CLUSTAL format seed alignment for MF_01263

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CCA_LACPL         -MILTQLPAEFQAAKPIIETIEAAGYEAYFVGGCVRDTILGKPLHDVDIATSAFPAEVKQ
CCA_LACSS         -MKLTTFAPEFAEALPILEQIEAAGFEAYFVGGSVRDNLLGLPIHDVDIATSAYPAEIKQ
W9ELP7_9LACO      -MQIKELPPEFLDAKQVLQKIEQHGYQAYFVGGCVRDTLLHKELHDVDLATSAYPAEIKQ
CCA_ENTFA         -MKLTTIPNEFKEAAPVIREINAQGFEAYFVGGSVRDALLNKPIHDVDIATSAYPEEIKQ
CCA_LACH4         MIKVDKLPDVFIKAMPVLQTLEDAGFEAYFVGGSVRDLLLDRHVHDVDITTSAYPEEVKE
CCA_LACDB         -MTNIRITEVFTQAMPVLEKLEEAGFEAYFVGGCVRDLLLERPIHDVDIATSAYPEEVKE
CCA_LEUCK         -MKISTLPQEFMQAQPILEHIESAGFEAYFVGGAVRDMLLNKPIHDVDIATSAFPEEIKA
CCA_LEUMM         -MKITQLPQEFIDAQPILTKLEDAGFEAYFVGGSVRDTMLGKTIHDVDIASSAFPEEVKS
CCA_STRT1         -MKLSYLPSEFQKALPILEKIKAAGFEAYFVGGSVRDALLNRPIHDVDIASSSYPEETKQ
CCA_STRMU         -MRLKHLPSEFQEALPVLEKIKAAGFEAYFVGGSVRDVLLGHPIHDVDIASSSYPEETKK
CCA_STRP6         -MKLMTMPSEFQKALPILTKIKEAGYEAYFVGGSVRDVLLERPIHDVDIATSSYPEETKA
CCA_STRP1         -MKLMTMPSEFQKALPILTKIKEAGYEAYFVGGSVRDVLLERPIHDVDIATSSYPEETKA
CCA_STRP3         -MKLMTMPSEFQKALPILTKIKEAGYEAYFVGGSVRDVLLERPIHDVDIATSSYPEETKA
CCA_STRA3         -MRLNYLPSEFQKALPILKKIKKAGYEAYFVGGSVRDVLLDRPIHDVDIATSSYPEETKQ
CCA_STRR6         -MRLTQMPSEFQKALPVLEKIKEAGFEAYFVGGSVRDALLHSPIHDVDIATSSYPEETKQ
CCA_LACLA         -MKLEKLPEEFVQAKPVLEKIIEHGFEAYFVGGSVRDILLGREIHDVDIATSAYPEEIKD
CCA_OCEIH         -----MISEPFLKASPILTTLISNGYEGYFVGGCVRDLLLQKDIHDIDIATSATPNEVMH
W9A9C8_9BACI      -----MLDSPFKEATAVLERIEQNGHEAYFVGGCVRDHLLDRKIRDVDIATSATPQFVQN
K0IY12_AMPXN      -----MSKIMFQLAFEMIETIKKAGFQAYVVGGAVRDYLLNKEVNDIDIASSATPTQIQE
I0JN84_HALH3      --MTESNETKLEAAFELLAKIEEGGGEAYIVGGAVRDYLSGRPLGDIDIATSEPPSHIQK
S2YN32_9BACL      ----MLTTEHWQAGTAIIKKLKENGYEAVFVGGAVRDFLRQKEANDIDIASSALPEQVKK
CCA_STAAC         -----MDKSLFEQARPILEQIQDNGFEAYYVGGSVRDYVMGRNIHDIDITTSATPDEIES
CCA_STAAS         -----MDKSLFEQARPILEQIQDNGFEAYYVGGSVRDYVMGRNIHDIDITTSATPDEIES
CCA_STAAN         -----MDKSLFEQARPILEQIQDNGFEAYYVGGSVRDYVMGRNIHDIDITTSATPDEIES
CCA_STAHJ         -----MGTELFNQAKPILEKIEQHGFEAYFVGGSVRDYLMNRHIHDIDITTSATPDEIES
CCA_STACT         -----MNKDLFLQAAPILQEIQDNGYEAYYVGGAVRDYLMDRPIHDIDITTSASPDEIEG
CCA_STAES         -----MSHEIFEQAKPILKKIQNKGFKAYFVGGSVRDYIMQRPIHDVDITTSATPDEIES
CCA_STAS1         -----MTNSLFETAKPILEKLQAHHFQAYFVGGSVRDYLMNRPIHDIDITTSATPDEIET
CCA_BACLD         ------MEDLFLKALPLLRELKKHGWQAYFVGGAVRDAQMNRDVGDIDIATDASPEEIEA
CCA_BACSU         ------MEKVFIKALPVLRILIEAGHQAYFVGGAVRDSYMKRTIGDVDIATDAAPDQVER
CCA_BACP2         ------MNEPFTHAIPILHTLHEHGYQAYFVGGAVRDVLLGREIGDIDIATDATPDTVES
CCA_GEOSE         ------MKPPFQEALGIIQQLKQHGYDAYFVGGAVRDLLLGRPIGDVDIATSALPEDVMA
CCA_GEOKA         ------MKPPFEQALGIIRQLKRHGYEAYFVGGAVRDLLIGRAIGDVDIATSALPEEVMR
CCA_BACAN         -------MERFKKASSIIETLKQQGHEAYFVGGSVRDLIIDRPIGDIDIATSALPEEVMA
CCA_BACC1         -------MKRFKKASSIIETLKQQGHEAYFVGGSVRDLIIDRPIGDIDIATSALPEEVMA
CCA_BACCR         -------MERFKKASSIIETLKQQGHEAYFVGGSVRDLIIDRPIGDIDIATSALPEEVMA
C3BIB8_9BACI      --------------------MKQHGHEAYFVGGSVRDFIINRPIGDIDIATSALPEEVMH
CCA_LISMF         ------MNDVFLKALPVLQKLTTAGFEAYFVGGSVRDYLLNRTISDVDIATSAFPEEVKE
CCA_LISIN         ------MNDVFLKALPVLQKLTTAGFEAYFVGGSVRDYLLNRPISDVDIATSAFPEEVKE
K1M1K5_9LACT      MKLDLTDP-LFLKAIPVLKELESHGYEAYFVGGCVRDSLLNKGISDIDIATSAFPEEVQS
C6CUG0_PAESJ      MEVRFDMPNLMLQAIPVLEALVQQGFEAVFVGGCVRDTAMGLPIKDVDIATSARPEQVMS
                                      :     ..  ***.***        *:*:::.  *     

CCA_LACPL         LFKRTVDTGIEHGTVMILDH---GNGYETTTFRTESGYQDFRRPDQVTFVRSLKEDLKRR
CCA_LACSS         IFKRTVDTGIQHGTVMILDH---GNGYEVTTFRTETGYQDFRRPDSVTFVRSLEEDLKRR
W9ELP7_9LACO      IFPITIDTGIEHGTITVRYD---RKSFEITTFRTESGYQDYRRPDQVTFVRSLKEDLQRR
CCA_ENTFA         IFKRTVDVGIEHGTVLVLME---DQQYEVTTFRTESTYQDFRRPDEVTFVRSLKEDLKRR
CCA_LACH4         LFAKSIDTGIRHGTVTVLYG---GESYEITTFRTESGYQDYRRPDHVTFVQNLDEDLKRR
CCA_LACDB         TFAKSIDTGILHGTVTVLYG---GSSYEITTFRTESGYQDFRRPDKVTFVQNLDEDLKRR
CCA_LEUCK         LFTKTVDTGIQHGTVMVLDH---GDGYEITTFRTESTYTDFRRPDKVTFVRSLAEDLKRR
CCA_LEUMM         LFHNTVDTGIQHGTVMVLDH---GTGYEITTFRVESTYTDFRRPDHVTFVRSLEEDLKRR
CCA_STRT1         IFERTVDIGIEHGTVLVLEN---GGEYEVTTFRTEDVYVDYRRPSSVSFVRSLEEDLKRR
CCA_STRMU         IFPRTVDIGIEHGTVLVLEN---GHDYEVTTFRTEDLYVDYRRPSQVSFVRSLEEDLKRR
CCA_STRP6         IFNRTVDVGIEHGTVLVLEN---GGEYEITTFRTEDVYVDYRRPSQVSFVRSLEEDLKRR
CCA_STRP1         IFNRTVDVGIEHGTVLVLEN---GGEYEITTFRTEDIYVDYRRPSQVSFVRSLEEDLKRR
CCA_STRP3         IFNRTVDVGIEHGTVLVLEN---GGEYEITTFRTEDVYVDYRRPSQVSFVRSLEEDLKRR
CCA_STRA3         IFKRTVDVGIEHGTVLVLEK---GGEYEITTFRTEEVYVDYRRPSQVNFVRSLEEDLKRR
CCA_STRR6         IFPRTADIGIEHGTVLVLDG---DEEYEVTTFRTEDVYVDYRRPSAVSFVRSLEEDLKRR
CCA_LACLA         IFPYTIDVGIEHGTVLVLAGKSEAEHYEITTFRTESKYTDYRRPDHVDFVRDLREDLKRR
CCA_OCEIH         LFKKVIPVGIEHGTVIVRHG---GESYEVTTYRQDGEYTDHRRPNDVRFVTNLAEDLRRR
W9A9C8_9BACI      IFDKVIPVGIEHGTVIVRHL---DTSYEVTTFRIDGTYSDSRHPDHVAFINKIDKDLERR
K0IY12_AMPXN      IFDQVIPVGIEHGTVIVRYK---HQSFEVTTFRSEQGYSDYRRPDRVTFVNSITDDLARR
I0JN84_HALH3      MFDKVIPVGIEHGTVIVRFR---SVSYEVTTFRTEEGYEDYRHPDEVTFVRDIKADLARR
S2YN32_9BACL      IFKRTVDVGLAHGTILVLES---HIPIEVTTFRSDGEYADYRRPTDVKFVLSLEEDLKRR
CCA_STAAC         IFSHTIPVGKEHGTINVVFN---DENYEVTTFRAEEDYVDHRRPSGVTFVRDLYEDLQRR
CCA_STAAS         IFSHTIPVGKEHGTINVVFN---DENYEVTTFRAEEDYVDHRRPSGVTFVRDLYEDLQRR
CCA_STAAN         IFSHTIPVGKEHGTINVVFN---DENYEVTTFRAEEDYVDHRRPSGVTFVRDLYEDLQRR
CCA_STAHJ         IFEKTIPIGREHGTINVVYQ---GTNYEVTTFRAEAEYVDHRRPSEVYFVRDLKEDLQRR
CCA_STACT         IFTNTIPIGKEHGTINVVYN---HENYEVTTFRAEGEYEDHRRPSEVIFVRDLYKDVERR
CCA_STAES         IFDKTIPVGKEHGTINVVFQ---NDNYEITTFRSEDEYIDHRRPSEVYFVRDLYQDVQRR
CCA_STAS1         VFDKTIPIGREHGTINVIYK---GEQYEVTTFRSEGDYDDHRRPNEVFFVRNLYDDVQRR
CCA_BACLD         IFPKTVDVGKEHGTIIVLFE---GESYEVTTFRAELEYEDYRRPSGVQFIKSLKEDLKRR
CCA_BACSU         LFQRTVDVGKEHGTIIVLWE---DETYEVTTFRTESDYVDFRRPSEVQFISSLEEDLKRR
CCA_BACP2         LFEKTVDVGKEHGTVIVLHD---GMSYEVTTFRTESEYEDFRRPKEVAFITSLKEDLLRR
CCA_GEOSE         IFPKTIDVGSKHGTVVVVHK---GKAYEVTTFKTDGDYEDYRRPESVTFVRSLEEDLKRR
CCA_GEOKA         LFPKTIDVGSKHGTVVVVHE---GTAYEVTTFRTDGDYEDHRRPESVTFVRSLEEDLKRR
CCA_BACAN         IFPRHVPVGLEHGTVIVVEN---GEPYEVTTFRTESEYEDFRRPSSVQFVRSLEEDLKRR
CCA_BACC1         IFPRHVPVGLEHGTVIVVEN---GEPYEVTTFRTESEYEDFRRPSSVQFVRSLEEDLKRR
CCA_BACCR         IFPRNVPVGLEHGTVIVVEN---GEPYEVTTFRTESEYEDFRRPSSVQFVRSLEEDLKRR
C3BIB8_9BACI      LFPRHVPVGLEHGTVIVVQE---GIPYEVTTFRTESDYEDFRRPSSVQFVRSLEEDLKRR
CCA_LISMF         IFQTSYDTGIAHGTVTVREN---NEFYEVTTFRTEGTYEDFRRPSEVTFIRSLEEDLKRR
CCA_LISIN         IFQSTYDTGIAHGTVTVREN---KECYEVTTFRTEGTYEDFRRPSEVTFIRSLEEDLLRR
K1M1K5_9LACT      IFPKHFDVGLEHGTVVVLFH---GESYEITTFRTESTYSDYRRPDQVSFVRDLVEDTKRR
C6CUG0_PAESJ      IFPRCIPTGLQHGTVTVLHD---GGSYEVTTFRTESEYEKHRRPLQVEFIDRLDGDLLRR
                   *      *  ***: :          * **:: :  * . *:*  * *:  :  *  **

CCA_LACPL         DFTINALAMTANGEVIDLFDGLADMEQGILRAVGVAEERFHEDALRMMRAVRFASQLGFT
CCA_LACSS         DFTINALAMRADGEIIDLFDGIADLKAHKIRAVGVADERFHEDALRMMRAVRFESQLGFS
W9ELP7_9LACO      DFTINALAMTATGDVIDLFSGLRDLDQRLIKAVGDPEQRFQEDALRLMRAVRFGSQLDFC
CCA_ENTFA         DFTINALALDSTGEIIDLFDGIEDLTNQTIRAVGNPHERFHEDALRMMRGLRFASQLDFK
CCA_LACH4         DFTINALAMDLHGQIVDLFNGVEDLKNHIIRAVGDPEKRFHEDALRMMRAVRFTSQLKFN
CCA_LACDB         DFTINALAMNRQGEIIDLFDGLGDLKRRVIKAVGVAEDRFHEDALRMMRAVRFMSQLSFS
CCA_LEUCK         DFTINAIAMTKDGDIIDLFDGLTDMAQKRIRAVGDAEVRFNEDALRIMRALRFSAQLGFD
CCA_LEUMM         DFTINALAMRHDGEVLDLFDGLEDMKKGVIRAVGDAEKRFTEDALRMMRALRFSAQLGFN
CCA_STRT1         DFTVNAFALNENAEVIDKFNGLADLDNRVLRAVGKAEERFNEDALRIMRGLRFAASLDFD
CCA_STRMU         DFTINAFALDEKANIIDKFNGLVDLEQKILRAVGNAAERFNEDALRIMRGLRFAAQLNFD
CCA_STRP6         DFTVNALALDENGQVIDKFRGLIDLKQKRLRAVGKAEERFEEDALRIMRGFRFAASLDFD
CCA_STRP1         DFTVNALALDENGQVIDKFRGLIDLKQKRLRAVGKAEERFEEDALRIMRGFRFAASLDFD
CCA_STRP3         DFTVNALALDENGQVIDKFRGLIDLEQKRLRAVGKAEERFEEDALRIMRGFRFAASLDFD
CCA_STRA3         DFTVNAFALNEDGEVIDLFHGLDDLDNHLLRAVGLASERFNEDALRIMRGLRFSASLNFD
CCA_STRR6         DFTVNAFALDETGEIVDLFHGLEDLEKQVLRAVGVASERFNEDALRIMRGFRFQASLGFA
CCA_LACLA         DFTINAFACDVNGQIIDLFDGLTDLKERRLTAVGSALERFNEDALRIMRAMRFAATLDFQ
CCA_OCEIH         DFTINALAMDTSGQITDLFHGQDDLKKKLIRTVGNAEERFTEDALRILRAVRFSSQLGCT
W9A9C8_9BACI      DFTINAMAMNKQGQIIDLYHGREDLNKRIIRTVGDGYERFKEDPLRMVRAVRFASQLGFT
K0IY12_AMPXN      DFTINAIAMTEDSVLVDPFDGQADLASKMIKAVGNPVERFTEDPLRMLRAIRFVSQLNFN
I0JN84_HALH3      DFTINAMAMDRYGTIIDPYSGLAAIENRQVKAVGDPFDRFTEDPLRMMRAARFSSQLEFE
S2YN32_9BACL      DFTMNALAMTESFQIIDLFDGRLDLENRIIRTVGNPTDRFQEDALRMLRAVRFSAQLGFT
CCA_STAAC         DFTMNAIAMDTAYKLYDYFDGQQDINNRIIRTVGIAEERFQEDALRMIRCLRFQSQLSFD
CCA_STAAS         DFTMNAIAMDTAYKLYDYFDGQQDINNRIIRTVGIAEERFQEDALRMIRCLRFQSQLSFD
CCA_STAAN         DFTMNAIAMDTAYKLYDYFDGQQDINNRIIRTVGIAEERFQEDALRMIRCLRFQSQLSFD
CCA_STAHJ         DFTINAIAMDKNFNIYDYFEGDVALNQHIIKTVGDAKERFKEDALRILRGLRFQSQLNFT
CCA_STACT         DFTINAIAMDNQFNIKDYFNGYSDIQNKLIKTVGNPYERFNEDALRILRGLRFKSQLRFE
CCA_STAES         DFTMNAIAMDLNYRLYDYFNGQQDINNRVIRTVGVPSERFSEDALRIIRGLRFQSQLNFQ
CCA_STAS1         DFTMNAIAMDINYQIFDYFEGQQDIKHQLIRTVGNPDERFDEDALRIIRGLRFQSQFGFH
CCA_BACLD         DLTINAMAMDEEGRLIDYFGGLRDIRERLIQTVGDPAERFHEDALRMLRALRFMSQLEFE
CCA_BACSU         DLTINAMAMTADGKVLDYFGGKKDIDQKVIRTVGKPEDRFQEDALRMLRAVRFMSQLGFT
CCA_BACP2         DLTINAMAMDINGEIIDHVGGKQDIERKRIQTVGDPACRFQEDALRMMRAIRFLSQLGFE
CCA_GEOSE         DFTMNAIAMDEYGTIIDPFGGREAIRRRIIRTVGEAEKRFREDALRMMRAVRFVSELGFA
CCA_GEOKA         DFTMNAIAMDERGTIIDPFGGQEAIERRLICTVGAADERFREDALRMMRAVRFVSQLGFA
CCA_BACAN         DFTMNAIAMTEEGEMVDLFAGQEAIQKREIVTVGNAADRFQEDALRMMRGIRFVSTLGFS
CCA_BACC1         DFTMNAIAMTEEGEMVDLFAGQEAIQKREIVTVGNAADRFQEDALRMMRGIRFVSTLGFS
CCA_BACCR         DFTMNAIAMTEEGKMVDLFAGQEAIQQREIVTVGNAADRFQEDALRMMRGIRFVSTLGFS
C3BIB8_9BACI      DFTMNAIAMNEEGNIIDLFAGQEAIRKQEIATVGNAADRFQEDALRMMRGIRFVSTLGFF
CCA_LISMF         DFTMNAIAMDEHFALQDPFSGQLAIQNKEIKAVGKASERFHEDALRMMRAVRFLSQLDFE
CCA_LISIN         DFTMNAIAMDENFKLHDPFSGQLAIQNKEIKAVGKASERFHEDALRMMRAVRFLSQLDFQ
K1M1K5_9LACT      DFTINAMALDARGVLFDYHDGLKDLEDQKIRAVGQAHDRFQEDALRMMRAIRFASQLGFE
C6CUG0_PAESJ      DLTINAMAMNAAGELYDPFRGLNDLKNRTIRCVGDADARFQEDALRMLRTIRFASQFEFT
                  *:*:**:*      : *   *   :    :  **    ** **.**::*  ** : :   

CCA_LACPL         IESQTEQAIADNAALLAKIAVERTRVEWEKLLMGQHPVAGLTGLLTTDLYRYMPAMADQE
CCA_LACSS         VTETTQAAIEKHAALLEKIAIERIHVEFMKLMQGIERQNGLRTFIDTGLYRYCPDLADQL
W9ELP7_9LACO      IEKQTLVAMYHKAALLEKISIERINAEFSKMMLGQTPMHGLEQMIKTKILQHIPVLSAYE
CCA_ENTFA         IEEKTLAAIAEFHPLLEKISVERITIEFVKMLLGVNRQGGLAPFIETECYQYCPKLREQG
CCA_LACH4         LEEKTEQAIKDNHELLKKISVERIREEFVKMGIGPHSRQAFQIFLDTQLSEDVPDFAGKK
CCA_LACDB         LEEKTRQAIINNHELLSKISVERIREEFVKLALGKDSRQAFKDFLATGLSEECPGLAGKK
CCA_LEUCK         IAPHTKAALKQIGRNLEKIAVERIRVEFEKLLMGQYASNSLSVAIEADLIRYLPGHIKKE
CCA_LEUMM         IEADTQKALVDLAPNLAKIAVERVRVEFEKLLLGSQASQSLELALRDQVMNYLPGPHI-E
CCA_STRT1         IEEKTFEAMTSHAFLLEKISIERSFIEFDKLLLAPHWKKGIKALLATKAYQYLPDFQETA
CCA_STRMU         IEKKTFIAMREHAPLLEKISVERSFIEFDKLLRAPYWRKGINCLIASQAYDYLPLLQSTA
CCA_STRP6         IEAATFEAMRSHSPLLEKISVERSFTEFDKLLMAPHWRKGISAMIACQAYDYLPGLKQQE
CCA_STRP1         IEAITFEAMRSHSPLLEKISVERSFTEFDKLLMAPHWRKGISAMIACQAYDYLPGLKQQE
CCA_STRP3         IEAATFEAMRSHSPLLEKISVERSFTEFDKLLMAPHWRKGISAMIACQAYDYLPGLKQQE
CCA_STRA3         IETTTFEAMKKHASLLEKISVERSFIEFDKLLLAPYWRKGMLALIDSHAFNYLPCLKNRE
CCA_STRR6         LEPETFKAMKTLTPLLEKISVERTFVEFDKLLLAPFWRRGLASMIESQAYDYLPDMASSQ
CCA_LACLA         IENKTFLAMCESAHLLEKISVERIFIEFDKLLLGQDWRNGLTLLLKSGAYKYLPDLQDSA
CCA_OCEIH         IQEDTLEAMFVIRKQIQHLAVERITIELTKLFQGQHVSKAIQYIIDLQLDEQLPIFQSGK
W9A9C8_9BACI      LDIETKNQIRSLNKEINTVAVERIAVEMEKFFAGDYISEAMKELKTTELFNNLPVFKYQP
K0IY12_AMPXN      LDRNTWEEIKNNAALIEKLSIERITVEIEKMFLGKALKKAIDYCYQARLFSHLPIFKPKE
I0JN84_HALH3      VENGTRQAISAKSSLLRYISVERIAVETLKLYRGRGYKKAISMVSDTNLITYLPIFNTIA
S2YN32_9BACL      IDDKSLEAIQFCAENLTYVSVERVTAELEKMWDSSNLQNGMSYLVTSKLSDQLPGGFPFQ
CCA_STAAC         IATETFEAMRIQMADIKFLSIERIVIELTKLMRGINVEKSFNHLKSLKAFNYMPYFEHLD
CCA_STAAS         IATETFEAMRIQMADIKFLSIERIVIELTKLMRGINVEKSFNHLKSLKAFNYMPYFEHLD
CCA_STAAN         IAMETFEAMRTQMADIKFLSIERIVIELTKLMRGINVEESFNHLKSLKAFNYMPYFEQLD
CCA_STAHJ         IEGDTFEAMKHQIADVEHLSIERIVVELKKLIKGQNVSQSYLNLIDLNFFNYVPFFRSLD
CCA_STACT         IDSDTYKAMQEKIADTEYLSIERIIIELRKLLEGTDASIVYPLLNELQFFKYVPFFKSFN
CCA_STAES         IDSDTLHAMSSQISDIQYLSVERVVVELKKLIMGNNVKQSFEVMQNMKAFNYIPFFKSFE
CCA_STAS1         LEEATFTAMLNHIADIKYLAIERIVVELKKLTNGDFVSKSFNNLKHFMAFKYIPFFKHYD
CCA_BACLD         LSPNTKKAICENRPLLAHISTERKTVEFEKLLKGKAAGRALEAAAETGLYKELPGLDGKK
CCA_BACSU         LSPETEEAIAKEKSLLSHVSVERKTIEFEKLLQGRASRQALQTLIQTRLYEELPGFYHKR
CCA_BACP2         LAAETAEAMEKDKHLLANISVERKKIEMEKLLKGRYCERAIKVLISTKLYEELPGLE-KD
CCA_GEOSE         LAPDTEQAIVQNAPLLAHISVERMTMEMEKLLGGPFAARALPLLAETGLNAYLPGLAGKE
CCA_GEOKA         LSEDTKSAIVQNAPLMAHISVERMTMEMEKLLAGPFVAEALPLLADTGLFAYLPGLAAKV
CCA_BACAN         LETKTKQAIETYGHLLEHIAIERITVEFEKLLTGTYCVKGLKELVETKLFSHLPYLQMSE
CCA_BACC1         LETKTKQAIETYGHLLEHIAIERITVEFEKLLTGTYCVKALKELVETKLFSHLPYLQMSE
CCA_BACCR         LEMKTKQAIETYGHLLEHIAIERITVEFEKLLTGTYCVKGLKELVETKLFSHLPYLQMSE
C3BIB8_9BACI      LEEQTKRAIEEYGHLLEHIAIERITVEFEKLLTGKYCVNGLQQLVETKLVTHLPYLQMSE
CCA_LISMF         LDKETEKALESQIELLQHTSVERITVEWLKMMKGKAAKRAIELLLKVKMETYLPGLKDEK
CCA_LISIN         LDKETETALTNQIALLQHTSVERITVEWIKMIKGQAVKRAIDLLLKVEMETYLPGFKGEK
K1M1K5_9LACT      LESQTYIAIQALSKNLAYISIERIRIEFEKTMLGRHFNCCLPLIKESHLLDHF-PLYNGQ
C6CUG0_PAESJ      IAHTTWRALVRHRELLRHIAMERVHAELDRMIGGAHPGRALHLLAASKLLRYTGTVLPAA
                  :   :   :          : **   *  :   .                          

CCA_LACPL         AMLRQLMA-LPAWHLPSIESTWTLLSWTMQRTDEAAVRQ--------LLKTWKTSNELIN
CCA_LACSS         LALERLTA-LPTEQLHDESAVWLVVTYLLGQTPAQAGR---------FLKHWKSANDVID
W9ELP7_9LACO      PQLQQLISHVPAVRLKTNVEVWTLLAVALRLNSTKLKH---------LLRTWKNSNQLLN
CCA_ENTFA         AGLFRLMD-LPARQIETEAEAWTLLIQSLNLPEAEIRS---------FLKAWKLSNQLIQ
CCA_LACH4         ELLQIYPQ--LQFSPTLETSLWSLIIILLKLPDEDISK---------FMRDWKNSNAMTE
CCA_LACDB         DQLSVLTD--LKAGPDDEAVFWSLIAVLINLPADKISP---------FMRAWKNSNAMNQ
CCA_LEUCK         DWLTITAD-LKRNQPQARTVIWPYFLSRLSLRLNELQL---------FMRSWKTSREDMR
CCA_LEUMM         DWSSIIDD-LNKDQATNYTVAWAHILSRTQFDDKKRRQ---------FMYDWKMSRNVMK
CCA_STRT1         EEWQSFVA-DYAEDFRFTSSEQAWAATLLALKHDNPRS---------FLKKWKTSVNFQK
CCA_STRMU         DKWQQLLT-DLPEDFTFSTSEQAWAAVLLYLNVENPRS---------FLKSWKTSNDFQK
CCA_STRP6         AGLNHLIV-SLKDNFTFSDHHQAWAYVMISLAIEDPKS---------FLKAWKTSNDFQR
CCA_STRP1         AGLNHLIV-SLKDNFTFSDYHQAWAYVMISLAIEDPKS---------FLKAWKTSNDFQR
CCA_STRP3         AGLNHLIV-SLKDNFTFSDHHQAWAYVMISLAIEDPKS---------FLKAWKTSNDFQR
CCA_STRA3         LQLSAFLS-QLDKDFLFETSEQAWASLILSMEVEHTKT---------FLKKWKTSTHFQK
CCA_STRR6         DKLNRLF--DLETDFTFESSEQAWAALLWALEIENAQS---------FLKSWKTSRQFAK
CCA_LACLA         --LKKVLT-DLSVDFHFQNSEQAWAALLTRFSNVDVKT---------FLRKWKVSNEFAK
CCA_OCEIH         SDIFKAMKENITPLHSFSEV-IAVFHLLDPTI--KIHD---------WIKNYKCSNHVKN
W9A9C8_9BACI      S-LINLLPAEQTPLHSLAEM-FAFFHFLYPQI--SVNT---------WIKEWKASNQSKR
K0IY12_AMPXN      NMIDHILTVEQPFIELIDLF-VYLTIITNEEI--TINQ---------WCQAYKLSNKAKN
I0JN84_HALH3      SFTNIAPLVR---LSSWPEL-VTYYLTYAPSF--SIKE---------WMKRWKLSNKERR
S2YN32_9BACL      HEKWAQLGNP----RNSLIC-WSFLCLLQETS--SVSE---------LTRTFKLSNESKQ
CCA_STAAC         MNQINVTEAIDLELLIAIVS-VKF-DINYSLK--PLKL---------SNRQVKDINQYIQ
CCA_STAAS         MNQINVTEAIDLELLIAIVS-VKF-DINYSLK--PLKL---------SNRQVKDINQYIQ
CCA_STAAN         MNQINVTEPIDLELLIAIVS-VKF-DINYSLK--PLKL---------SNRQVKDINQYIQ
CCA_STAHJ         MKQTKVNSPISFELWIAILL-TVE-QTNTSLS--DLKI---------SNNEKTKINQYHK
CCA_STACT         TSAIEIKDPIKLELLIAIMS-FKQ-SSNISLS--MLKI---------SNDSKKKIQKYIT
CCA_STAES         MSHLHIDEPITFELWIAILI-VQQ-PKDIQLS--TLKI---------SNQEKATIKKWVT
CCA_STAS1         ITKFTLRNAMPFTTFVAFLI-SQQREIDANIA--DLKV---------SNNEKKRIKTLVQ
CCA_BACLD         ERVLAARAFPFYQLQKSADI-WAAFIHMISINPAEAHR---------FLKGWKLPGKVIR
CCA_BACSU         ENLISTSEFPFFSLTSREEL-WAALLINLGIVLKDAPL---------FLKAWKLPGKVIK
CCA_BACP2         RLQDSFQTFPYYLLDGLEEV-WGAVIHLLGLDEEKAVL---------FLKEWKLSTKLLK
CCA_GEOSE         KQLRLAAAYRWPWLAAREER-WALLCHALGVQ--ESRP---------FLRAWKLPNKVVD
CCA_GEOKA         QLLRSAAAFRWPWLTKREER-WALLCRALDVK--DIRP---------FLRAWKLPNKVID
CCA_BACAN         ERLLKATQYNWDSFETDIEA-WAFFLYCIGEE--HPSV---------FLRQWKFSNKKIK
CCA_BACC1         ERLLKATQYNWDSFETDIEA-WAFFLYCIGEE--HPAV---------FLRQWKFSNKKIK
CCA_BACCR         ERLLKATQYKWDSFETDIEA-WAFFLYCIGEE--HPSV---------FLRQWKFSNKKIK
C3BIB8_9BACI      ERILKAMQYNWGFFETDIEA-WAFFLYCIGEE--HPSV---------FLRQWKFSNKKIK
CCA_LISMF         SALSEFASWDWEKRTTEESI-WLGLVVAVKPN--NVNA---------FLKAWKLPNKTIQ
CCA_LISIN         SALMEFASWNWEKRTTETAI-WLGLVIAVKPS--NITA---------FLKAWKLPNKTIQ
K1M1K5_9LACT      RYCLGMDALANEISDLKDYSIVQAWAFLLRGMELSES----------SDRQNLLKKWTLS
C6CUG0_PAESJ      EKLAQVDPSYSELDKLNDPDARYAALLLAEGITLSDAEETLKALRLPTQKMNAILSVLFV
                                                                              

CCA_LACPL         HVTAAIKALMALKHNGQLTAQENFYTGLEALKTANQVATILGFGQ----DQAQLVQSYAS
CCA_LACSS         AVKAGL-VLLPKLLTATADQWDLYQAGQAVLVISLQIAQMVTTATI---PTADWLERYDR
W9ELP7_9LACO      ETVIAT-QAAQTMCQRELTAWELYQTGWVLLQQSAHVALLYRSTI----SLARLQKQYQK
CCA_ENTFA         NVSQLV-RGLRFRLSNDWQPMMLYELGEESAVLVERLLYYYQQES----QVQVTKELVKA
CCA_LACH4         QVERII-KFFDLISDHTPNDYELFQAGERTIINTIDVAHILGQPV----ASEALVDRYLA
CCA_LACDB         QVRQIV-AAFDLLSRGEESDFDLFEIGQENLEAALKLAGLLGKPL----SSQVLLDRYNR
CCA_LEUCK         AVLSIV---PIVKHVQTVSVFELYAI-YDYQALLFEVLTLIGTPLA---TQQRVKQIFDA
CCA_LEUMM         TVNAIV---PIVHNPKKSTVFDIYQV-LAYQEELLEVLSLTGSQPE---TIQRISHIIEM
CCA_STRT1         TVQSLI-EIFRFRMEREVTKQDVYHYGKDLLKEAETLRQAQRLDV----DYERIAELDGQ
CCA_STRMU         TVEKLL-AIYRLREDRQIKKTDVYQYSATLLTLVEELRQAQGLAV----DFEHIKELDEA
CCA_STRP6         YVTKLI-ALYRIRQERSFEKLDIYQYGKEMASLVEDLRKAQSLSV----DMDRINTLDQA
CCA_STRP1         YVTKLI-ALYRIRQERSFEKLDIYQYGKKMASLVEDLRKAQSLSV----DMDRINTLDQA
CCA_STRP3         YVTKLI-ALYRIRQERSFEKLDIYQYGKEMASLVEGLRKAQSLSV----DMDHIEALDQA
CCA_STRA3         DVEHIV-DVYRIREQMGLTKEHLYRYGKTIIKQAEGIRKARGLMV----DFEKIEQLDSE
CCA_STRR6         QVQDLL-IILALRENGELSKRDCYRFDIDLLLQAENLRQAQGKEV----NPQAITEKYQS
CCA_LACLA         FVADLV-SAYELD---SWDLMSLYHFGLEKVLLVDELKVAYGLKI----NREQAVTINNQ
CCA_OCEIH         DTIQLINAYHYY-QSHGINNWLLYILPTKLWDGFIRLIY--VIDRTTIER-KQLEEITAT
W9A9C8_9BACI      NTIKLVEAVTEF-RNNGLENWIVYQLPSDLYAGFIRVLT--ALSEHAIPTLQEMRTIVSG
K0IY12_AMPXN      SGESLKHLIQLY-KHEQLSRQLVYHLPSELDDRFISLIQ--RVYQHSVSQAMI-DQIRRQ
I0JN84_HALH3      ETEELNNALNEYLVKNRVTPWLLYVLPESLQRAFARVLQ--AKGLADESILMLLKEGCKN
S2YN32_9BACL      QIGQLVKATQIRFERLFTRDDLYSFNEDILIKAESLVHV--LRDKIPPMPIDTIIKLKRS
CCA_STAAC         IMNALPSIITKEQLKMFVYDYDTHLIKNVMVAADVLKANDIQGHEPLIVNLQTIDETLHR
CCA_STAAS         IMNALPSIITKEQLKMFVYDYDTHLIKNVMVAADVIKANDIQGHEPLIVNLQTIDETLHR
CCA_STAAN         IMNALPSIITKEQLKMFVYDYDTNLIKNVMVAADVLKANDIQGHEPLIVNLQTIDETLHR
CCA_STAHJ         IMIEMPQVSSKEQLKLFVYDYGMNNIIDIIAINSILEDNNIKIASPLIFNLQSIKEIDQH
CCA_STACT         LFNKLPDIKTKKALKVFVYDYGISTLSYILDMKDTLAANQIELGHPLIFNIESIDEINQN
CCA_STAES         LIQTLPKIQSKQSLITLVYDYNLNDIEILLSLHHLLKQNGLTTANHLIINEISIREANEK
CCA_STAS1         LIDQIDEVQTKSQLKLFVYDYGKKDILEVLSYLDELKRNRITSISPLIVNDQTVTEVAKQ
CCA_BACLD         QALHTAERIDQK-----WDAVSMYEAGEETLLAASAIRSLRDKQAIDEEQLAEIRQSYQA
CCA_BACSU         EAIHIADTFGQS-----LDAMTMYRAGKKALLSAAKISQLRQNEKLDEKKLKDIQYAYQN
CCA_BACP2         DAVAISRYVDCE-----WNAEKMFEAGEHVLLSSLKITQLKHERRIFFDELEAAKSSYDA
CCA_GEOSE         EAGAILTALADIPRPEAWTNEQLFSAGLERALSVETVRAAFTGAPP-GPWHEKLRRRFAS
CCA_GEOKA         EAGAILAALDDVPRPEEWTNEQLFSAGLERALSVEAVRAALCGAPS-EPHHEELRRRFAA
CCA_BACAN         DIVAVLLTIRKR-KEKDWDTVLLYKTGIHIAEMAERVYEAMIESYD-HTSVERVQTLFQA
CCA_BACC1         DIVAVLLTVRKR-KEKDWDTVLLYKTGIHIAEMAERVYEAMIESYD-HTSVKRVQTLFQA
CCA_BACCR         DIVAVLLTIRTR-KEKDWDTVLLYKTGIHIAEMAERVYEAMIERYD-PTSVERVQSMFHA
C3BIB8_9BACI      DIVAVILAIRSR-KTKSWDAVFLYKTGLHTALMAERVYQAIIKKYD-IFSVNQVQSLFDS
CCA_LISMF         LVNKAYQDALKM--KETWLKDELYHAGKAVFSLVNELNVIRGKENN----QHKVSQAYEA
CCA_LISIN         LVNKAYEAALNM--KETWLTEELYHAQEAVFLLVNEINNIRGQSDK----EDELKKAYEL
K1M1K5_9LACT      NQRINQIQEYYQLIVNVENGAIQPIDLYSFSSQSIELLEDYLIAKEQKSLAALIRDHFDS
C6CUG0_PAESJ      QFAMNQLNQQSGLRLVWTSTVLQYGEEASRRWLSIVVWNQKHHLHDQK---NLFDKWLDA
                                                                              

CCA_LACPL         LPIHDKHELAINGGDLLKAKL-VTPGPMMGQILAACLQAVVMKQVPNQQDALLDFARMVA
CCA_LACSS         LQIKQKADLAING-QILMQNG-FQPGPILGKALAILERKVVLDELPNTTEALLKAAK---
W9ELP7_9LACO      LPIKKRGELHING-KSLLKAG-FTPGPHLGQVLEQLEKSVVAGELPNDTVALLKVAQKLN
CCA_ENTFA         LPIHQRHELAITGKDLLAVLE-ETPGKWLGELIAEIEQHVVEGSLENKQEVLLSFAKKQR
CCA_LACH4         LPIKKPAELAIDG-RFLIKHG-MRPGAELGHTLNKIRELVVSSRLENSPDAIEKYLEDLD
CCA_LACDB         LPIKAAGELAIDG-QWLIKEG-IKPSPELGQLLRKALEGVVSGQVENSQAAIAEFLAI--
CCA_LEUCK         LPITHNRDMCISGGDLLANNI-VTPGPQMGRILTQLEHAVIQRIISNRPDSLLEYAKELV
CCA_LEUMM         LPITKAADLNISGGELIRSGI-LTPGPLLGRVLKKIEYAVVVGDILNDHDALEKFAKEYV
CCA_STRT1         LLIHDKHEIVVNGGKLMKELG-FKPGPDLGRTLRAIENAIVDGELANDEESIMAFVQAMK
CCA_STRMU         LTIHDKHEIVVKGGDLMAAFD-LKPGPDLGKILNQIESFIVAGNLANERQAILDFVRKEI
CCA_STRP6         LVIHDKHDIVLNGSHLIKDFG-MKPGPQLGLMLEKVELAIVEGRLDNDFTTIEAFVREEL
CCA_STRP1         LVIHDKHDIVLNGSHLIKDFG-MKSGPQLGLMLEKVELAIVEGRLDNDFTTIEAFVREEL
CCA_STRP3         LAIHNKYDIVLNGSHLIKDFG-MKPGPQLGLMLEKVELAIVEGRLDNDFTTIEAFVREEL
CCA_STRA3         LAIHDRHEIVVNGGTLIKKLG-IKPGPQMGDIISQIELAIVLGQLINEEEAILHFVKQYL
CCA_STRR6         LTIHDKKEIQINGGILIKEYG-YQPGPDLGEILTEIEFAIVDGELENNREAIHAYLREKK
CCA_LACLA         LQIHDKSEIVIAGKDLMEEFS-LEPGPELGKILKIIEEKIVKNELKNEQAAIFAEVKKML
CCA_OCEIH         LPIDKRSQLHLDGNDLMNWFPHRPKGKWIKILLEEVEYLVVSKQLPNEKKIIKEW-VLCN
W9A9C8_9BACI      LPIENRQELEIDGNDLIKLFPDVTKGPWMQKLLNQVEYLVVMRKLTNKKEKIREW-LKWN
K0IY12_AMPXN      LPITNRREIKMNGHDLQLLYPGKPRGEWIRDYLTSIEEQIIDGSLENDFEKIKEWILKCH
I0JN84_HALH3      LPILSSRELAFQPQDLISLYADKQKGPWISEYMKEIEHQVVERHLPNDYEKIKEWALLWN
S2YN32_9BACL      LPIQSKADLVISGKDLMDWFS-KRGGPWLKEALAEIEMAVLHKKVVNDATKIKEWIMNES
CCA_STAAC         LPMHNRKDMMVNGGVLMAHLN-AKSGPWLKDVLRQIEIAIVTGKVSNEETEILKWVDNHV
CCA_STAAS         LPMHNRKDMMVNGGVLMAHLN-AKSGPWLKDVLRQIEIAIVTGKVSNEETEILKWVDNHV
CCA_STAAN         LPMHNRKDMMVNGGVLMAHLN-AKSGPWLKDVLRQIEIAIVTGKVSNEETEILKWVDNHV
CCA_STAHJ         LPIRSRRELNINGGDILRITS-KKSGPWLKEVLRQIEIDVLTNKVPNLKDELLKWVKENV
CCA_STACT         LIIRQRSDMMVNGKDILESLN-QKGGPWLKDVLRNIECAIINQEIPNQKSEIINWVKTHV
CCA_STAES         LPIHCRKELAINGKDILNHTN-KNSGPWLKDTLREIEIAVISNQIVNTKEEILEWVDAHV
CCA_STAS1         LPMLSRSEMDINGKDILEIAN-KKSGPWLKETLREVEYAIISGEVVNFKPELKKWVKTRV
CCA_BACLD         LPIKSLKDLAVSGSDLLNFRK-KPAGKWVSDDLKRIERAVLNGELANQKKAIEEWLDSCS
CCA_BACSU         LPIKSLKDLDITGKDLLALRN-RPAGKWVSEELQWIEQAVVTGKLSNQKKHIEEWLKTCG
CCA_BACP2         LPIKTLQDLAVSGKDLMAFRQ-KTSGKWIAEELDLVKKAVLHNHLENRKEAIEEWLTACD
CCA_GEOSE         LPIKTKGELAVNGKDVIEWVG-KPAGPWVKEALDAIWRAVVNGEVENEKERIYAWLMERN
CCA_GEOKA         LPIKTKGELAVNGKDVIRWAG-KPAGPWVKETLDAIWRAVVSSEVENEKERIYAWLMERN
CCA_BACAN         LPIKSRQEMDVTGNDLLNWAS-KKPGPWVAEMIQKIEEAIVQGNVVNEKECIREWLQECN
CCA_BACC1         LPIKNRQEMNVTGNDLLNWAS-KKPGPWVAEMIQKIEEAIVQGNVVNEKECIREWLQECN
CCA_BACCR         LPIQERQEMNVTGNDLLNWAN-KKPGPWVAEMLQKIEEAIVQGNVVNEKERIREWLQGCN
C3BIB8_9BACI      LSIHNRQEMKVSGNDLLGWTE-KTPGPWVAEVLQRIEEEILQERLENEKEKIREWLQGCN
CCA_LISMF         LPIHSKKDLAITGADLLKWSG-ESAGPWVKETLDKVECGVLSNEINNEKIQIKRWLGYHE
CCA_LISIN         LPIHSKKDLAITGADLLKWTG-ENAGPWVKETLDKVECQVLLGKINNEKNQIKRWLGYHE
K1M1K5_9LACT      LAIHDRKELALNGSDIMQILDMHHGGPLIGQILDYLETQVIKNNLRNDRLILEKAVQDYS
C6CUG0_PAESJ      MPAMTLKQLNLNGKQLAEELQRVTGN-WTGLMLKRLLLEVALDKLPNEKDLLLKQAQIWN
                  :      :: .              .      :      :    : *    :        

CCA_LACPL         DSKNH--
CCA_LACSS         -------
W9ELP7_9LACO      PKED---
CCA_ENTFA         SKGEKA-
CCA_LACH4         -------
CCA_LACDB         -------
CCA_LEUCK         DNEKN--
CCA_LEUMM         NDQN---
CCA_STRT1         QV-----
CCA_STRMU         D------
CCA_STRP6         AP-----
CCA_STRP1         AT-----
CCA_STRP3         AT-----
CCA_STRA3         MD-----
CCA_STRR6         -------
CCA_LACLA         -------
CCA_OCEIH         QPDPN--
W9A9C8_9BACI      PPEVN--
K0IY12_AMPXN      PPVNN--
I0JN84_HALH3      PPENN--
S2YN32_9BACL      NSEI---
CCA_STAAC         KI-----
CCA_STAAS         KI-----
CCA_STAAN         KI-----
CCA_STAHJ         KI-----
CCA_STACT         EI-----
CCA_STAES         KI-----
CCA_STAS1         -------
CCA_BACLD         QI-----
CCA_BACSU         QH-----
CCA_BACP2         QQLEND-
CCA_GEOSE         RTREKNC
CCA_GEOKA         RTHEKNC
CCA_BACAN         LL-----
CCA_BACC1         LL-----
CCA_BACCR         LL-----
C3BIB8_9BACI      LL-----
CCA_LISMF         E------
CCA_LISIN         E------
K1M1K5_9LACT      KSYNDS-
C6CUG0_PAESJ      AEDQ---