CLUSTAL format seed alignment for MF_01260

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

BIOH_BUCBP      ------MNKKLHWKSLGTGTTNLILIHGWGVNSKIWSILVQSQLYQHFKLHFVDLPGFGH
BIOH_WIGBR      -------MKPFFWRIIGSGSVNLVFIHGWGLNSCIWNNIII-ILSNYFKLHLVDLPGYGK
BIOH_LEGPA      --------MNIHLDKHGQG-MPLVLFHGWGFDNQIWQPIIP-YLKPKYQIILVDLPGFGL
BIOH_LEGPL      --------MNIHLDKHGQG-MPLVLFHGWGFDSQIWQPIIP-YLKPKYQIILVDLPGFGL
BIOH_LEGPH      --------MNIHLDKYGQG-MPLVLFHGWGFDSQIWQPIIP-YLKPKYQIILVDLPGFGL
BIOH_ECOLI      -------MNNIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDE-ELSSHFTLHLVDLPGFGR
BIOH_SHIFL      -------MNNIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDE-ELSSHFTLHLVDLPGFGR
BIOH_ECOL6      -------MNNIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDE-ELSSHFTLHLVDLPGFGR
BIOH_ECO57      -------MNNIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDE-ELSSHFTLHLVDLPGFGR
BIOH_SALCH      -------MNDIWWQTYGEGNCHLVLLHGWGLNAEVWHCIRE-ELGSHFTLHLVDLPGYGR
BIOH_SALPA      -------MNDIWWQTYGEGNCHLVLLHGWGLNAEVWHCIRE-ELGSHFTLHLVDLPGYGR
BIOH_SALTI      -------MNDIWWQTYGEGNCHLVLLHGWGLNAEVWHCIRE-ELGSHFTLHLVDLPGYGR
BIOH_SALTY      -------MNDIWWQTYGEGNCHLVLLHGWGLNAEVWHCIRE-ELGSHFTLHLVDLPGYGR
BIOH_SERMA      -------MTALYWQTIGEGERDLVLLHGWGLNAEVW-SCIQ-ALTPHFRLHLVDLPGYGR
BIOH_PECAS      -------MAALYWQTEGAGNTDLVLLHGWGLNAQVWQSMVV-RLAPHFRLHLVDLPGYGR
BIOH_PHOLL      -------MADLFWQTSDEGSRDLVLLHGWGLNAEVWRSIEM-RCAPHFRLHLVDLPGYGR
BIOH_YERPE      -------MKQLYWYTCGEGDCDLVLLHGWGLNSGVWHCIID-RLAPHFRLHLVDLPGYGR
BIOH_YERPS      -------MKQLYWYTCGEGDCDLVLLHGWGLNSGVWHCIID-RLAPHFRLHLVDLPGYGR
BIOH_VIBVU      ------MSTDLHWQTQGQGP-DLVLLHGWGMNGAVWQQVVE-RLELHFRLHVVDLPGYGH
BIOH_VIBVY      ------MSTDLHWQTQGQGP-DLVLLHGWGMNGAVWQQVVE-RLEPHFRLHVVDLPGYGH
BIOH_VIBCH      ------MTMALYWQVSGQGQ-DLVLVHGWGMNGAVWQQTAQ-ALSDHFRVHVVDLPGYGH
BIOH_VIBPA      ------MSTNLHWQSFGQGP-DLVLLHGWGMNGAVWQQTVE-SLQADFCVHVVDLPGYGF
BIOH_PHOPR      ------MTTALCWQTEGQGS-DLVLIHGWGMNGAVWQQLLP-LLTPFYRVHWVDMPGYGH
BIOH_ALIF1      ------MTTPLYWQTEGEGS-DLVLIHGWGMNGAVWQTTSE-KLSQHYRVHTVDLSGYGH
BIOH_IDILO      --------MSISVTCCGTGT-PIVVLHGWGMNSNIWQPVVP-ALSEHFQLYCVDLPGFGD
BIOH_SHEON      MNATTSAHHPLHIETIGQGP-DLVVIHGWGVNSAVFTPLHE-QLSE-YRVHYVDLPGFGL
BIOH_NITEU      -------MASIHIETTGNGP-DLVMLHGWAMHSGVWDGVVE-SLSQRFRLHQVDLPGHGA
BIOH_XANAC      ----------MHIDVIGHGP-ALVLLHGWALHGGVFAPLVE-RLAPHYQLHLVDLPGHGF
BIOH_XANOR      ----------MHIDVIGHGP-ALVLLHGWALHGGVFAPLVE-RLAPHYQLHLVDLPGHGF
BIOH_XANCP      ----------MHIDVIGHGP-ALVLLHGWALHGGVFAPLVE-RLAPHYQLHLVDLPGHGF
BIOH_XYLFA      ----------MYIEVTGYGP-ALVLIHGWAMHSGVFAPLVE-QLRAHHTLYLVDLPGHGY
BIOH_XYLFT      ----------MYIEVTGYGP-ALVLIHGWAMHSGVFAPLVE-QLRPHHTLYLVDLPGHGY
BIOH_NEIMB      ------MRRQRERKSMPDAVKKVYLIHGWGANRHMFDDLMP-RLPATWPVSAVDLPGHGD
BIOH_NEIG1      ------MRRQQERKFMPDAAKKVYLIHGWGANRHAFDDLMP-RLPATWPVSAVDLPGHGD
BIOH_CHRVO      ------MNLFVE---TLGQGPDVVMLHGWGLHGGVFARVAE-QLATRFCVHLVDLPGHGA
BIOH_AROAE      -----------------MNRPDLVLLHGWGLGPQVWSALTP-YLPAGLRVRTPALPGHGG
BIOH_METCA      ---------MGLFIETSGRGPEVVLIHGWGMHGGIWSGFVP-WLTDRFRVTRIDLPGHGH
                                      : ..***.     :             :    :.*.* 

BIOH_BUCBP      SNQL--LPMTLNDTAELLSVYIPKNSILLGWSMGGLIASKIALNYPQKIKGIISVCSSPC
BIOH_WIGBR      NILY--KEYSFSKITEIIACKSPKKSILIGWSLGGLIATNISIVYPEKFKGLIIVSSSPC
BIOH_LEGPA      TPM-----MDWESFKKNLLDQLPDKFALAGWSMGGLYATRLAIEEPARVQYLINITSSPR
BIOH_LEGPL      TPM-----MDWESFKKNLFDQLPDKFALAGWSMGGLYATRLAIEEPARVQYLINITSSPR
BIOH_LEGPH      TPM-----MDWESFKKNLLDQLPDKFALAGWSMGGLYATRLAIEEPARVQYLINITSSPR
BIOH_ECOLI      SRGFGAL--SLADMAEAVLQQAPDKAIWLGWSLGGLVASQIALTHPERVQALVTVASSPC
BIOH_SHIFL      SRGFGAL--SLADMAEAVLQQAPDKAIWLGWSLGGLVASQIALTHPERVQALVTVASSPC
BIOH_ECOL6      SRGFGAL--SLADMAEVVLRQAPDKAIWLGWSLGGLVASQIALTHPERVLALVTVASSPC
BIOH_ECO57      SRGFGAL--SLAEMAEAVLRQAPDKAIWLGWSLGGLVASQIALTHPERVQALVTVASSPC
BIOH_SALCH      SSGFGAM--TLEEMTAQVAKNAPDQAIWLGWSLGGLVASQMALTHPERVQALVTVASSPC
BIOH_SALPA      SSGFGAM--TLEEMTAQVAKNAPDQAIWLGWSLGGLVASQMALTHPERVQALVTVASSPC
BIOH_SALTI      SSGFGAM--TLEEMTAQVAKNAPDQAIWLGWSLGGLVASQMALTHPERVQALVTVASSPC
BIOH_SALTY      SSGFGAM--TLEEMTAQVAKNAPDQAIWLGWSLGGLVASQMALTHPERVQALVTVASSPC
BIOH_SERMA      SQGFGAL--SLAQMTEIVLAAAPPQAWWLGWSLGGLVASQAALMQPQRVSGLITVASSPC
BIOH_PECAS      SQGFGPM--PLNDMANIVLTQAPERAVWLGWSLGGLVASQIALSAPLRVEKLITVASSPC
BIOH_PHOLL      SQKYGPM--NLADMADEVWRYAPENALWLGWSLGGLVASRIALDHQDKVAGLITVASSPH
BIOH_YERPE      SQDYGAM--SLADMAERVAQQAPKQALWLGWSMGGLVASQIALSQPECVRGLITVSSSPC
BIOH_YERPS      SQDYGAM--SLADMAERVAQQAPKQALWLGWSMGGLVASQIALSQPECVRGLITVSSSPC
BIOH_VIBVU      SAHLHAA--SLEEIAQQLLEHAPKQAIWVGWSLGGLVATHMALHHADYVSKLVTVASSPK
BIOH_VIBVY      SAHLHAA--SLEEIAQQLLEHAPKQAIWVGWSLGGLVATHMALHHADYVSKLVTVASSPK
BIOH_VIBCH      SAEQHAA--SLEEIAQALLEHAPRNAIWVGWSLGGLVATHMALHHSDYVSKLVTVASSPK
BIOH_VIBPA      SAEHHGE--DLAQIAAMVLKDAPEKAVWLGWSLGGLVATHIALNAPQRVSKLITVASSPK
BIOH_PHOPR      SHDISAD--SIEEMAQLLLDKSPISATWLGWSLGGLVATQAALLAPERVTRLVTVASSPR
BIOH_ALIF1      SAELGCA--DFDEMVKQVLAQAPKKAAWLGWSLGGLIATKAALTSPERVSQLITVASSPR
BIOH_IDILO      SVWSSENDVSLESFIEQIMPALPPRFHLLGWSLGGLIATQIALTHSDRVMSLTTVASSPH
BIOH_SHEON      SQPIAGN---LSTWIDALINNLPTNAIWAGWSLGGLVATQAAIDYPSHIKGLITIASSPC
BIOH_NITEU      SRDCALD--SLDQMTEVIADRLPGRYSVCGWSLGGQVAIRLALQAPERVQQLVLVASTPC
BIOH_XANAC      SRDDSTP-LALPYVVAEIAAATPP-AVWLGWSLGGLFALHAAATLPQ-VRGLAMIAATPR
BIOH_XANOR      SRDDSTP-LALPYVVAEIAAATPP-AVWLGWSLGGLFALHAAATLPQ-VRGLAMIAATPR
BIOH_XANCP      SHDDTTP-LALPHVVAAIAAATPA-AVWVGWSLGGLFALHAAATQPQ-VRALAMIAATPR
BIOH_XYLFA      NHTTLTP-LALPHVVHAIAAATPP-AVWLGWSLGGLFALHAAATLPQ-VRGLIMLAATPC
BIOH_XYLFT      NHTTPTP-LALPQVVHAIAAATPP-AVWLGWSLGGLFALHAAATLPQ-VRGLIMLAATPC
BIOH_NEIMB      APFVRPF--DIAAAADGIAAQIDAPADILGWSLGGLVALYLAARHPDKVRSLCLTASFAR
BIOH_NEIG1      APFAQPF--DIEAAADGIAAQIDTSADILGWSLGGLVALYLAARHPDKVRSLCLTASFAR
BIOH_CHRVO      SPALPRF--DADAVADLLAAHFPLPAQVVGWSLGGLIAQHWAARHPDKVKSLALVATSPR
BIOH_AROAE      TPARGP---TLEAWSDALLPELPDDAVVCGWSLGGLVALDLARRHPHKVARLVLIGTSPC
BIOH_METCA      SPMLADW--SLETVAGAVLEAVPRPAHWVGWSLGAMVALEAARMAPGAVASLTLLCGTPR
                                 :           ***:*.  *   :      .  :      . 

BIOH_BUCBP      FIV----RPN--WPGIPKKIFLKFYNKLNINFDRTISEFITLQSHNT--NYLEIKNLKQQ
BIOH_WIGBR      FCE----KKD--WPGIKKEILNNFSFQLKNDFHNTVKKFFNIQFLGTKKNNNEIKKLKNI
BIOH_LEGPA      FIS----DID--WPGVAEEVFVNFYNNLSKDINKTLKEFISLQ----------LNKMKFD
BIOH_LEGPL      FIS----DID--WPGVAEEVFVNFYNNLSKDINKTLKEFISLQ----------LNKMKFD
BIOH_LEGPH      FIS----DID--WPGVAEEVFVNFYNNLSKDINKTLKEFISLQ----------LNKMKCD
BIOH_ECOLI      FSA----RDE--WPGIKPDVLAGFQQQLSDDFQRTVERFLALQTMGTETARQDARALKKT
BIOH_SHIFL      FSA----RDE--WPGIKPDVLAGFQQQLSDDFQRTVERFLALQTMGTETARQDARALKKT
BIOH_ECOL6      FSA----RDE--WPGIKPDVLAGFQQQLSDDFQRTVERFLALQTMGTETARQDARALKKT
BIOH_ECO57      FSA----RDE--WPGIKPDVLAGFQQQLSDDFQRTVERFLALQTMGTETARQDARALKKT
BIOH_SALCH      FSA----REG--WPGIKPEILGGFQQQLSDDFQRTVERFLALQTLGTETARQDARTLKSV
BIOH_SALPA      FSA----REG--WPGIKPEILGGFQQQLSDDFQRTVERFLALQTLGTETARQDARTLKSV
BIOH_SALTI      FSA----REG--WPGIKPEILGGFQQQLSDDFQRTVERFLALQTLGTETARQDARTLKSV
BIOH_SALTY      FSA----REG--WPGIKPEILGGFQQQLSDDFQRTVERFLALQTLGTETARQDARTLKSV
BIOH_SERMA      FAA----RDE--WPGIRPDVLSGFQHQLSLDFQRTVERFLALQTLGTESARQDARQLKAV
BIOH_PECAS      FSA----QDD--WPGIKPDVLQGFQQQLSEDFQRTVERFLALQTLGTENARQDARLLKGV
BIOH_PHOLL      FSA----ESD--WPGIKPEVLHDFEHQLSKDFQRTVERFLALQTLGTDSARQDARLLKSV
BIOH_YERPE      FTA----RDE--WPGIKPEVLAGFQHQLSDDFHRTVERFLALQTLGTESSRQDARLLKSV
BIOH_YERPS      FTA----RDE--WPGIKPEVLAGFQHQLSDDFHRTVERFLALQTLGTESSRQDARLLKSV
BIOH_VIBVU      FAA----EAR--WRGIQPQVLSAFTEQLSEDFHTTVERFMALQAMGSPSARQDVKNLKQA
BIOH_VIBVY      FAA----EAR--WRGIQPQVLSAFTEQLSEDFHITVERFMALQAMGSPSARQDVKNLKQA
BIOH_VIBCH      FAA----QGS--WRGIQPDVLTAFTDQLVADFQLTIERFMALQAMGSPSARQDVKVLKQA
BIOH_VIBPA      FAA----EKP--WRGIQPNVLSAFTSQLLEDFSLTIERFMALQAMGSPSARKDVKQLKQA
BIOH_PHOPR      FAA----EGT--WRGIQPQVLDDFRRQLGDDFQLTVERFLALQAMGSPTARQDIKLLKQA
BIOH_ALIF1      FSA----EKG--WRGIKPLVLSQFTEQLKTDFTLTVERFMALQAMGSPNAKQDIKLVKKA
BIOH_IDILO      FVE----SND--WAGIKPDILEQFQQQLDSNFKKTIERFLAIQAMGSEDAREQVKQVKQL
BIOH_SHEON      FMA----REEEAWPGIPPQVLSMFGEQLGQNLPKTIERFLAIQAMGSETAKEDIKQLRDL
BIOH_NITEU      FVR----RAD-WPWGMEDSTLTLFMENLARDYTQTLNRFLTLQVSGSEDQARVLAWLRKS
BIOH_XANAC      FVR----GSD-WPSAVQREVFVQFGVELSRDYRGTLERFLALDTLGSAHARSELRSLRET
BIOH_XANOR      FVR----GSD-WPDAVQRELFVQFGTELSRDYRGTLERFLALDTLGSAHARSELRSLRET
BIOH_XANCP      FVR----GSD-WPDAVEREVFVQFGQDLARDYRGTLDRFLALDTLGSAHARSELRSLRET
BIOH_XYLFA      FVR----RED-WPHAVEVSIFTQFAEDLKQNYTETINRFLALDTLGSTYAQSELRQLRQI
BIOH_XYLFT      FVR----RED-WPHAVEVSILTQFAQDLKQNYTETINRFLALDTLGSTHAQSELRQLRKI
BIOH_NEIMB      LTA-----DEDYPEGLAAPALGKMVGAFRSDYAKHIKQFLQLQLLHTPDADGIIGRILPD
BIOH_NEIG1      LTA-----AEDYPEGLAAPALGKMVGAFRTDYAKHIKQFLQLQLLHTPDAAEIIGRILPD
BIOH_CHRVO      FVR-----DETWPHAQARASIEAVAQSLDGAFEQTLERFLALQMMGAPSARDTLKALRGE
BIOH_AROAE      FVTRPENAAAPWPYGLAASTVTGFIDDFAHDPAATLRRFVALQALGDARRRTVSNALNAA
BIOH_METCA      FVA------EPGWPGMEAVTLMRFADGFLSDYEDACRRFLALQAWGMPNERELLRGVRSQ
                :             .     .  .   :         .*. ::             :   

BIOH_BUCBP      ILSQPYPTIYTLKKNLETIFKTDLRTKIKKLKIPMLRIYGSLDTFVPKKIREILDIL--W
BIOH_WIGBR      FFRQKEPSYKTLSSGLKILKNIDIRNYLKYIKIPTLRIYGNLDVIVPVKIIPIIKKLQNF
BIOH_LEGPA      FKIGNPPSPEGLAFGLEILGTWDFREQLKQITIPTVYLFGRLDPITPVKTMAIMEKN--Y
BIOH_LEGPL      FKIGNPPSPEGLAFGLEILGTWDFREQLKQISIPTVYLFGRLDPITPAKTMAIMEKN--Y
BIOH_LEGPH      FKIGNPPSPEGLAFGLEILGTWDFREQLKQISIPTVYLFGRLDPITPVKTMAIMEKN--Y
BIOH_ECOLI      VLALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKL--W
BIOH_SHIFL      VLALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKL--W
BIOH_ECOL6      VLALPMPEVDVLNGGLEILKTVDLRQPLQNVPMPFLRLYGYLDGLVPRKVVPMLDKL--W
BIOH_ECO57      VLALPMPEVDVLNGGLEILKTVDLRLPLQNVPMPFLRLYGYLDGLVPRKVVPMLDKL--W
BIOH_SALCH      VLAQPMPDVEVLNGGLEILKTVDLREALKNVNMPFLRLYGYLDGLVPRKIAPLLDTL--W
BIOH_SALPA      VLAQPMPDVEVLNGGLEILKTVDLREALKNVNMPFLRLYGYLDGLVPRKIAPLLDTL--W
BIOH_SALTI      VLAQPMPDVEVLNGGLEILKTVDLREALKNVNMPFLRLYGYLDGLVPRKIAPLLDTL--W
BIOH_SALTY      VLAQPMPDVEVLNGGLEILKTVDLREALKNVNMPFLRLYGYLDGLVPRKIVPLLDTL--W
BIOH_SERMA      VLNQPTPSVEVLNGGLEILRTADLRAPLAELNLPLLRIYGYLDGLVPRKVAELLDAA--W
BIOH_PECAS      VLEQPMPSVDVLNGGLEILREADLRQPLADLTVPLLRLYGALDGLVPRKVAGRLDDE--W
BIOH_PHOLL      VLAQPMPSVEVLHVGLEILRTEDLRQPLAELAIPFLRIYGYLDGLVPRKIINILDEK--W
BIOH_YERPE      VLQHQMPDVEVLTGGLAILRTADLRTALAGFTLPFMRVYGHLDSLVPRKVASLLDSA--W
BIOH_YERPS      VLQHQMPDVEVLTGGLEILRTADLRTALSGFTLPFMRVYGHLDSLVPRKVASLLDSA--W
BIOH_VIBVU      VFSRPQPNPQSLLAGLQMLAEVDLRDHLPHLTMPMLRLYGRLDGLVPIKVAQDLEKV--L
BIOH_VIBVY      VFSRPQPNPQSLLAGLQMLAEVDLRDHLPHLTMPMLRLYGRLDGLVPIKVAQDLEKA--L
BIOH_VIBCH      VLSRPMPNPQSLLAGLTMLAEVDLRDELQHISVPMLRLYGRLDGLVPAKVARDLNHL--A
BIOH_VIBPA      VLSRPQPNPESLLVGLNILADVDLRDALISLTMPMLRLYGRLDGLVPIKVATDLSQQ--L
BIOH_PHOPR      VLSRPQPNPEALSIGLRLLADVDLRAQLGDITQPWLRLYGRLDGLVPAKVAKDMDQL--A
BIOH_ALIF1      VFSRPMPDQQALATGLMILADIDLREAVSQLSMPVCRMYGRLDGLVPIKVAHDMDEL--M
BIOH_IDILO      IFTKPMPDQGVLKQSLTILQTADLRQQLPNIEVPFNRFYGRLDSLVPERAIDDISAL--A
BIOH_SHEON      VLARPLPDAAALTQGLDMLNQIDLRMQLSSISQPWLRIWGRLDGLVPKRVQPQMPT---A
BIOH_NITEU      ILRGQPPTPATLQAGLKILQTSDLRAELNQVSQPVLLIHGRNDVITPAGAADWMQQH--L
BIOH_XANAC      LTARGEPAPEALQQGLTLLERTDLRRTVPQLARPSLWIAGQRDRLVPAAGMHAAAALSP-
BIOH_XANOR      LTARGEPAPEALQQGLSLLERTDLRRALPQLARPSLWIAGQRDRLVPAAGMHAAAALSP-
BIOH_XANCP      LTARGEPAASALQDGLGLLERTDLRRALATLARPSLWIAGQRDRLVPAAGMHAAAARAP-
BIOH_XYLFA      LNARHTPNTATLQAGLELLAHTDLRRAVIDLTPPSLWIAGQRDRLVPAASIHAATALAPS
BIOH_XYLFT      LNARHTPNTATLQAGLELLAHTDLRRALIDLTPPSLWIAGQRDRLVPAASIQAATVLAPS
BIOH_NEIMB      LARCG--TPQALQEALDAAERADARHLLDKIDVPVLLVFGGKDAITPPRMGEYLHRR--L
BIOH_NEIG1      LARCG--TPQALQEALDAAERADARHLLDKIDVPVLLVFGGKDAITPLRMGEYLHRH--L
BIOH_CHRVO      LFSHG--RPQGLLPALGLLLEADARALAGRIQCPAALFYGARDAITPIGAGRWLAES--L
BIOH_AROAE      LANLEQCRPAALGAGLELLADTDWRAALDDVRQPVQLIHGAGDALMPLAAAEWLATR--L
BIOH_METCA      LSGRPPPERPALLAGLEVLRHADLRGVLRELPQPVQALLGRRDRLVPVELGDALARL--K
                .          *   *      * *     .  *   . *  * : *             

BIOH_BUCBP      PKTKSITIAHASHIPFVSHQKEFYESIINFKNYLNTLKITCQK
BIOH_WIGBR      NINKNIIIPSASHAPFLSHPFLFCKIIKYFIKKFN--------
BIOH_LEGPA      PNFKYVLFNRAAHMPFLSHTDLFITMMDEFIK-----------
BIOH_LEGPL      PNFKYVLFNRAAHMPFLSHTDLFITMMDEFIK-----------
BIOH_LEGPH      PNFKYVLFNRAAHMPFLSHTDLFITIMDEFIK-----------
BIOH_ECOLI      PHSESYIFAKAAHAPFISHPAEFCHLLVALKQRV---------
BIOH_SHIFL      PHSESYIFAKAAHAPFISHPVEFCHLLVALKQRVLVVSES---
BIOH_ECOL6      PHSESYIFAKAAHAPFISHPDEFCHLLVALKQRV---------
BIOH_ECO57      PHSESYIFAKAAHAPFISHPVEFRHVLVALKQRV---------
BIOH_SALCH      PHSTSQIMAKAAHAPFISHPAAFCQALMTLKSSL---------
BIOH_SALPA      PHSTSQIMAKAAHAPFISHPAAFCQALMTLKSSL---------
BIOH_SALTI      PHSTSQIMAKAAHAPFISHPAAFCQALMTLKSSL---------
BIOH_SALTY      PHSTSQIMAKAAHAPFISHPAAFCQALMTLKSSL---------
BIOH_SERMA      PNSTSQIVAKAAHAPFISHPDEFVTMIEAFIAAH---------
BIOH_PECAS      PNSTSVVMPKAAHAPFISHPDAFTEQVIAFAQA----------
BIOH_PHOLL      PRSVSAMMRHAAHAPFISHPDEFVGLLTEFASREVLQGR----
BIOH_YERPE      PQTQSVVMQGAAHAPFISHPNDFAKLILNFAEENKK-------
BIOH_YERPS      PQTQSVVMQGAAHAPFISHPNDFAKLILNFAEENKK-------
BIOH_VIBVU      PASEQFIFTQSSHAPFITEPESFCHQLLSFAGK----------
BIOH_VIBVY      PASEQFIFTQSSHAPFITEPESFCHQLLSFAGK----------
BIOH_VIBCH      PYSEAFMFDQSSHAPFMTEAEAFCQQLIEFATR----------
BIOH_VIBPA      PHTQQFVFSQSSHAPFMTEHDEFCAQVRDFAQD----------
BIOH_PHOPR      PQSCRQIFAAASHAPFISHPEEFVQTLKDFIK-----------
BIOH_ALIF1      PNSAKIVFEQASHAPFISHNDEFISELRTFLNQHA--------
BIOH_IDILO      PESKAVVFTKSAHAPFISEPERFISELLKVVEN----------
BIOH_SHEON      SHITDVMLAKASHAPFVSHRQEFLQALLPWLTQFKD-------
BIOH_NITEU      PRARLVLFPHCGHAPFLSFPEQFVSCFDAL-------------
BIOH_XANAC      -HAQALTIAGGGHAPFLGHADQVSEALQRFVASVP--------
BIOH_XANOR      -HAQALTIAGGGHAPFLGHADQVSEALQRFVASVP--------
BIOH_XANCP      -HAQALTIDGGGHAPFLGHADQVAEALHRFVAALP--------
BIOH_XYLFA      GQTELLTITGGGHAPFLSHANQMTAALQHFIATLP--------
BIOH_XYLFT      DQTELLTITGGGHAPFLSHANQMTAALQHFIATLP--------
BIOH_NEIMB      KGSRLVVMEKAAHAPFLSHAEAFAALYRDFVEGGLR-------
BIOH_NEIG1      KGSRLVVMEKAAHAPFLSHAEAFAALCRDFVEGGLT-------
BIOH_CHRVO      PDAVLYEFPQASHAPFLSHEQDFVRALAEHLETQA--------
BIOH_AROAE      PDARLARFDDCGHAPFLSHPEDCAVLIEDVVRG----------
BIOH_METCA      TGLVSHRIDDAPHVPFLTHGERTARLIHEFIASS---------
                       .    * **: