF--KDSPIIIGGIEASLRRFAHY
F5YKN1_TREPZ      AYSPGGKAG-----------FRPDRATLKYVECIRAAY--KDIPVIIGGIEASLRRFAHY
F4LND7_TREBD      AYAHGGEAG-----------HRPDRALIAYTAKIREAY--KGVPVIIGGIEASLRRTAHY
E1R6S8_SEDSS      AYSPGGKAG-----------LRPDRSLVVYTSRIRQAF--KGVTVALGGLEASLRSLSHY
F0RZU7_SPHGB      EYSPGGKAK-----------LRPDRPTLVYTAKARQAYG-ADIPLIIGGLEASLRRLSHY
Q2FTR4_METHJ      AYSPGGIP------------RRPDRAVLVYTDIIHRLF--PDIPIIIGGIEASLRRFAHY
A2STY7_METLZ      AYSPGGKL------------TRPEKTTLVYTNILHRLF--KDTPIIIGGIEASLRRFAHY
B8GKX9_METPE      VYSPGGRP------------NRPDRATIVYAQQVHALF--PETPLLLGGIEASLRRFAHY
D1B6J9_THEAS      LFSPGGQPG-----------LRPDRAVMAYVNLARRAF--KGLPVIIGGIEASLRRLAHY
M1PF01_DESSD      SYSPDGNPWFDKKRE-KTSRRRPDRASMLYSNLARSAYK--DVPVILGGVEASLRRFIHY
D6Z0N8_DESAT      DYSPDGNPYFGGQAQ-RRFRRRPDRATIIYAQQARRACG--QVPIILGGLEASLRRFVHY
D8K057_DEHLB      DYTPGG-----------KNSRRPDRAVIAYSNLIRRHCK-GTAPIVLGGLESSLRRIAHY
C0QM91_DESAH      DYTPGG-----------MNNRRPDRAVIAYTNLIRRYFK-GTCPIVIGGIEASLRRIAHF
E4TIH6_CALNY      DFTPGG-----------INNKRPDRATIAYVNLIKRYDR-FKKPIIIGGIEASLRRVAHY
C6JJH8_FUSVA      DFTPGG-----------ENIRRPDRASIIYTNLIKRFFKNGNAPVVLGGIEASLRRITHY
E6W5W1_DESIS      DFTPGT-----------VNNRRPDRATIMYCNLVRRYFK-NTVPLVIGGIEASLRRIAHY
Y332_THENN        DYTPGG-----------SGGKRPDRATIVYTNLIKRFFP--EVPVVLGGLEASLRRFAHY
Y1155_METJA       SMSNEG------------IRKRPDRATIVYTNLIKRAFK--GVPIALGGIEASLRRFSHY
E1RE69_METP4      RFCEDGNPYFSKKGEGKKYRIRPDRTVAVYCNQIKTACR--DVPIIIGGIEASLRRIAHY
YGIQ_ECOLI        AYTPDNVAG-----------KRPDRATLVYTQRCKEAWK--DVPVILGGIEASLRRTAHY
Y674_YERPE        AYTPDNQSG-----------KRPDRATLVYSQRCKEAYS--HVPVLLGGIEASLRRIAHY
Y4872_PSEPK       AYTPGGLAG-----------SRPDRASLVYSQRCKEAYK--HVPIVLGGIEASLRRIAHY
F1VZ76_9BURK      AYTPHGEAN-----------KRPDRALVVYAQRVREAYP--EINVVIGSIEASLRRIAHY
Y934_PORGI        AYTPDRRSD-----------MRPDYPTIVYTRILKELFP--DVPVIVGGIEASLRRLTHY
F9Z7Z9_ODOSD      AYTPDGRAG-----------ARPDMPSIVYTRILKKLYP--DTPVIIGGIEASLRRLSHY
Q729D8_DESVH      AYTPGGKAG-----------ARPNRAVIVYTNLLRQAFA--GLPVVIGGIEASLRRATHY
E1QEN6_DESB2      AYTPGGKAG-----------ARPDRATIVYVNLVKQAFP--GLPVVIGGIEASLRRVTHY
C4XQA0_DESMR      AYTPGGKAG-----------ARPNRAAIVYANLVRRAFP--GLPVALGGIEASLRRVSHF
C6BTQ5_DESAD      AYTPGGKAG-----------ARPNRACIIYTNLIKKAFK--GLPVIIGGIEASLRRISHY
Q1JVX9_DESA6      AYTPGGQSG-----------ARPNRAIIAYTAAVKGALK--GVPVIIGGIEASLRRMAHY
                                       **: .   *    :         : :*.:*:***   *:

Y1196_CLOPE       DYWENKVRKSILVDSGADLLVYGMSEKQIVEVADFLNQGF-------DGKYIRHIPGTCY
Y243_CLOB1        DYWDNSVRRSILEDSSADLLIYGMGEKPIVQVSNLLRYGM-------KIDSIKNVRGTTY
F5YKN1_TREPZ      DYWSDTVRRSILLDSKADILVYGMGERPILEIARRLQKGE-------PVSTIRDVRGTCV
F4LND7_TREBD      DCWSNTVRRSILLDTKADLLIYGMGERPILEIAERLARGE-------TASLIRGVRGTCW
E1R6S8_SEDSS      DYWSDTIRRSVLLDAKADYLLYGMSETTILALAAALETAVEKGS-QPNVETIRGLVRVVG
F0RZU7_SPHGB      DFWTDKVRKPIILDAKADLLVYGMGEKQTIEIVRRLDKGE-------PIQSMVDIKGTVY
Q2FTR4_METHJ      DYWSDSVRQSILADAPADLLVFGMGETALCTIAQHADAGE-------KPGDMHNIPGTVW
A2STY7_METLZ      DYWSDSVKQGILADAPASLLVYGMGELQMIEIAARLKNGE-------EIKDLTDIRGTSY
B8GKX9_METPE      DYWSDSIRQSILADAPADLVVYGMGEQQIVAIADRLNTGE-------SIGEIMDIAGTTV
D1B6J9_THEAS      DYWSDKVRRSILVDSKADLLIYGMGERSLMEVAQRLAQGQ-------EVRTILDVRGTCV
M1PF01_DESSD      DYKQKKLRGSLLSDAKADLLVYGMGEQAVLEIARRLDKGLD----------LSSIAGTCE
D6Z0N8_DESAT      DYQQRKLRASVLTDAKADLLVYGMGERAVLEVARRLEAGEH----------LHGIAGTCE
D8K057_DEHLB      DYWDDRVRRSILFDAKADYLLYGMAEKSVVKLAEALDKGID----------TETIKGLCY
C0QM91_DESAH      DFWSNKIRRSILFDAKADILAYGMAEATVVELARALDQGRD----------VTKIRGLCY
E4TIH6_CALNY      DYWDDKIRKSILFDSKADILVYGMGEITLLELTKRLANNED----------FRDIRGICY
C6JJH8_FUSVA      DYWSNNLRRPLIFDAKADILSYGMGEKSMLALAQALKGGRE----------WRNIRGLSY
E6W5W1_DESIS      DLQSSAIRRSILLDAKADILVYGMGEHAVLQIAHSLREQRD----------IKSISGTCV
Y332_THENN        DWWSEKVRKSILVDSKADLLVYGMGEKAVLEIAQILSRTGDI-------EKCKSVRGVVW
Y1155_METJA       DYWDNKVRKSVLIDSKADILMYGMGEKSILAITKALESGEN--------IKDLEINGTVV
E1RE69_METP4      DFWSDKIRRTVLLDSKADILIYGMGEYPLLETVQNLENGIP--------PEMIRVPNTAI
YGIQ_ECOLI        DYWSDTVRRSVLVDSKADMLMFGNGERPLVEVAHRLAMGEPIS-------EIRDVRNTAI
Y674_YERPE        DYWSDTVRRSVIVDAKADMLVYGNGERPLVEVAHRLAAGEKIT-------DIQDVRNTVV
Y4872_PSEPK       DYWQDKVRHSILIDASADILLFGNAERAVVEVAQRLSNGEKIE-------TITDVRGTAF
F1VZ76_9BURK      DYWSDKVRRSVLPDSKADILLFGNAERALVDLTHRLAAGEPIK-------EIRDLRGTAF
Y934_PORGI        DYWQDKLLPGILYQSGADLLIYGMGELPLHEIAQRLIAGEPFD-------SLKSIRQIAY
F9Z7Z9_ODOSD      DYWKDTLQPSILIDSGADMLIYGMGEKPLTDICRLMQKGIPFR-------NLTNIPQTAV
Q729D8_DESVH      DFWTDSLRRSILLDAKADLLVYGMGEYALREAAARYDAAMNEGGAATAAEALHGIGGTAW
E1QEN6_DESB2      DFWTDKLRRSILLDAKADALVYGMGELPLLAIARRLAQGDAD---EPVARRLLGAPGVAV
C4XQA0_DESMR      DFWSNALRRSVLYDAKASLVLYGMAETGILALAEGLDRLEDEG--GLLADILAGLPGAAF
C6BTQ5_DESAD      DFWTDKIRKPVLMDSKADLLVYGMGERAMLDAAIRLSKAEEPS-----AADLKGIAGTAF
Q1JVX9_DESA6      DYWSEQVRRSVLIDSKADLLVYGMGETALAEIVRHLDDGEPVS-------ALNAIRGTAW
                  *     :   :: :: *. : :* .*                                  

Y1196_CLOPE       IADSLDEIY---------------------------------------------------
Y243_CLOB1        IEKDISSL----------------------------------------------------
F5YKN1_TREPZ      RSHGQPP-----------------------------------------------------
F4LND7_TREBD      RTGRRTELPAVSADA---------------------------------------------
E1R6S8_SEDSS      KNNIAYDNIISSQYD---------------------------------------------
F0RZU7_SPHGB      ATNRAKF-----------------------------------------------------
Q2FTR4_METHJ      KIPPKQLHAL--------------------------------------------------
A2STY7_METLZ      TISIAEFRE---------------------------------------------------
B8GKX9_METPE      KMAPKTWRAT--------------------------------------------------
D1B6J9_THEAS      RVRDHQVPE---------------------------------------------------
M1PF01_DESSD      RLSDQVFQQRQHDEKSR-------------------------------------------
D6Z0N8_DESAT      RLTPAQLVARGYDESMPARASAPDPE----------------------------------
D8K057_DEHLB      IVAKIDEDRF--------------------------------------------------
C0QM91_DESAH      ISKTIT------------------------------------------------------
E4TIH6_CALNY      IDKTPK------------------------------------------------------
C6JJH8_FUSVA      IAKEKK------------------------------------------------------
E6W5W1_DESIS      LAAEAP------------------------------------------------------
Y332_THENN        WASQKP------------------------------------------------------
Y1155_METJA       RVNERKIGD---------------------------------------------------
E1RE69_METP4      IC--RKSGN---------------------------------------------------
YGIQ_ECOLI        IVKE---ALPGWSGVDSTRLDTPGKIDPIPHPY----GEDLPCADNKP--VAPKKQEAKA
Y674_YERPE        MRKT---PLPGWSGVDSTRLDKPGRIEAIPNPY----GEDLPCATDDI--SIP---EAKP
Y4872_PSEPK       VRRD---TPQGWYEIDSTRIDRPGRVDKIINPY-VNTQDTQACAIEQAKGDQEDPNEAKV
F1VZ76_9BURK      MVSRGWLPADDWTEANSTRVDTPGRVEAHPDPYEMKTKEPTSCGTANA----EPTIVAKP
Y934_PORGI        LVPK-----------GKTPVPCE-------------------------------------
F9Z7Z9_ODOSD      LRAG-----------DETVATNK-------------------------------------
Q729D8_DESVH      VGTESDMP----------------------------------------------------
E1QEN6_DESB2      MGRIEDLP----------------------------------------------------
C4XQA0_DESMR      SLKPEELPQRF-------------------------------------------------
C6BTQ5_DESAD      MGNPEDVD----------------------------------------------------
Q1JVX9_DESA6      VTNS--------------------------------------------------------
                                                                              

Y1196_CLOPE       ------------------EEHIVLPSFKEVS-----------SDKRTYAECFKIQYDEQD
Y243_CLOB1        ------------------KDYIEIPSFEEVS-----------TNKKSYAEAYKIQYYEQD
F5YKN1_TREPZ      ----------------EIAACVRLPDYEAVK-------GADPGSLRAYAEHFMLQKLQGD
F4LND7_TREBD      --------------NGKISAPVELPPFAEVS-------APTAEGKAAFARSFTLQEANTD
E1R6S8_SEDSS      --------------DITGSKTVFLPSHEALI-------KDGTR----YADHFALQMKHAD
F0RZU7_SPHGB      --------------QQDLMSTIEIPSFEEVSDRDKISNTPTVQGKQAYAEAFQAQLMQQN
Q2FTR4_METHJ      ----------------HIPDLCTLPAYTKVR-----------ENPDDFCLAHTLISQNQN
A2STY7_METLZ      ----------------HPPTGIILPAYPAV------------VNKETYAETFKIQYLSKD
B8GKX9_METPE      ----------------DPGDAVVIPSYTEVA-----------GDKRVYAEAFRLHALEQN
D1B6J9_THEAS      -------------------GAIRLPSYDQVS-----------SDPEAHCEAFRLAYLNSD
M1PF01_DESSD      ---------------------IFLPSWQEIQ-----------QNDALFLRAEKTIDAQAR
D6Z0N8_DESAT      --------------RAGPAHFKVLPGYEQIM-----------VDKSHFLAAEREIDRQAR
D8K057_DEHLB      -----------------GDGYLLLPSFEISS-----------DDKVQFTRMFHMFYEHMD
C0QM91_DESAH      ------------------NGYIELPSFEKSA-----------ADKQEFSNGFRLFYANND
E4TIH6_CALNY      ------------------EDFILLPSFDEVS-----------SDKDRFIDMFNLFYENND
C6JJH8_FUSVA      ------------------DSYLELPSFDECV-----------KDKREFVKAFDIFYHNCD
E6W5W1_DESIS      ------------------AGYRELASYEAVQ-----------SDADAFGEMFATFHKTAL
Y332_THENN        ------------------EEGIELPSYDEIS-----------ENPEKYAEALKLQTWYTD
Y1155_METJA       --------------IKERYETKELPSHEEVV-----------NSKEKYAEMHRKLMTMD-
E1RE69_METP4      --------------YENVENAVILPSFKEVE-----------DSKDKFAEAWRLFEKNDD
YGIQ_ECOLI        VTVQP------PRPKPWEKTYVLLPSFEKVK-----------GDKVLYAHASRILHHETN
Y674_YERPE        ITVRA------AKPKPWEKTYVLLPSYEKVK-----------ADKVLYAHTSRILHHETN
Y4872_PSEPK       VQILD------SPAVTREKSVIRLPSFEKVR-----------NDPVLYAHANRVLHLETN
F1VZ76_9BURK      ILILSREERQAAQKEIRNKTVIRLPGYDAIK-----------DDPVLYAHASRVFHLESN
Y934_PORGI        -----------------NDR--HLFSHEECL-----------SDKRKQAQNFREIEIQSN
F9Z7Z9_ODOSD      -----------------KWRTIILHSHESCL-----------SNKKHHAENFRYIEEESN
Q729D8_DESVH      ----------------EGASIMRLPSHEDIS-----------ADVRLLMEATLQQERHVH
E1QEN6_DESB2      ----------------PQAEVVILPSHEEIV-----------AQPARLMEATLALERQAH
C4XQA0_DESMR      ----------------PQADVLTLPAHEAIV-----------ADPKRLIEATLALERHVH
C6BTQ5_DESAD      ----------------SEAELIELPSHQEIV-----------EEANQLMTATLALEEQVH
Q1JVX9_DESA6      ----------------PPADAVCLPDYEMVE-----------QDVAAYAKAFALSE---Q
                                         :                                    

Y1196_CLOPE       PVRGRTLVQEHN-GKYVVINKPEMPLSREELDRVYALPYQKTYHPIYEKDG-----GIAA
Y243_CLOB1        SIRGKTLVQKHK-ERYVVQNPPQPPLSQEEMDEVYALPYARTYHPMYEAEG-----GIPA
F5YKN1_TREPZ      PQTAKPLAEKSDGDRWVIQNPPAFPLIAPELDSIYELPYQRRAHPMYDAAG-----GIPG
F4LND7_TREBD      AVSGKILIEQSE-NRYVVQEPPAFPLTQEAFDAVMELPFTRRWHPDYDLPAANGKTGVPA
E1R6S8_SEDSS      PYSAATLIEPCG-DRFIVHNPPPFPLTTEELDAVYELPFCRRAHPSYAKAG-----GIPA
F0RZU7_SPHGB      PIAGKRIVQACM-ERLVVQNPPALPLDEEQFDQLYELPFTLDAHPDYEKDG-----GVPA
Q2FTR4_METHJ      PFVGRPLLQQHP-KTVIIQNPPSLPLSPHDMDRIYDLPYTREKHPSYQEDI-------PA
A2STY7_METLZ      -----TLIQPHP-KTVIVQNPPARPLTSEELDIIYELPYTRKQHPAYKEPI-------PA
B8GKX9_METPE      PITGRRVVQPHS-KTVIIQNPPALPLSTEALDRIYALPFTRKAHPSYTTKV-------PA
D1B6J9_THEAS      PFGGRPMVQDQD-PGLVLHNPPPEPLSTRELDRIYQLPFVGLPHPRYRQPI-------PA
M1PF01_DESSD      SYGDIQLIQRQQ-SSWIIQQPQPPQLSTPELDKLYELPYTRCEHP---AFPNV-----PA
D6Z0N8_DESAT      ARQPAMLLQRQQ-AQWLLQHPPAAPLRPEELDRLYALPYARRPHP---QAGRV-----PA
D8K057_DEHLB      PIRAKGLIQQHG-KRYLIQNPPNESLTQAELDNIYALDFQRDQHPFYSRHGKV-----KA
C0QM91_DESAH      PVTAKGLGQQHG-DRFLIQNPPQPFPSTPEMDEIYNLEFEREAHPFYTQAGKV-----KA
E4TIH6_CALNY      PITAKGLCQKHI-DRFLIHNPPQRILTQKELDEIYELEFEHDIPPELKKLGKV-----KA
C6JJH8_FUSVA      PITAKGLCQLCG-DRYLIQNPPSENFTSEELDSIYSMDFERDVHPYYKAMGEV-----RA
E6W5W1_DESIS      HQGAPGFFQQHG-ARFLIHHPPAPMLSSAELDRVHGLPFQHDAHPKCRADGEI-----RA
Y332_THENN        PYKNILIYQKQD-TRYVVQNPPQLPLSQEELDRLYLLPFEREVHPFYAKMGRV-----KA
Y1155_METJA       ----KVIYQKVG-NQYLVQFPPI-YLTEKEMDEIYEMPFERRAHP---SYSYV-----PG
E1RE69_METP4      ---RNVLIQKYD-TRYYVQQPKR-QATQEELDYIYDLRFERRPHP---KYQRI-----PA
YGIQ_ECOLI        PGCARALMQKHG-DRYVWINPPAIPLSTEEMDSVFALPYKRVPHPAYGNA------RIPA
Y674_YERPE        PGCARALMQKHG-DRYIWINPPAIPLSTEEMDSVFALPYQRVPHPSYGKS------PIPA
Y4872_PSEPK       PGNARALVQKHG-EVDVWFNPPPIPMSTEEMDYVFGMPYARVPHPAYGKE------RIPA
F1VZ76_9BURK      PGNARAMVQAHG-ERDVWLNPPPLPLAMDEMDGVYDMNYARAPHPSYGKA------KIPA
Y934_PORGI        RYEADRILQAVG-DSTIVVNPPFPPMSTAQIDQSFDLPYTRLPHPRYKGK------IISA
F9Z7Z9_ODOSD      SIEAARLIQPVD-NRQVIVNPPYPPPTTRELDAVYALPFTRLPHPRYKGK------EIPA
Q729D8_DESVH      RGDA-WAIQPVG-SRAVIMAPPAPPMSSEDLDRLYALPFTREAHPSYRET-------VPA
E1QEN6_DESB2      QGWR-WAAQAVG-GRALLVAPPARPLSTAELDMLHDLPFRRVAHPIHDQP-------VPG
C4XQA0_DESMR      QNKQ-LAVQPSG-DRLTVLTPPGAGLSGKTLDALYALPYSRQPHPSYKLP-------IPA
C6BTQ5_DESAD      FGDS-WAIQPVD-KRHVVLTPPSQYLSTEELDWLYSLPYARLPHPIYKDKG-----RIPA
Q1JVX9_DESA6      MGQK-TQAQAHG-SRWVVVNPPTVALEEAQLDALYALPFARRPHFSYRQS-------IPA
                          :                     :*    : :                    .

Y1196_CLOPE       IEEVKFSLVSSRGCSGNCSFCAITFHQGRIVTSRSEDSIVEEAEEITK-YDDFKGYIHDI
Y243_CLOB1        IKEVKFSITSHRGCYGSCSFCALTFHQGRVIQNRSQDSILKEANMMTN-MKDFKGYIHDV
F5YKN1_TREPZ      LKEVQFSLVSSRGCFGGCSFCAITSHQGRAISSRSRESLVREAETLAR-HRDFKGYIHDV
F4LND7_TREBD      LAEVQFSLVSCRGCFGACSFCAITFHQGKRIQSRSHDSLEKEARALTA-LPGFKGYIHDV
E1R6S8_SEDSS      LQEVRFSLVSSRGCFGGCSFCALTFHQGRIITPRSKESLLREAQKLIA-DPDFKGYIHDV
F0RZU7_SPHGB      LNEVQFSLTSNRGCFGSCSFCAITSHQGRMIQTRSKASLIKEAQRMAE-HPVFKGYIHDL
Q2FTR4_METHJ      LTPVRFSVISHRGCYGNCSFCALSMHQGTIIQSRSRKSILKEIASFQN-MRGFSGIVSDV
A2STY7_METLZ      LTPIQFSITTHRGCFGACSFCAITHHQGKEIVSRSEASILREAERIAK-MPEFKGTISDL
B8GKX9_METPE      LEPVRFSVTSHRGCFGSCSFCALTHHQGRIIQSRSVSSIVDEVTRMTR-MKGWKGIVQDV
D1B6J9_THEAS      LEEVRFSVTAHRGCIGDCSFCAIGVHQGKNIQPRSIRSVVREVQRFLQ-SKDFKGVVSDV
M1PF01_DESSD      ARMIQHSLTAVRGCSGNCSFCAITRHQGPAISSRSKESLLREAKAVSN-MKNFAGTITDI
D6Z0N8_DESAT      FTMVRDSVTIVRGCCGNCAFCAITRHQGGRVVSRSRESIIAEVAQIAQ-APDFRGTITDL
D8K057_DEHLB      LDTIKFSIPSHRGCYGECNFCAIALHEGRTVQWRSEASIIKELKVLSK-YPDFTGYIRDI
C0QM91_DESAH      LDTIRFSIPTHRGCYGECNFCAIAVHEGRTVRWRSRESIINEARALTR-HPRFRGIITDI
E4TIH6_CALNY      LDTIKFSITINRGCYGECNFCAITVHQGATVVSRSKRSIINEIKKISK-LKNFDGIIRDI
C6JJH8_FUSVA      LDTIRTSVTTHRGCYGECNFCAIAIHQGRTVISRSQDSIVEEVKEIAS-APKFKGYIADV
E6W5W1_DESIS      LATIRNSVTTHRGCYGDCSFCAITVHQGRSIISRSMESILSEVKHMAS-QKGFSGTIRDL
Y332_THENN        IETVKFSITAVRGCFGSCSFCALTQHQTTHVSYRSKDSILEEVRILTK-KKDFKGTITDV
Y1155_METJA       IVPVQFSVVTHRGCFGGCSFCSILHHQGKVIQNRSERSILKEIRKLLN-HEDFKGVIQDI
E1RE69_METP4      FDMIETSVTSHRGCFGDCSFCAISAHQGKEIVSRSRDSILKEIKAISG-MKNFRGTITDI
YGIQ_ECOLI        YEMIRFSVNIMRGCFGGCSFCSITEHEGRIIQSRSEDSIINEIEAIRDTVPGFTGVISDL
Y674_YERPE        YDMIRFSINIMRGCYGGCSFCSITEHEGRIIQSRSEDSIIREIEEIRDKVPGFTGIISDL
Y4872_PSEPK       YEMIRFSVNIMRGCFGGCTFCSITEHEGRIIQNRSHESILHEIEEMRDKVPGFTGVVSDL
F1VZ76_9BURK      WDMIRFSVNIMRGCFGGCTFCSITEHEGRIIQSRSEPSILREIELIRDKTQGFTGNISDM
Y934_PORGI        YEMIKHSVNVHRGCFGGCAFCTISAHQGKFIASRSEASVLREVKEITE-MEDFKGYLSDV
F9Z7Z9_ODOSD      YNMIRHSVTLHRGCFGGCAFCTISAHQGKFIVSRSPESIRQELEQITA-MPDFKGTVTDL
Q729D8_DESVH      ADMIRTSITTHRGCGGGCSFCSLALHQGRRIASRSRDSVLAEARDLAA-AARKGVSISDV
E1QEN6_DESB2      LATVATSIISHRGCGGGCSFCSLALHQGRAISSRSARSILAEAQELAR-LNNGRVAISDV
C4XQA0_DESMR      ADMIRGSLNIHRGCAGGCSFCTLALHQGRAIRSRSAGSVLREAARLVD-APGFDGSVSDV
C6BTQ5_DESAD      ADMIEFSITSHRGCGGGCSFCSIAMHQGRHIRSRSRKSIMNELKRMQE-HPDFRGSVSDI
Q1JVX9_DESA6      FEQIRWSVTSHRGCQGGCAFCAIARHQGRRVQSRSQSSVVEEVRQLSC-DEDFRGTITDV
                     :  *:   *** * * **::  *:   :  **  *:  *   .          : *:

Y1196_CLOPE       GGPTANFRKPACKKQLTLGACKHKRCMSP-GICKNMEVDHREYLHLLRRVRKL-PGIKKV
Y243_CLOB1        GGPTANFRHRACKVQEKHGTCKNKQCVFP-KACKNLIVDHKEYLSLLRKIRKI-PNVKKV
F5YKN1_TREPZ      GGPTANFYRAPCKRQAKGGFCPEKECLYP-KPCPQLKADHRPYIETLTALRNI-DTVKKV
F4LND7_TREBD      GGPTANFRQDACAKQEKSGACTNRECLGT-DPCPNLRVDHRDYVTLLRRLRAL-PGVKKV
E1R6S8_SEDSS      GGPTANFHTPACEGQKHRGACSNRQCLFP-KPCPSLKVDHTAYLDVLKSLRKL-PGVKKV
F0RZU7_SPHGB      GGPTANFQGLACDHQIEYGPCPAKECLWP-KPCSNLKDYHGRYLDLLQALESV-KGVKKV
Q2FTR4_METHJ      GGPSANMYGDFCQNWEKNGACTDKECIR----CPVVRSGIHDYLDMLDEAEKL-PKVKHV
A2STY7_METLZ      GGPSANMYACSCAKWEKNGPCLDKNCTT----CPSMKLGTAEQISLLRNVSEI-RKVKHV
B8GKX9_METPE      GGPSANMYGLSCPRWWTLGPCADRACSPD---CLSLTVSHQQQVEMLSALRAV-PGVRKV
D1B6J9_THEAS      GGPSANFHQMPCSKADRLGVCQGRSCLRP-NPCPNLEARHREYFEMLRAVRSI-PGVKRV
M1PF01_DESSD      GGPTANLYGVSC----RIGSCKKHDCL-YPKVCKNLEVNEKAFLAVLREVAAL-PEIRNV
D6Z0N8_DESAT      GGPTANLYGCSCSR--RKEGCSRRDCL-YPDVCRELRIDEDTLLELLQAAAAV-AGVRHL
D8K057_DEHLB      GGPTANMYGFECPKKVRNGICKHQRCL-FPEICPILPVDHSPQTALLKNIRLV-PGVKKV
C0QM91_DESAH      GGPTANMYGFECKKKYDKGACPDKRCL-FPKVCQSLKPDHSSQIELLRQIRTV-PGVKKV
E4TIH6_CALNY      GGPTANMYEIECTKKLKSGKCKDKRCL-FPNPCKSLKIDHSPLISLLEEIRRV-PSIKKA
C6JJH8_FUSVA      GGPTANMYAIECSKKLKLGACQDKRCL-YPHKCPALKIDHNSQIELLDKLKNI-DKIKKI
E6W5W1_DESIS      GGPTANMYASGCELLSRGTPCQHRHCIGYEGICPKLVHGHGEQVELLARLRAL-PGVKRI
Y332_THENN        GGPTANLYGSSCSIRETKGQCQ-KFCL-YPSVCKIVRPNHDEFISLLESIRKI-PGVRNV
Y1155_METJA       GAPTANMYRMGC--KKGLADRCPKNCLYP-EPCENLIINHKPLIKLYRKIRDIVGDDVRV
E1RE69_METP4      GGPTANMYGSKC--ASG--GCITHDCLKSGEGCKNLVPGTKEYLSILDEALKI-RNVKRI
YGIQ_ECOLI        GGPTANMYMLRCKSPRAEQTCRRLSCVYP-DICPHMDTNHEPTINLYRRARDL-KGIKKI
Y674_YERPE        GGPTANMYMLRCQSPRAEQTCRRASCVYP-EICPHMDTNHQPTISLYRRARDL-KGIKKI
Y4872_PSEPK       GGPTANMYRIACKSPEIEKYCRKPSCVFP-GICENLNTDHSSLIELYRKARAL-PGVKKI
F1VZ76_9BURK      GGPTANMYRLACKEKSIEESCRRLSCVYP-TICSNLGTDHSKLIQLYRKARAI-PGIKKI
Y934_PORGI        GGPSANMYKMQGYDLSICKRCKKPSCIHP-NVCPNLNADHRPLLDLLRRIDKN-PKIKKS
F9Z7Z9_ODOSD      GGPSANMYHMKGKNEEICRLCKRASCAYP-TVCKNLNTDHGPLLRIYEEARQV-PGIKHC
Q729D8_DESVH      GGPSANMWQARCTL--NPAKCRRASCMFP-SVCKGFAVDQRKAVRLLREVRDT-PGVRNV
E1QEN6_DESB2      GGPSANMWGGRCAG--DRQSCARASCLTP-KICPQFQVDQMAIIDLLTRLAAT-PGVGHV
C4XQA0_DESMR      GGPSANMWGGRCRG--DMTSCQRPSCLTP-TICKHFSVDQGAFVDLLEAVAEV-PGVRHV
C6BTQ5_DESAD      GGPSANMWNANCTL--ERGKCKRKSCLVP-KVCPNFKYDQKANLKLLRDAQKM-DGIKHV
Q1JVX9_DESA6      GGPTANMYGIEVEDGGKCARCQRISCLFP-QICSNLQVRNGRAARLLRRVREI-KGVKHV
                  *.*:**:                  *      *  .                      . 

Y1196_CLOPE       FIRSGLRYDYIM--ADKD------DTFFKELVEHHVSGQLKVAPEHVSPNVLKYMGKPAG
Y243_CLOB1        FIRSGIRFDYLM--YDKN------DEFFKELCEHHISGQLKVAPEHISDKVLNLMGKPTR
F5YKN1_TREPZ      FIRSGIRFDYLE--LDTQSG----QEFLETLCKYHVSGQLKVAPEHITPGVLAAMGKGKA
F4LND7_TREBD      FIRSGIRFDYLL--LDGD------KTFFRELCEHHVSGQLKVAPEHVSNRVLNLMRKSTH
E1R6S8_SEDSS      FIRSGIRFDYLL--LDEN------RSFLKELVAYHISGQLKVAPEHAGSRTLEAMGKPPI
F0RZU7_SPHGB      FIRSGIRYDYLLEVCDQQTR----ERFMKHLVRNNVSGQLKVAPEHVSPAVLDAMGKPRA
Q2FTR4_METHJ      YIGSGLRYDLIP--LDTDC-----FRQI----SRHISGQMKVAPEHIITTVTGLMNKPDQ
A2STY7_METLZ      FISSGVRYDLIP--KTEEG-----DRYLRELTERHISGHLKVAPEHISDRVTQLMNKPGK
B8GKX9_METPE      FISSGVRYDLVL--ADHS-------TYLQDLVRHHVSGHLKIAPEHFVDSVTARMHKPGR
D1B6J9_THEAS      FVRSGVRYDYLM--MDHP-------SYLRELCEHHVSGQMRVAPEHLSDRVTEVMNKPPR
M1PF01_DESSD      FISSGLRLELLCL--T--------PKLFKEIIRTHTPGILKIAPEHTEQEVLDIMHKESS
D6Z0N8_DESAT      LVSSGLRMELLLK--T--------PRLLRRLLEHHTPGTLKIAPEHTEPEVLRLMHKPDG
D8K057_DEHLB      FVASGIRYDMVLR--DKKNG----REYLKEIVRHHVSGQLKVAPEHSEGKVLELMGKSGT
C0QM91_DESAH      FIASGIRQDLIFA--DKSHG----MTFLKTVVAHHVSGQMKIAPEHTETKILELMGKPDS
E4TIH6_CALNY      FVASGIRYDMVLN--DKENG----GRYLEDLIVHHTSGQLKIAPEHIDPNLLRLMGKPPL
C6JJH8_FUSVA      FIASGIRYDMILD--DKRNG----QMYLEEIIKDHVSGQMKIAPEHTEDKVLSLMGKQGK
E6W5W1_DESIS      FIASGIRYDLILA--DGKHG----RAYLRQMVAHHVSGQLKIAPEHCADAVLRLMNKPSA
Y332_THENN        FVSSGIRHDFVLA--EKDPD-----VFIRELVK-YTPGQLKLAPEHAHPKVLSLMRKPPV
Y1155_METJA       YVRSGVRYDLIMY--DEEYG----EDYIKELSKYHVSGRLKVAPEHISKKVCKAIQKPDG
E1RE69_METP4      QINSGIRYEQCIL--ND--------SAIESILGKYISGRMKIAPESGSDKVLKLMNKPST
YGIQ_ECOLI        LIASGVRYDIAVEDP----------RYIKELATHHVGGYLKIAPEHTEEGPLSKMMKPGM
Y674_YERPE        LIASGVRYDLAVEDP----------RYIKELASHHVGGYLKIAPEHTEEGPLSKMMKPGM
Y4872_PSEPK       LIASGLRYDLAVESP----------EYVKELVTHHVGGYLKIAPEHTERGPLDKMMKPGI
F1VZ76_9BURK      LISSGVRYDLAVRSP----------EYVKELVTHHVGGLLKIAPEHSEEGPLSKMMKPGM
Y934_PORGI        FIGSGVRMDLLLHNYKDKVLKKAADEYTEDLIVKHVSGRLKVAPEHSSDRVLNLMRKPPF
F9Z7Z9_ODOSD      FIGSGIRYDLCLSDTGNKEVDKTNRRYLETVIRHHVSGRFKVAPEHCSPTVLGLMRKPAF
Q729D8_DESVH      RVASGVRFDLALREG----------EALRAYTMEFTGGQLKVAPEHICDEVLEYMRKPGL
E1QEN6_DESB2      RVASGVRFDLALQQP----------AYARALVERFVGGQLKLAPEHVSPGVLALMRKPGL
C4XQA0_DESMR      RVASGWRMDLALADE----------DALGRMVRRFTGGQAKVAPEHQSDRVLKLMRKPPF
C6BTQ5_DESAD      RVASGVRYDLGQKDK----------TSLKDIFKEFVGGQLKVAPEHIAPSVLKHMRKPDL
Q1JVX9_DESA6      FVASGVRYDLLEQQG----------DYLKGLLEHHVGGLLKVAPEALSDPLLKVMRKPAA
                   : ** * :                            *  ::***         : *   

Y1196_CLOPE       KTYDEFRRKFFRITERLG-----KKQFIIPYLMSSHPGCKLEDAIMLAEYLRD-INYQPE
Y243_CLOB1        NVYDSFVKKYYDINKKIH-----KNQFLVPYLMSSHPGSDLKAAIELAQYIKK-MGYTPE
F5YKN1_TREPZ      ETYEKFREDYAETNRRLG-----LKQYLIPYFISSHPGSSLADAVELALFMKK-SHFVPD
F4LND7_TREBD      EVYERFSCEYAALNRKLG-----KKQYLVPYYIAGHPGAELSDAVETALYLKK-TGFVPE
E1R6S8_SEDSS      EVYEQFSRLFYEETKRIG-----KKQYLIPYLIAGHPGSTLDEAVELALFLKK-SGFIPD
F0RZU7_SPHGB      ELFDAFGSLYQDATEEAG-----KKQYLIPYFIAAHPGSTLEDAITLALYLEK-TRFIPD
Q2FTR4_METHJ      ECFDRFRIFFEKNQRGKQ-----SRQYLIPYLMSGHPGCTLSDMISLAEYLRD-TGLYTE
A2STY7_METLZ      AVFDAFCKRFDALQKDKL-----KRQYLVPYLMSSHPGCRIDDMVTLALYLRE-KGMYTE
B8GKX9_METPE      AIFETFQRAYDKTVRETG-----LRQYLLPYLMSGHPGCTVGDMIEMARYIED-HHLYTE
D1B6J9_THEAS      EVLLQFMDRFRGCSGG--------RLFLVHYIMTSHPGCTLEDAVEMAVWLKR-LRIRPR
M1PF01_DESSD      EQLVRFLELGRTLSRELN-----KEAHFSPYIISAHPGCKESHTANMAKTLQK-LGLELR
D6Z0N8_DESAT      SVLEKFVQTFNRLAAELARRSEKKPPTLNPYLISAHPGCTMAHMEEMVRKLQK-LNLVPR
D8K057_DEHLB      ETLLNFKKIFDELSEEAG-----KKQFLTYYFIAAHPGCDDRDTAKLKIFINRHLHLRPE
C0QM91_DESAH      AALIEFKAQFDRLSKENG-----KQQFLTYYLIAAHPGSTMEDMKKLKQFCSTILKIRPE
E4TIH6_CALNY      SDLKRFIEDFYKICRKNR-----LKYFLTYYFIAAHPGCGTKEMEKLKNYISENIRIKPE
C6JJH8_FUSVA      APLKEFKEKFYKINSKLG-----KKQFLTYYLIAAHPGCDEKDMLDLRRFASSELRINPE
E6W5W1_DESIS      AVTARFARLYREMAAAEN-----QHIHLSCYVIAAHPGSTKQHMEEFVRFARSNLQFMPE
Y332_THENN        ELFLEFKKRFETLAKKMG-----KRKYVIGYFIVGHPGEGWRENNYLRDFILKHLGYFPQ
Y1155_METJA       RLFKKFLEKYREIAEKVG-----GIKEVLPYWLIAHPNCSIKEMIELAEFIHK-NNCYSR
E1RE69_METP4      KIFEGFYKRFTGIRKKSG-----LKCILTPYLITGHPGEGEKEILETSEFLKR-FGLSGA
YGIQ_ECOLI        GSYDRFKELFDTYSKQAG-----KEQYLIPYFISAHPGTRDEDMVNLALWLKK-HRFRLD
Y674_YERPE        GSYQRFKELFDTYSKQAG-----KEQYLIPYFISAHPGTEDKDMVNLALWLKK-NRFRLD
Y4872_PSEPK       GTYDRFKRMFEKFSKEAG-----KEQYLIPYFIAAHPGTTDEDMMNLALWLKG-NGFRAD
F1VZ76_9BURK      GAYDQFKELFEKYSKEAG-----KEQYLIPYFIAAHPGTTDEDMLNLSLWLKK-NNFRLD
Y934_PORGI        RQFAEFTKRFQRINEAHG-----LRQQLIPYFISSHPGCTEEDMAELAILTKK-LDFKLE
F9Z7Z9_ODOSD      GLFQQLKSIFDEINRKHR-----LNEQIIPYFISSHPGCRPEDMAELAVATKA-LDFKLE
Q729D8_DESVH      PVFEKFLEAFAAFSDEAG-----KEQYVVPYLLSAFPGCTDDHMRTLSRWLQA-RGWSPQ
E1QEN6_DESB2      DVFERFLRVFEQISRQAG-----KEQYVVPYFMSAFPGCGDAQMRELTQWLGQ-RHWRPQ
C4XQA0_DESMR      AVFERFLKVFERESGRAG-----KEQYVVPYLMSAFPGCTLEDMRRMAEWFAG-KGWRPN
C6BTQ5_DESAD      PIFESFLEMFAVESKKAG-----KEQYVIPYLMSAFPGCTDNDMRHLASWLAA-RGWKPR
Q1JVX9_DESA6      QAFGRFVEAFRADSRRRG-----KRRGIVPYLMAGHPGSTLNDMIDTALFLKR-YHLRVE
                       :                     .  * : ..*.                      

Y1196_CLOPE       QVQDFYPTPGTLSTTMFYTGLDPLT-----MEEVYIPRSKEEKAMQRALLQFKNPKNY--
Y243_CLOB1        QVQDFYPTPGSLSTTMYYTGINPLT-----EEKVYIPKDQKEKRMQRALLQFSIHDNY--
F5YKN1_TREPZ      QVQDFYPSPGTLSTVMYHTGLDPRT-----MESISVPRGEREKRLQRALLQFNHAEQK--
F4LND7_TREBD      QVQDFYPTPGSLATCMYYTALDPRT-----MQPIHVAAGARERRLQRALLQFNKPENR--
E1R6S8_SEDSS      QVQDFYPTPGTLSTCMWATGIDPRT-----MKPIFVPRGEKERHLQRALLQFNRPKNY--
F0RZU7_SPHGB      QVQEFYPTPGTVSTCMYYTGLDPRPGK--RFATIRVPKG-RERHLQRALLQYNKPENR--
Q2FTR4_METHJ      QVQDFTPTPMTTSTCMYATGRDPRT-----GNRVHVPKG-EEKKIQRAILHWKNPANY--
A2STY7_METLZ      QVQDFTPVPMTLSTAMYYTGIHPLT-----GKKVYVPLG-DEKRIQRALLQWKDPKQY--
B8GKX9_METPE      QVQDFTPTPMSVSTCMYATGLDPFT-----MKPVHVPTG-REKQIQRAFLRYRDPANE--
D1B6J9_THEAS      EVQDFTPTPMTRSTCMYATGMDPMT-----GRRVHVPKG-RERRLQRALAQYWVEENR--
M1PF01_DESSD      QFQDFTPTPGTLATAMYVTGLHRDT-----EKPIFVARGQSERMKQRRILEQHLLPKN--
D6Z0N8_DESAT      QFQDFTPTPGTLATAIYVSGLDPAS-----GRPVHVPKGDQERRRQRLVLEQVTKSSA--
D8K057_DEHLB      QVQVFLPAPSTWSAVMYHTERDPFT-----GDKIYVEKSIERKERQKRIITSPSFSGR--
C0QM91_DESAH      QTQIFTPTPSTFSTLMYYTGTDPFS-----GKPLFVERNPLAKEGQKNILTG--------
E4TIH6_CALNY      QVQIFTPLPSTYSSVVYWTEKDPFT-----GEKVFVEKDLRKKKLQKEIITV--------
C6JJH8_FUSVA      QVQVFTPTPSTYSTLMYYTEMDPFT-----NKKLFVEKDNGKKQKQKDILIP--------
E6W5W1_DESIS      QVQIFTPTPSTVSTAMYHCGRHPLS-----GEVVWSEKSSVGKQAQKDTLRAGREMRK--
Y332_THENN        QIQIFTPTPGTVSTAMYYSGLDPFT-----GEKVHVERSLKVRNKMKENVLFK-------
Y1155_METJA       QVQVFTPTPMTLSTTMYHTGINPIT-----NEKVYVPYTYREKKIQKAICLYREEENW--
E1RE69_METP4      QSQIFTPTPMTRSTAMYYLGYDPVT-----GQK-----TESEK-----------------
YGIQ_ECOLI        QVQNFYPSPLANSTTMYYTGKNPLAKIGYKSEDVFVPKGDKQRRLHKALLRYHDPANW--
Y674_YERPE        QVQNFYPSPLANSTTMYYTGKNPLAKVDYKSEEVVVPKGDRQRRLHKALLRYHDPANW--
Y4872_PSEPK       QVQAFYPSPMASATAMYHSGKNPLRKVTYKSEGVEIVKSDEQRRLHKAFLRYHDPKGW--
F1VZ76_9BURK      KVQSFMPTPMALATTMYHTRKNPLRKVTADSETVETVRTGKVRKLHKAFLRYHDPDNW--
Y934_PORGI        QIQDFTPTPMTLATEMYYTGYHP-----YTLQPVYTAIKKEEKMRQHMFFFWYKREEA--
F9Z7Z9_ODOSD      QVQDFTPTPMTVATTIYYSGYHP-----YSLQKIDTAKSEKEKKQQNMFFFWYKREFR--
Q729D8_DESVH      QVQCFIPTPGTVATAMYAAGIDPE------GNPIPVARTDAERLRQHGILMPDTGRPPSR
E1QEN6_DESB2      QVQCFEPTPGTVATAMFATGQDPQ------GRPIFVARDGAQRRRQHGLLTPRPGR----
C4XQA0_DESMR      QVQCFIPLPGTAAAAMYFAGTDLG------GQPLFIADADAERLRQHAVLGGEREK----
C6BTQ5_DESAD      QVQCFIPTPGTVATAMFYCETDPA------GNKIYVAKTDAQRLKQHRILIPDPGRDP--
Q1JVX9_DESA6      QVQEFTPTPGTLATCMYHTGIDPFS-----GQSVEICRSEKQRRWQKALLLYHLPASR--
                  : * * * * : :: ::    .                    :                 

Y1196_CLOPE       --NIVYDALVKAGREDLIGN--GPKCLIRDKNSFGKGNNHSNHKSGGRKNRNENSGRRES
Y243_CLOB1        --DLVKEALIKAHREDLIGN--GPDCLIPYNKPYKKSHKKNNAKN------NNNHYNKNN
F5YKN1_TREPZ      --ALVLEALRMAGREDLIGN--GAECLVRK------------------------------
F4LND7_TREBD      --ALVKEALLEAGRADLIGV--LQ------------------------------------
E1R6S8_SEDSS      --DRVRKALRQAGRSDLIGF--GQTALVPPERNRHP------------------------
F0RZU7_SPHGB      --PLVLEALDKANRKDLTRI--LLARRYTS------------------------------
Q2FTR4_METHJ      --SLVLEGLTRAGRKDLIGN--TGRCLIPARKTGEIRATRKKISPYEHYQGSSPRN----
A2STY7_METLZ      --EYVVSGLLKAGRRDLIGDLVPNRGLPPVRKSGSSKKRRS-------------------
B8GKX9_METPE      --TMVREGLAQTKREDLIGS--GPKCLLPDHRAGKMIGFRRP------------------
D1B6J9_THEAS      --PLVEEALRLVGRTDLIGD--GPQCLIPGSPGGSKGGRPKGIGPRGRRGRGKGA-----
M1PF01_DESSD      --SSPKNSG-----------------HKKQRPHKHSVKRRK-------------------
D6Z0N8_DESAT      --K-PGRAA-----------------RPASRRKAPATKPKR-------------------
D8K057_DEHLB      --QSGGIVSSA--------GLPHKNSKLRGRKVKPKINEKPR------------------
C0QM91_DESAH      -----------------------------NRKRK--------------------------
E4TIH6_CALNY      ------------------------------------------------------------
C6JJH8_FUSVA      --------------------------RENNNKRR--------------------------
E6W5W1_DESIS      --ETVR------------------SRPAGGRRKKPSGSPWRS------------------
Y332_THENN        ---------------------------KKGREKR--------------------------
Y1155_METJA       --EKALEGFKMVGYKGVIYRWIMEQMEKKKKQKKDKNKKNRLN-----------------
E1RE69_METP4      --------------------------DRKKLEKRKTYLLNRS------------------
YGIQ_ECOLI        --PLIRQALEAMGKKHLIGSRRDCLVPAPTIEEMREARRQNRNTRPALTKHTPMATQRQT
Y674_YERPE        --PMLRSALEDMGLQHLIGARRECLVPAPTLEEQREARRALRHHTPALTKHTSITRQRQP
Y4872_PSEPK       --PMLREALQRMGRADLIGPGKHQLIPLHQPQTDTYQSARRKNSTPAGSHKVGKDQKILT
F1VZ76_9BURK      --EIIREALQRMGRSDLIGSGEKHLVPRHSAPTAGLMAIERRRETPS-------PEKLAK
Y934_PORGI        --DKIRRELHRIGRPDLIAKLFDRTTSSRNDRHTPPSTQPRKSKSKSRHS----------
F9Z7Z9_ODOSD      --EQIMTLLRRIHRADLIPKLYGKEREK--------------------------------
Q729D8_DESVH      DADNRRRGDARQSETGRGKAGTRDGRPHRSDRDTGNANRHDGGRSDRRGGRRDEDRPDRG
E1QEN6_DESB2      -----RRG----------------------------------------------------
C4XQA0_DESMR      -----RLAGQSKGQPDRRPDRRAPGAPAPPRR---DAPPLRQGKADGRRGRPD-------
C6BTQ5_DESAD      -----RAGKQGKRKPSSDRPQESSPRHKKGKK---NTKRHDGLNASGEG-----------
Q1JVX9_DESA6      -----KPILEALRSCAREQDGAALFGGGRERS---GAEPLDRKAP---------------
                                                                              

Y1196_CLOPE       EDKKRSSHSKKQRGNKSRGFDQKSQRGSKGKKRR--------------------------
Y243_CLOB1        NYNKNKDISKKNKKNS----------LSKHKKRK--------------------------
F5YKN1_TREPZ      ------------------------------------------------------------
F4LND7_TREBD      ------------------------------------------------------------
E1R6S8_SEDSS      ------------------------------------------------------------
F0RZU7_SPHGB      ------------------------------------------------------------
Q2FTR4_METHJ      ------------------------------------------------------------
A2STY7_METLZ      ------------------------------------------------------------
B8GKX9_METPE      ------------------------------------------------------------
D1B6J9_THEAS      ------------------------------------------------------------
M1PF01_DESSD      ------------------------------------------------------------
D6Z0N8_DESAT      ------------------------------------------------------------
D8K057_DEHLB      ------------------------------------------------------------
C0QM91_DESAH      ------------------------------------------------------------
E4TIH6_CALNY      ------------------------------------------------------------
C6JJH8_FUSVA      ------------------------------------------------------------
E6W5W1_DESIS      ------------------------------------------------------------
Y332_THENN        ------------------------------------------------------------
Y1155_METJA       ------------------------------------------------------------
E1RE69_METP4      ------------------------------------------------------------
YGIQ_ECOLI        PATAKKASSTQSRP----------------------------------VNAGAKKRPKAA
Y674_YERPE        SNRAPAASAGKKAPTVANGTSSAHSTSANQSTSANQSTSAAHSTLATKKSAGKTGVNKAA
Y4872_PSEPK       QHTGLPPRGSDGSK--------------------------PWDKREKAKAEAFARNQQAA
F1VZ76_9BURK      KFGQNKPR--DGG------------------------------------AVTRTPSALAR
Y934_PORGI        ------------------------------------------------------------
F9Z7Z9_ODOSD      ------------------------------------------------------------
Q729D8_DESVH      RRNGARPDGGANRG--------------------------------------RADAEERR
E1QEN6_DESB2      ------------------------------------------------------------
C4XQA0_DESMR      ----TRSGKPDTRR--------------------------------------AATGDKRG
C6BTQ5_DESAD      ----KKFNRKDNGK--------------------------------------RFSKKKKT
Q1JVX9_DESA6      -----RHDRSPRRK--------------------------------------KTLRPKRR
                                                                              

Y1196_CLOPE       -----------------------
Y243_CLOB1        -----------------------
F5YKN1_TREPZ      -----------------------
F4LND7_TREBD      -----------------------
E1R6S8_SEDSS      -----------------------
F0RZU7_SPHGB      -----------------------
Q2FTR4_METHJ      -----------------------
A2STY7_METLZ      -----------------------
B8GKX9_METPE      -----------------------
D1B6J9_THEAS      -----------------------
M1PF01_DESSD      -----------------------
D6Z0N8_DESAT      -----------------------
D8K057_DEHLB      -----------------------
C0QM91_DESAH      -----------------------
E4TIH6_CALNY      -----------------------
C6JJH8_FUSVA      -----------------------
E6W5W1_DESIS      -----------------------
Y332_THENN        -----------------------
Y1155_METJA       -----------------------
E1RE69_METP4      -----------------------
YGIQ_ECOLI        VGR--------------------
Y674_YERPE        VNKPSAGSRGKNRQH--------
Y4872_PSEPK       KERKEASKGGKGNKKPRQPVIPR
F1VZ76_9BURK      PARKAAGVVARPGRK--------
Y934_PORGI        -----------------------
F9Z7Z9_ODOSD      -----------------------
Q729D8_DESVH      EGRKGGSKRPPRR----------
E1QEN6_DESB2      -----------------------
C4XQA0_DESMR      QGRKPGP----------------
C6BTQ5_DESAD      K----------------------
Q1JVX9_DESA6      -----------------------