CLUSTAL format seed alignment for MF_01256

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y2700_BACAN      ---MNDLRYPIGQFTYKRPITEEMIDTWIQEIEDLPNELTKAIKDLDQKQLDTPYRVGGW
Y2441_BACCZ      ---MNDLRYPIGQFTYKRPITEEMIDTWIQEIEDLPNELTKAIKDLDQKQLDTPYRVGGW
Y2729_BACC1      ---MNDLRYPIGQFTYKRPITEEMIDTWIQEIEDLPNELTKAIKDLDQKQLDTPYRVGGW
Y2476_BACHK      ---MNDLRYPIGQFTYKRPITEEMIDTWIQEIEDLPNELTKAIKDLDQKQLDTPYRVGGW
Y2708_BACCR      ---MNDLRYPIGQFTYKRPITEEMIDTWIQEIEDLPNELTKAIKDLDQKQLDTPYRVGGW
Y782_OCEIH       ---MNE-KYPIGEFQFDGEITNIIINEWINEIEDLPRLLKNTVIDLNNEQLDTSYRSGGW
YFIT_BACSU       -MTSVNLSYPIGEYKPRESISKEQKDKWIQVLEEVPAKLKQAVEVMTDSQLDTPYRDGGW
Y869_BACLD       ---MDQLKYPIGTFSKPLEADERELEKWIGDLKQAPHLLRSAAAELNEEQLDTPYRTGGW
Y1024_DEIRA      --MIDP-RYPLGPMPQPRDLSDDERQEARAALRALPGELRAAVAGLSEPQLDTPYREGGW
Y841_DEIRA       --MSDP-RYPIGPAPAVQTLTHEQRQERLAHLAALPEEFEAAFAGLSDAQLDTPYREGGW
Y616_GEOKA       MATVDPIRYPIGTFQAPQQFEAGEVQEWIAAIRGLPSDLRTAVSGLNDEQLNTPYREGGW
Y277_ALKHC       ----MDNRYPIGQFNCPSEVQEKDIQMWIKEITTLPSRLHALTVSLDELELTKTYRENSW
Y413_OCEIH       ----MDVRFPIGKLQVPEKVTIEDIHEWLKQIETYTNRLGETVNSLNDEELSKTYREGSW
                         :*:*             .     :   .  :      : : :* ..** ..*

Y2700_BACAN      TVRQVVHHVVDSHMNSYIRFKLALTEKNPTIKPYKEEKWAELPDSK-LPVDVSLVMLESL
Y2441_BACCZ      TVRQVVHHVVDSHMNSYIRFKLALTEKNPTIKPYKEEKWAELPDSK-LPVDVSLVMLDSL
Y2729_BACC1      TVRQVVHHVVDSHMNSYIRFKLALTEKNPTIKPYKEEKWAELPDSK-LPVDVSLVMLESL
Y2476_BACHK      TVRQVVHHVVDSHMNSYIRFKLALTEKNPTIKPYKEEKWAELPDSK-LPVDVSLVMLESL
Y2708_BACCR      TVRQVVHHVVDSHMNSYIRFKLALTEKNPTIKPYKEEKWAELPDSK-LPVDVSLVMLDSL
Y782_OCEIH       TVRQVIHHLADSHMNAYIRLKLAITEENPVIKPYDEKEWAELYDYN-LPIEISLSLIEAL
YFIT_BACSU       TVRQVVHHLADSHMNSYIRFKLSLTEETPAIRPYDEKAWSELKDSKTADPSGSLALLQEL
Y869_BACLD       AVRQVVHHLADSHMNGYIRSKLALTEETPLIRTFDEQNWAGLTDARTLDPDLSLALLDTL
Y1024_DEIRA      TVRQVVHHVADRHLNAYVHTARVLSGGEALAQPAHEEAWAALPASSF-ATELSLLLLERL
Y841_DEIRA       TLRQLAHHVADSHLNAYVRTKLALTEDRPTVKTYEENLWAELPDTR--AIAPSLDLLRGL
Y616_GEOKA       TVAQVVHHLADASMNAFLRTKWGVTEDGPTVKPFAESEWAKTADACLLPIEPSLLLLDGL
Y277_ALKHC       NVRQLIHHISDSHLNGYMRMKLALTEDNPVVKTYEESEWAKLIDYE-LPIRVSLQLLESL
Y413_OCEIH       DIRQLVHHIADSQLNMYQRLKLALTDESPTVPAFDQEKWAIQPDTN-LPVETSIKMLEGI
                  : *: **: *  :* : :    ::   .   .  :. *:            *: ::  :

Y2700_BACAN      HKRWVNLLYSLELEDLEKTFNHP-DTGETKLAAAIGLYAWHGRHHTAHITSLRKRLNW-
Y2441_BACCZ      HKRWVNLLYSLELEDLEKTFNHP-DTGETKLAAAIGLYAWHGRHHTAHITSLRKRLNW-
Y2729_BACC1      HKRWVNLLYSLELEDLEKTFNHP-ETGETKLAVAIGLYAWHGRHHTAHITSLRKRLNW-
Y2476_BACHK      HKRWVNLLYSLELEDLEKTFNHP-ETGETKLAAAIGLYAWHGRHHTAHITSLRKRLNW-
Y2708_BACCR      HKRWVNLLYSLEIEDLEKTFNHP-ETGETKLAVAIGLYAWHGRHHTAHITSLRKRLNW-
Y782_OCEIH       HKRWCSLLRDLSPTDMERTFKHP-ESGSISIGKNIGIYAWHGKHHLAHITSLCKRKDW-
YFIT_BACSU       HGRWTALLRTLTDQQFKRGFYHPDTKEIITLENALGLYVWHSHHHIAHITELSRRMGWS
Y869_BACLD       HLRWAALXESLTEADFEKAYIYPGTGEEMKLYQALALYVWHSQHHIAHIKAHRKRMGWN
Y1024_DEIRA      HIHWDEVLADVT--DWQQAGLRP-DGSEWTLDGLLGQAAWHGRHHTAHITRLREREGW-
Y841_DEIRA       HRRWVAVLESLTPEQWARVFVHP-VSGPNTLDTMLAYYTWHGQHHTAHALNLRQERGW-
Y616_GEOKA       HARWAALLESMTEADFHRTVRPEGAAGEMPLYVLTALYAWHGKHHTAQVASLRKRKGW-
Y277_ALKHC       HERWTYLLKNLTATQLQRTYQYP-DGSIMRIEQSIALYAWHGNHHLAHIQQALIRTK--
Y413_OCEIH       NERIVSLGYRLTEEQLDQSFVHQ-INGEISVASKVAKLAWHEEHHLAHIKIALSNNSGS
                 : :   :   :   :  :            :    .  .** .** *:      .