CLUSTAL format seed alignment for MF_01252

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HMP_BACSU       ------MLDNKTIEIIKSTVPVLQQHGETITGRFYDRMFQDHPELLNIFNQTNQKKKTQR
HMP_OCEIH       MSNTTVLLDKKTTEIIKATVPVLKEHGEAITKHFYKILLENNPELKNVFNQTNQRKGAQS
HMP_BACAN       ------MLSEKTIEIVKSTVPLLQEKGVEITTRFYEILFSEHPELLNIFNHTNQKKGRQQ
HMP_BACHK       ------MLSEKTIEIVKSTVPLLQEKGVEITTRFYEILFSEHPELLNIFNHTNQKKGRQQ
HMP_BACC1       ------MLSEKTIEIVKSTVPLLQEKGVEITTRFYEILFSEHPELLNIFNHTNQKKGRQQ
HMP_BACCR       ------MLSAKTIEIVKSTVPLLQEKGVEITTRFYQILFSEHPELLNIFNHTNQKKGRQQ
HMP_BACHD       --MSTATLSQETKQIVKATVPILAEHGEAITKHFYKRMFSHHPELLNIFNQTHQKQGRQP
HMP_ECOLI       ------MLDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNMSNQRNGDQR
HMP_ECO57       ------MLDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNMSNQRNGDQR
HMP_SHIFL       ------MLDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNMSNQRNGDQR
HMP_ECOL6       ------MLDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNMSNQRNGDQR
HMP_SALTY       ------MLDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNMSNQRNGDQR
HMP_SALTI       ------MLDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNMSNQRNGDQR
HMP_VIBVU       ------MLSENTINIVKSTAPLLAETGPKLTAHFYQRMFEHNPELKDIFNMSNQRNGDQR
HMP_VIBVY       ------MLSENTINIVKSTAPLLAETGPKLTAHFYQRMFEHNPELKDIFNMSNQRNGDQR
HMP_VIBPA       ------MLSNQTIEIVKATAPLIAETGPKLTAHFYDRMFTHNPELKDIFNMSNQRNGDQR
HMP_PHOPR       ------MISQQTIDIVKATAPVVAETGPKLTAHFYERMFNHNPELKDIFNMSNQRNGDQR
HMP_PHOLL       ------MLDNQTIATVKSTIPLLSATGPKLTAHFYERMFKHNPELKNIFNMSHQLNGDQR
HMP_YERPE       ------MLDTQTIAIVKSTIPLLAATGPKLTAHFYERMFKHHPELKNIFNMSNQSSGDQR
HMP_VIBCH       ------MLTQEHINIIKSTIPLLESAGPALTQHFYQRMFSHNPELKHIFNMTHQKTGRQS
HMP_BORBR       ------MLSPEVRALVKATAPVLKEHGEALTRHFYTRMLGGNPELRQLFNQGHQQSGQQQ
HMP_BORPA       ------MLSPEVRALVKATAPVLKEHGEALTRHFYTRMLGGNPELRQLFNQGHQQSGQQQ
HMP_BORPE       ------MLSPEVRALVKATAPVLKEHGEALTRHFYTRMLGGNPELRQLFNQGHQQSGQQQ
HMP_CHRVO       ------MLSEQTRSLVKATVPVLQQHGVALTSHFYRRMFEHNPELKNVFNQGHQHSGQQQ
HMP_RHIME       ------MLTQKTKDIVKATAPVLAQHGYAIIQHFYKRMFQAHPELKNIFNMAHQERGEQQ
HMP_PSEAE       ------MLSNAQRALIKATVPLLETGGEALITHFYRTMLGEYPEVRPLFNQAHQASGDQP
HMP_PSEPK       ------MLNAEQRAIIKATVPLLESGGEALTTHFYKMMLSEYPEVRPLFNQAHQASGDQP
HMP_DEIRA       ------MLTPEQKAIVKATVPALEAHGETITRTFYASMFAAHPELLNIFNPANQQTGKQA
HMP_XYLFA       ---MSASFSPHTITLIKSTVPLLAEHGTTIIEAMYHRLFE-DPQIEALFNQANQKNGTQI
HMP_XYLFT       ---MSASFSPHTITLIKSTVPLLAEHGTTIIEAMYHRLFE-DPQIEALFNQANQKNGTQI
HMP_RHOBA       ------MLSEKTIRIVKEITPLVAANAETITRRFYERMFEANPEVKAFFNQAHQHSGGQQ
                       :       :*   * :   .  :   :*  ::   *::  .**  :*    * 

HMP_BACSU       TALANAVIAAAANIDQLGNIIPVVKQIGHKHRSIGIKPEHYPIVGKYLLIAIKDVLGDA-
HMP_OCEIH       KALANTVYAAAANIEKLEEILPHVKQIAHKHVSLNIKPEQYPIVGKYLLIAIKEVLGDA-
HMP_BACAN       QALANAVYAAATYIDNLEAIIPVVKQIGHKHRSLGIKAEHYPIVGTCLLRAIKEVAG---
HMP_BACHK       QALANAVYAAATYIDNLEAIIPVVKQIGHKHRSLGIKAEHYPIVGTCLLRAIKEVAG---
HMP_BACC1       QALANAVYAAATYIDNLEVIIPVVKQIGHKHRSLGIKAEHYPIVGTCLLRAIKEVAG---
HMP_BACCR       QALANAVYAAATYIDNLEAIIPVVKQIGHKHRSLGIKAEHYPIVGTCLLRAIKEVAG---
HMP_BACHD       QALANSIYAAAEHIDNLEAILPVVSRIAHKHRSLNIKPEQYPIVGENLLAAMREVLGDA-
HMP_ECOLI       EALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGEHLLATLDEMFSPG-
HMP_ECO57       EALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGEHLLATLDEMFSPG-
HMP_SHIFL       EALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGEHLLATLDEMFSPG-
HMP_ECOL6       EALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGEHLLATLDEMFSPG-
HMP_SALTY       EALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGTHLLATLDEMFNPG-
HMP_SALTI       EALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGTHLLATLDEMFNPG-
HMP_VIBVU       EALFNAICAYASNIDNLPALLGAVEKIAHKHSSFLITADQYQIVGGHLLATIDELFSPG-
HMP_VIBVY       EALFNAICAYASNIDNLPALLGAVEKIAHKHSSFLITADQYQIVGSHLLATIDELFSPG-
HMP_VIBPA       EALFNAICAYAANIENLPALLGAVEKIAHKHTSFLITKDQYQIVGKHLIATIDELFNPG-
HMP_PHOPR       EALFNAICAYANNIDNLAALLPAVEKIAHKHTSFMITAEQYQIVGGHLLATIDELLSPG-
HMP_PHOLL       EALFNAICAYAANIDNLKVLLPAVEKIAHKHASLNIQPEHYQIVGTHLLATLNEMFQPG-
HMP_YERPE       EALFNAICAYATNIENLAALLPTVERIAQKHTSLNIQPEHYPIVGEHLIATLDELFSPG-
HMP_VIBCH       VALFEAIAAYAKHIDNLAALTSAVERIAHKHTSFNIQPEHYQIVGHHLLETLRELAPDAF
HMP_BORBR       QALAAAVAAYAEHIDDPSVLLPVVERIAHKHVSLGVRAEHYAIVGKHLLASIREVLGEAA
HMP_BORPA       QALAAAVAAYAEHIDDPSVLLPVVERIAHKHVSLGVRAEHYAIVGKHLLASIREVLGEAA
HMP_BORPE       QALAAAVAAYAEHIDDPSVLLQVVERIAHKHVSLGVRAEHYAIVGKHLLASIREVLGEAA
HMP_CHRVO       QALAMAVLAYARHIDDPSPLLPVLTRVAHKHVSLGIRAEHYPIVGKHLLASIRELLGEAA
HMP_RHIME       QALARAVYAYAANIENPESLSAVLKDIAHKHASLGVRPEQYPIVGEHLLASIKEVLGDAA
HMP_PSEAE       RALANGVLMYARHIDQLQELGPLVAKVVNKHVSLQVLPEHYPIVGTCLLRAIREVLGEQI
HMP_PSEPK       RALANGVLMYARHIDQLEQLGGLVGQIINKHVALQILPEHYPIVGSCLLRAIEEVLGKDI
HMP_DEIRA       RSLAASVLAYAAHIDHPEALGGMVGRIAHKHVSLEVLPEHYPIVGQYLLGAIAGVLG-DA
HMP_XYLFA       HALAGAILAYARNIDNPGVLASAIERIAQKHVGYAIHPEHYPHVATALLGAIKKVLGDV-
HMP_XYLFT       HALAGAILAYARNIDNPGVLASAIERISQKHVGYAIHPEHYPHVATALLGAIKQVLGDV-
HMP_RHOBA       KALAGAICAYFTHIDNPAVLMPAVELIAQKHVSLGIKPEHYPIVGSNLLAAIGDVMGDA-
                 :*   :      *:.   :   :  : :** .  :  ::*  *.  *: ::  :     

HMP_BACSU       ATPDIMQAWEKAYGVIADAFIGIEKDMYEQAEEQAGGWKEYKPFVIAKKERESKEITSFY
HMP_OCEIH       ATDEIIEAWEKAYFVIADIFISVEKEMYNEKKNQIGGWTGFRDFKVIKKVKESKEITSFY
HMP_BACAN       APDEVLNAWGEAYGVIADAFISIEAEMYEEAAHKEGGWKDFRNFVVVKKVKESDVITSLY
HMP_BACHK       APDEVLNAWGEAYGVIADAFISIEAEMYEEAAHKEGGWKDFRNFVVVKKVKESDVITSFY
HMP_BACC1       APDEVLNAWGEAYGVIADAFISIEAEMYEEAAHKEGGWKDFRNFVVVKKVKESDVITSFY
HMP_BACCR       APDEVLNAWGEAYGVIADAFISIEAEMYEEAAHKEGGWKDFRNFVIVKKVKESDVITSFY
HMP_BACHD       ASDDVLEAWREAYELIADVFIQVEKKMYEEASQAPGGWREFRSFVVEKKQRESATITSFY
HMP_ECOLI       --QEVLDAWGKAYGVLANVFINREAEIYNENASKAGGWEGTRDFRIVAKTPRSALITSFE
HMP_ECO57       --QEVLDAWGKAYGVLANVFINREAEIYNENASKAGGWEGTRDFRIVAKTPRSALITSFE
HMP_SHIFL       --QEVLDAWGKAYGVLANVFINREAEIYNENASKAGGWEGTRDFRIVAKTPRSALITSFE
HMP_ECOL6       --QEVLDAWGKAYGVLANVFINREAEIYNENASKAGGWEGTRDFRIVAKTPRSALITSFE
HMP_SALTY       --QEVLDAWGKAYGVLANVFIHREAEIYHENASKDGGWEGTRPFRIVAKTPRSALITSFE
HMP_SALTI       --QEVLDAWGKAYGVLANVFIHREAEIYHENASKDGGWEGTRPFRIVAKTPRSALITSFE
HMP_VIBVU       --QAVLDAWAEAYGVLANVFIQREEQIYQDNQSQTGGWRGLREFELVEKQYESAHICSFV
HMP_VIBVY       --QAVLDAWAEAYGVLANVFIQREEQIYQANQSQTGGWRGLREFELVEKQYESAHICSFV
HMP_VIBPA       --QEVLDAWAEAYGVLANVFIQREEQIYQANASQEGGWRGLREFELVGKQLESEHICSFV
HMP_PHOPR       --QEVLDAWGEAYGVLANVFITREEAIYQENEEKTGGWRGTREFTLIEKTQESDVITSFT
HMP_PHOLL       --NEILDAWGKAYGVLADIFINREEQIYHSGELTDGGWRGLRPFRINRKEVKSEVICSFE
HMP_YERPE       --QAVLDAWAKAYGVLADVFIQRESQIYQQSETETGGWRTLRRFRIIKKEQQSEVICSFV
HMP_VIBCH       T-QPVEEAWTAAYFFLAQVFIDREGALYLERKQALGGWRDGRTFVVREKQVESAYVTSFV
HMP_BORBR       T-DELIDAWAAAYGQLADLLIGRERALYAAAASRDGGWTGWRAFKVVRKTPESAEITSFY
HMP_BORPA       T-DELIDAWAAAYGQLADLLIGRERALYAAAASRDGGWTGWRAFKVVRKTPESAEITSFY
HMP_BORPE       T-DELIDAWAAAYGQLADLLIGRERALYAAAASRDGGWTGWRAFKVVRKTPESAEITSFY
HMP_CHRVO       G-DDLIQAWAEAYGLLADTLIGIENGMYGDATSADGGWSGWRPFRVAKKEIESEEIASFY
HMP_RHIME       T-DEIISAWAQAYGNLADILAGMESELYERSEERAGGWAGWRRFIVREKNPESDVITSFV
HMP_PSEAE       ATDEVLEAWGAAYQQLADLLIEAEESVYAASAQADGGWRGVRRFRVARKQAESEEITSFY
HMP_PSEPK       ATPAVIDAWGAAYGQLADILIGAEENLYKEKEEAEGGWRGTREFRLVRREQESSEIVSFY
HMP_DEIRA       AKPEILDAWAAAYGELADLMIGIEKGMYDAGAGQPGGWRDFRPFRVARKVAESRVITSFV
HMP_XYLFA       ATSEVLEAWGEAYWFIANLLKDREAVIREGIMTKNGGWIHWRRFVISKRIPESETITSFM
HMP_XYLFT       ATSEVLEAWGEAYWFIANLLKDREAVIREGIMTKNGGWIHWRRFVISKRIPESETITSFM
HMP_RHOBA       ATPEIVEAVSEAYGFLADIFIGREGAIYEEQASMPGGWNGTRTFVVTKKVRESEIVTSFY
                    : .*   **  :*: :   *  :        ***   : * :  :  .*  : *: 

HMP_BACSU       LKPEDSKPLPEFQAGQYISIKVRIPDSEYTHIRQYSLSDMPG-KDYYRISVKKD------
HMP_OCEIH       LKPDDNLPITTFIPGQYITIKAQIESEAYVHLRQYSLSTAPG-KDYYRISVKREA---SN
HMP_BACAN       LKPEDGGKVSSFIPGQYVTVQINIEGETYTHNRQYSLSDAPG-KEYYRISVKKEKG--VD
HMP_BACHK       LKPEDGGKVSSFIPGQYVTVQINIEGETYTHNRQYSLSDAPG-KEYYRISVKKEKG--VD
HMP_BACC1       LKPEDGGKVSSFIPGQYVTVQINIEGETYTHNRQYSLSDAPG-KEYYRISVKKEKG--VD
HMP_BACCR       LKPEDGGKVSSFIPGQYVTIQINIEGETYTHNRQYSLSDAPG-KEYYRISVKKEKG--VD
HMP_BACHD       LKPEDGKALASYKPGQYITVKVTIPGHEHTHMRQYSLSDAPE-KGYYRITVKREEGD-GD
HMP_ECOLI       LEPVDGGAVAEYRPGQYLGVWLKPEGFPHQEIRQYSLTRKPD-GKGYRIAVKRE------
HMP_ECO57       LEPVDGGAVAEYRPGQYLGVWLKPEGFPHQEIRQYSLTRKPD-GKGYRIAVKRE------
HMP_SHIFL       LEPVDGGAVAEYRPGQYLGVWLKPEGFPHQEIRQYSLTRKPD-GKGYRIAVKRE------
HMP_ECOL6       LEPVDGGAVAEYRPGQYLGVWLKPEGFPHQEIRQYSLTRKPD-GKGYRIAVKRE------
HMP_SALTY       FEPVDGGTVAEYRPGQYLGVWLKPEGFAHQEIRQYSLTRKPD-GKGYRIAVKRE------
HMP_SALTI       FEPVDGGTVAEYRPGQYLGVWLKPEGFAHQEIRQYSLTRKPD-GKGYRIAVKRE------
HMP_VIBVU       FKPVDGGSVVSFKPGQYLGIYINDEQFENQEIRQYSLSSSVR-PDCYRISVKRE------
HMP_VIBVY       FKPVDGGSVVSFKPGQYLGIYINDEQFENQEIRQYSLSSSVR-PDCYRISVKRE------
HMP_VIBPA       FKPTDGSKVTKYKPGQYLGIYINSDKFENQEIRQYSLSSSVQ-ENTYRISVKRE------
HMP_PHOPR       FKPADGGTVSNFKPGQYLGIYLTPDAFEFQEIRQYSLSSAPR-TDNYRISVKRE------
HMP_PHOLL       FAPQDGGKVMDYKPGQYLSIYLQDDSFANREIRQYSLTAAPN-GSSYRIAIKRE------
HMP_YERPE       LAPEDGGQVLHYKPGQYLGIYIEHESLEFQEIRQYSLTTAPN-GKTYRIAVKRE------
HMP_VIBCH       LVPADGGAVLDYQPGQYIGIEVTPEGSDYREIRQYSLSHASN-GREYRISVKREGV--GS
HMP_BORBR       LAPADGGATPDYLPGQYVSVRVYVPELGLMQPRQYSLSEAPGMPGQLRISVKRE----AG
HMP_BORPA       LAPADGGATPDYLPGQYVSVRVYVPELGLMQPRQYSLSEAPGMPGQLRISVKRE----AG
HMP_BORPE       LAPADGGATPDYLPGQYVSVRVYVPELGLMQPRQYSLSEAPGMPGQLRISVKRE----AG
HMP_CHRVO       LEPSDGGALPAFKPGQYVSVKRFVAEWGLSQPRQYSLSDAPN-GEYLRISVKREDAA-QG
HMP_RHIME       LEPADGGPVADFEPGQYTSVAVQVPKLGYQQIRQYSLSDSPN-GRSYRISVKREDGG-LG
HMP_PSEAE       LEPVDGQPLLAFQPGQYIGLRLDIDGEE--VRRNYSLSAASN-GREYRISVKRE------
HMP_PSEPK       FAPVDGMPVLKAEPGQYIGLKLDIDGAE--QRRNYSLSALCD-GKEYRISVKRE------
HMP_DEIRA       LEPVGGGALPAYQPGQYLSLKVKVPGQERWQIRQYSLSDAPS-PDHYRISVKRE------
HMP_XYLFA       LHPEDGGPVVPHQAGQYLTFRFDAAGMP-GMKRNYSISCGPN-SDHYRITVKREH-----
HMP_XYLFT       LHPEDGGPVVPHQAGQYLTFRFDAAGMP-GMKRNYSISCGPN-SDHYRITVKREH-----
HMP_RHOBA       LKPEDEGPLPPFKPGQYITVHMDHPHTP-TSPRNYSLSDCAS-QPHYRISVKREERLVPD
                : * .        .***  .            *:**::         **::*::      

HMP_BACSU       ---GVVSSYLHDGLQEGDSIEISAPAGDFVLDHASQK-DLVLISAGVGITPMISMLKTSV
HMP_OCEIH       QPIGVVSNYLHTSVEVGSVLPISAPAGDFILDERDHR-PLVLISGGVGLTPIMSMLESVV
HMP_BACAN       TPDGKVSNYLHDHVKEGDMLPVSAPAGDFVLNMDSTL-PVVLISGGVGITPMMSMLNTLI
HMP_BACHK       TPDGKVSNYLHDHVKEGDMLPVSAPAGDFVLNMDSTL-PVVLISGGVGITPMMSMLNTLI
HMP_BACC1       TPDGKVSNYLHDHVKEGDMLPVSAPAGDFVLNMDSTL-PVVLISGGVGITPMMSMLNTLI
HMP_BACCR       TPDGKVSNYLHGHVKEGDVLPVSAPAGDFVLNMDSTL-PVVLISGGVGITPMMSMLNTLI
HMP_BACHD       LPPGIVSNYLHQHIHEGDVLEITAPAGDFTLQEEGER-PIVFISGGVGITPLMSMFNTLM
HMP_ECOLI       -EGGQVSNWLHNHANVGDVVKLVAPAGDFFMAVADDT-PVTLISAGVGQTPMLAMLDTLA
HMP_ECO57       -EGGQVSNWLHNHANVGDVVKLVAPAGDFFMAVADDT-PVTLISAGVGQTPMLAMLDTLA
HMP_SHIFL       -EGGQVSNWLHNHANVGDVVKLVAPAGDFFMAVADDT-PVTLISTGVGQTPMLAMLDTLA
HMP_ECOL6       -EGGQVSNWLHNHANVGDVVKLVAPAGDFFMAVADDT-PVTLISAGVGQTPMLAMLDTLA
HMP_SALTY       -DGGQVSNWLHHHASVGDGVHLAAPAGDFFMNVAADT-PVSLISAGVGQTPMLAMLDTLA
HMP_SALTI       -DGGQVSNWLHHHANVGDVVHLAAPAGDFFMNVAADT-PVSLISAGVGQTPMLAMLDTLA
HMP_VIBVU       -EGGRVSNYLHDHLDVGSKVKLAAPAGDFFLDAAPTA-PVVLISAGVGLTPTLSMLESLT
HMP_VIBVY       -EGGRVSNYLHDHLDVGSKVKLAAPAGDFFLDAAPTA-PVVLISAGVGLTPTLSMLESLT
HMP_VIBPA       -QGGKVSNYLHDELNIGDKVKLAAPAGDFFMDVDTNT-PVVLISAGVGLTPTLSMLESLT
HMP_PHOPR       -EGGKVSNYLHNELTVGDTVQLAAPAGDFFLDVPATT-PVTLISAGVGLTPTLSMLDALT
HMP_PHOLL       -PQGIVSNHMHDKMQEGDTVWLTAPRGDFFLDIKPET-PVTLISAGVGLTPMMSMLYHLH
HMP_YERPE       -EQGTVSNLLHRELNEGDIVRIAPPRGDFFLDVSPDT-PVALISAGVGQTPMLSMLNTLY
HMP_VIBCH       DNPGLVSHYLHNNVKVGDSVKLYAPAGDFFY-VERER-PVVLISAGVGATPMQAILHTLA
HMP_BORBR       SPAGMVSGTLHNRINEGDVLDVSPPQGDFTLDAEDGR-PVVLLSGGVGLTPMVSMLNHLT
HMP_BORPA       SPAGMVSGTLHNRINEGDVLDVSPPQGDFTLDAEDGR-PVVLLSGGVGLTPMVSMLNHLT
HMP_BORPE       SPAGMVSGTLHNRINEGDVLDVSPPQGDFTLDAEDGR-PVVLLSGGVGLTPMVSMLNHLT
HMP_CHRVO       KPAGRVSNLLHREVQVGDVLELSAPQGDFFLHEERDG-PAVLISAGVGQTPMQAMLGQLL
HMP_RHIME       TP-GYVSSLLHDEINVGDELKLAAPYGNFYIDVSATT-PIVLISGGVGLTPMVSMLKKAL
HMP_PSEAE       -AGGRVSNYLHDRVAEGDELDLFPPAGDFVLRDSDK--PLVLITAGVGITPALAMLQEAL
HMP_PSEPK       -AGGKVSNYLHDELKVGDTLQLFPPAGDFTLAASDK--PLVLISGGVGITPTLAMLQAAL
HMP_DEIRA       -GGGLVSEYLHGAVQEGDELLVHVPAGDFVLQQSER--PVVLISAGVGITPMLAMVQTLA
HMP_XYLFA       --GTGASAFLHDQAKVGTIIECTPPVGDFFL-PSVIERPIVLLSGGVGLTPMVSMMEQIA
HMP_XYLFT       --GTGASAFLHDQAKVGTIIECTPPVGDFFL-PSVIERPIVLLSGGVGLTPMVSMMEQIA
HMP_RHOBA       APDGLISNHLHDGIEEGHRIELGPPCGEFTVDPATIAKPIVLIAGGIGVTPLLSMAKSIV
                      *  :*     *  :    * *:*            ::: *:* **  ::     

HMP_BACSU       SKQPERQILFIHAAKNSEYHALRHEVEEAAK-HSAVKTAFVYREPTEEDRAGDLHFHEGQ
HMP_OCEIH       EHQPNRNVVFIHAAKSIDHQAMRKRVSEIAKSKEQVKQYVVYSNPTNRTDGD----KQGY
HMP_BACAN       EQDSKRNVCFVHAAINSNTHAMKEHVEAVDNEYEQVKAYTCYSAPTEKDLEMKNFDKEGF
HMP_BACHK       EQDSKRNVCFVHAAINSNTHAMKEHVEAVDNEYEQVKAYTCYSAPTEKDLEMKNFDKEGF
HMP_BACC1       EQDSKRNVCFVHAALNSNTHAMKEHVEALDNEYEQVKAYTCYSAPTEKDLEMKNFDKEGL
HMP_BACCR       EQDSKRNVYFVHAAINSNTHAMKEHVKAVENEYEQVKAYTCYSAPTEKDLEMKNFDKEGF
HMP_BACHD       QRGVKREVIFIHAAINGFYHAMHDHLAQTASQQENVHYAVCYERPTPGDRMNPFMKKEGF
HMP_ECOLI       KAGHTAQVNWFHAAENGDVHAFADEVKELGQSLPRFTAHTWYRQPSEADRAKGQFDSEGL
HMP_ECO57       KAGHTAQVNWFHAAENGDVHAFADEVKELGQSLPRFTAHTWYRQPSEADRAKGQFDSEGL
HMP_SHIFL       KAGHTAQVNWFHAAENGEVHAFADEVKELGQSLPRFTAHTWYRQPSEADRAKGQFDSEGL
HMP_ECOL6       KAGHTAQVNWFHAAENGDVHAFADEVKELGLSLPRFTAHTWYRQPNEADRAKGQFDSEGL
HMP_SALTY       KEQHTAQVNWFHAAENGDVHAFADEVSELGRTLPRFTAHTWYREPTESDRAQRLFDSEGL
HMP_SALTI       KEQHTAQVNWFHAAENGDVHAFADEVSELGRTLPRFTAHTWYREPTEADRAQRVFDSEGL
HMP_VIBVU       E--HQAPVTWIHATENGQQHAFKQHVKQLVETHPHFNSLVWYNQPNSDDKIGDDFQFSGW
HMP_VIBVY       E--HQAPVTWIHATENGQQHAFKQHVKQLVETHPHFNSLVWYNQPNSDDKIGDDFQFSGW
HMP_VIBPA       E--HHAPVTWVHATENSKHHAFKEHVNQLVTAKENMNALIWYNQPTAEDKIGEDFHFTGF
HMP_PHOPR       E--HQASVHWLHATENGSHHAFKDYVNTLADKYDHISATTWYREPLATDRPAEDFDYQGM
HMP_PHOLL       QQNHNSPINWLHAAEHGGHHAFSHEVAAIAQAMPNFAGTIWYREPRDEDQQGIHYQHKGF
HMP_YERPE       SQQHAAPVHWLHAAENGRVHAFADEVSAIAAKMPNLSRHVWYREPDLQDKHGEDYHSQGL
HMP_VIBCH       KQ-NKSGVTYLYACNSAKEHTFAQETAQLI-AQQGWMQQVWYRDESADDVL------QGE
HMP_BORBR       ARDDGRQIRFVHACREAGVHAMKEHINALAAKRPNVRKAVFYERVGADDRRGVDYDYEGR
HMP_BORPA       ARDDGRQIRFVHACREAGVHAMKEHINALAAKRPNVRKAVFYERVGADDRRGVDYDYEGR
HMP_BORPE       ARDDGRQIRFVHACREAGVHAMKEHINALAAKRPNVRKAVFYERVGADDRRGVDYDYEGR
HMP_CHRVO       KRG-GREVRFLHAARHGGAHAMGAKVRQLADRHPQLKVHVCYETPRAQDAIGVDYQAAGR
HMP_RHIME       QTP-PRKVVFVHGARNSAVHAMRDRLKEASRTYPDFKLFIFYDEPLPTDIEGRDYDFAGL
HMP_PSEAE       PQ--ARPIRFIHCARHGGVHAFRDWIEDVSAQHEQVEHFFCYSEP----RAGDSADAEGL
HMP_PSEPK       QT--RREVHFIHCARNGAVHAFRDWIDGLAARHPQLKRFYCYAEP----EGGAAADAVGL
HMP_DEIRA       QAGSQRPVTFIHAAQNGSVHAFRDDVARLTHEYPHFRKVVFYDEAGPDDQLGTHHDVAGR
HMP_XYLFA       EAHPDAQVWYVHGTQNRETHAMDAHIRALVSRHKHMKATTFYTQR-----READDAEAGF
HMP_XYLFT       EAYPDAQVWYVHGTQNRETHAMDAHIRALVSRHKHMKATTFYTQR-----SEADDAEAGF
HMP_RHOBA       HANPNAELHFIQAARNSKVHAFADELRRLAQAGPNVHTKVIYDSPLPGDVEEGKCDEAGF
                       : :.        :::                   *                * 

HMP_BACSU       IDQQFLKELIA-NTDADYYICGSPSFITAMHKLVSELGSAPESIHYELFGPQLSLAQSV-
HMP_OCEIH       IDYEWLKEVIP-TKDAAFYLCGPKPFMSAINNDLQNMNIAQNDIHMELFGPLEPIAK---
HMP_BACAN       VEREWLQTIIP-TTEAEFYFCGPVPFMKHINAVLTDLGVKQEHIHYEFFGPAASLQ----
HMP_BACHK       VEREWLQTIIP-TTEAEFYFCGPVPFMKHINAVLTDLGVKQEHIHYEFFGPAASLQ----
HMP_BACC1       IEAEWLQTIIP-TTEAEFYFCGPVAFMKHINATLTDLGVKQEHIHYEFFGPAASLQ----
HMP_BACCR       IESEWLKTIIP-TTEAEFYFCGPVAFMKHINAALTDLSVKQEHIHYEFFGPATSLQ----
HMP_BACHD       IDESFLRSILH-DREADFYFCGPVPFMKTIAQILKDWDVPEQQVHYEFFGPAGTLASS--
HMP_ECOLI       MDLSKLEGAFS-DPTMQFYLCGPVGFMQFTAKQLVDLGVKQENIHYECFGPHKVL-----
HMP_ECO57       MDLSKLEGAFS-DPTMQFYLCGPVGFMQFAAKQLVDLGVKQENIHYECFGPHKVL-----
HMP_SHIFL       MDLSKLEGAFS-DPTMQFYLCGPVGFMQFTAKQLVDLGVKQENIHYECFGPHKVL-----
HMP_ECOL6       MDLSKLEGAFS-DPTMQFYLCGPVGFMQFAAKQLVDLGVKQENIHYECFGPHKVL-----
HMP_SALTY       MDLSKLEAAIS-DPAMQFYLCGPVGFMQFAAKQLVSLGVNNENIHYECFGPHKVL-----
HMP_SALTI       MDLSKLEAAIS-DPAMQFYLCGPVGFMQFAAKQLVSLGVNNENIHYECFGPHKVL-----
HMP_VIBVU       VNLHEIETVLK-QADVQVYFCGPVGFMQFIAKQLLEMGVPEQQFHYECFGPHKVV-----
HMP_VIBVY       VNLHEIETVLK-QADVQVYFCGPVGFMQFIAKQLLEMGVPEQQFHYECFGPHKVV-----
HMP_VIBPA       VNLHEIEAALK-QDNVQVYFCGPVGFMQHVAKQLQELGVPQEQFHYECFGPHKVV-----
HMP_PHOPR       IDLKAVASQLI-DPAMHYYFCGPVGFMQHVAKQLIELDVQEDNIHYECFGPHKVL-----
HMP_PHOLL       MDLTVLNEALK-TEGMHFYFCGPVAFMQYVAKQLLDMGIDKQFIHYECFGPHKVI-----
HMP_YERPE       MDLSSYQWLAD-DPKRHYYFCGPLPFMQFIGRQLLAQGIAPEQIHYECFGPHKVI-----
HMP_VIBCH       MQLAELILPIE-DGD--FYLCGPIGFMQYVVKQLLALGVDKARIHYEVFGPHAQLAA---
HMP_BORBR       VDLHAIRDEVI-LPDADYYLCGPLPFMQAQRRALADLGVAEHRIHAEVFGTGGVA-----
HMP_BORPA       VDLHAIRDEVI-LPDADYYLCGPLPFMQAQRRALADLGVAEHRIHAEVFGTGGVA-----
HMP_BORPE       VDLHAIRDEVI-LPDADYYLCGPLPFMQAQRRALADLGVAEHRIHAEVFGTGGVA-----
HMP_CHRVO       LNLADVKGIAL-LPDADYYLCGPLGFMRAQRDSLRGLGVAADRIHYEVFGSHPGDD----
HMP_RHIME       VDVEKVKDSIL-LDDADYYICGPVPFMRMQHDKLLGLGITEARIHYEVFGPDLFAE----
HMP_PSEAE       LSREKLADWLPQERDLDAYFLGPRPFMAQVKRHLADLGVPSQQCHYEFFGPAAALDA---
HMP_PSEPK       LSEDLLAEWLPQERDVDAYFLGPKGFMAAVKRQLKGLGVPEQQSRYEFFGPAAALE----
HMP_DEIRA       LSLDAVRGALP-AGEAEFYYCGPAGFAGAVEAILDDLQVPAERRFTETFGPSQSFAPVIL
HMP_XYLFA       ITIDWLRANTP-FQKADFYLCGPRPFLRTFVRDLIGAGVPAVQVHYEFFGPMDEEMAA--
HMP_XYLFT       ITIDWLRANTP-FQKADFYLCGPRPFLRTFVRDLIGAGVPAAQVHYEFFGPMDEEMAA--
HMP_RHOBA       VTENQIRESTP-FTDADFYFCGPKPFMKNVHSCLRELGVDEHRVRYEFFGPKEELVAV--
                :                 *  *.  *       :            * **.         

HMP_BACSU       -
HMP_OCEIH       -
HMP_BACAN       -
HMP_BACHK       -
HMP_BACC1       -
HMP_BACCR       -
HMP_BACHD       -
HMP_ECOLI       -
HMP_ECO57       -
HMP_SHIFL       -
HMP_ECOL6       -
HMP_SALTY       -
HMP_SALTI       -
HMP_VIBVU       -
HMP_VIBVY       -
HMP_VIBPA       -
HMP_PHOPR       -
HMP_PHOLL       -
HMP_YERPE       -
HMP_VIBCH       -
HMP_BORBR       -
HMP_BORPA       -
HMP_BORPE       -
HMP_CHRVO       -
HMP_RHIME       -
HMP_PSEAE       -
HMP_PSEPK       -
HMP_DEIRA       G
HMP_XYLFA       -
HMP_XYLFT       -
HMP_RHOBA       -