CLUSTAL format seed alignment for MF_01255

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ECTC_ALKHC      MKVVKLEDVIGTEQEV--KGENWTSRRLLLKKDGMGYSVHDTIIKAGTETHIWYQNHLEA
ECTC_BACSK      MKVVKLADIIGTNRDV--DGGNWRSQRIVVESDGMGYSLHDTQIKAGTETHLWYKYHLES
ECTC_STRAW      MIVRSFKDIEGTDRHVKAASGTWESKRIVLAKEKVGFSLHETVLYAGTETSMWYANHIEA
ECTC_STRCO      MIVRSFKEFEGTDRHVKSASGTWESTRIVLAKEKVGFSVHETILYAGTETSMWYANHIEA
ECTC_NOCFA      MIVRTTDEITGTERDV--AGPGWRSKRIVLGGDGVGFSFHETTIDAGTTHEFHYVHHIEA
ECTC_OCEIH      MIVKSLEDIQGTEDHQ--KGETWESRRFVLNKDNVGFSLNDTIIKAGTESYFWYKNHIEA
ECTC_BORBR      MIVRNVKDVMGTEDEVRTDT--WVSRRVLLKKDGMGFSFHETTIFPGTRTHIHYKNHLEA
ECTC_BORPA      MIVRNVKDVMGTEDEVRTDT--WVSRRVLLKKDGMGFSFHETTIFPGTRTHIHYKNHLEA
ECTC_VIBCH      MIVRTLEECRQSERRVVAEN--WESVRMLLKDDHMGFSFHITTIYANTQTHIHYRNHLES
ECTC_VIBPA      MIVRTLDECRNSERRVVADN--WESVRMLLKDDNMGFSFHITTIYEGTETHIHYQNHLES
ECTC_WOLSU      MIVKTKEEVVGTPREIFAPNGHWISRRYLLAGEGMGFSFHETIILAGTKTHIHYQNHLEA
ECTC_BRADU      MIVRSLHDIEATDHFV--DWGNSTSHRLLTDKDGMGFSICHTIVRANTVSLLQYRNHLEA
                * * .  :   :            * * :   : :*:*.  * :  .*   : *  *:*:

ECTC_ALKHC      VYCIEGEGEVETVKDGKVWPIKANEIYALDEHDEHLLRAKTD--MRMVCVFNPPITGKET
ECTC_BACSK      VYVIEGEGEVETVKDGKVWPVKQYECYVLDKNDEHLLRAKTD--MRMVCVFNPPVTGEEV
ECTC_STRAW      VLCVEGEAELTDDETGEKHWITPGTMYLLDGHERHTMRPKTD--FRCVCVFNPPVTGRED
ECTC_STRCO      VVCTKGDAELTDRETGKTYHITPGTMYLLDGHERHTLKVKED--FHCICVFNPPVTGRED
ECTC_NOCFA      VWLVEGEGTLTDLDNDQVYDLRPGTMYLLNGHEKHRVQARTT--MRMMCVFNPPVTGQEV
ECTC_OCEIH      VYCIEGEGEVEKKDTGEVWQLKPGTMYLLNDNDKHYLRAKTQ--MRMVCVFNPALVGTET
ECTC_BORBR      VWCIEGDGSIETIADGKTYELGPGVVYALNENDEHWLCGGKQ-PLRVICVFNPPLTGQEV
ECTC_BORPA      VWCIEGDGSIETIADGKTYELGPGVVYALNENDEHWLCGGKQ-PLRVICVFNPPLTGQEV
ECTC_VIBCH      VYCMSGEGEIEVVG-GKTYPIQPGTLYILDQHDEHYLRAFSS-EMVMACVFNPPLTGHEI
ECTC_VIBPA      VFCMSGEGEIEVVG-GETYPIKPGTLYILDKHDEHYLRAYKNKEMVMACVFNPPITGAEV
ECTC_WOLSU      VFCVQGRGEVELIPSGERFLIEEGVMYALDKHDEHYLSASEE--MRLICVFNPPLQGNEV
ECTC_BRADU      CFCIGGEGEVEDMD-GNVFPIRRGDMYVLDKHDKHLLRGGPDKDMILVSIFNPPLTGTER
                     * . :     .:   :     * *: ::.* :       :   .:***.: * * 

ECTC_ALKHC      HDENGVYPLVDDE---------
ECTC_BACSK      HDEDGAYPLPEHMKPLNS----
ECTC_STRAW      HDENGVYPLLTEPEEV------
ECTC_STRCO      HDENGVYPLLT--EEV------
ECTC_NOCFA      HDENGVYPLVAVPAS-------
ECTC_OCEIH      HDEDGVYPLLAE----------
ECTC_BORBR      HDAEGVYALVEEAA--------
ECTC_BORPA      HDAEGVYALVEEAA--------
ECTC_VIBCH      HDAEGVYPLDKSELISQCHKEK
ECTC_VIBPA      HDENGVYPLVD-----------
ECTC_WOLSU      HDEKGVYPLKKGQ---------
ECTC_BRADU      HKLDDPAGSTY-----------
                *. ..