CLUSTAL format seed alignment for MF_01271

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NAGK_ECOLI      MYYGFDIGGTKIALGVFDSGRQLQWEKRVPTPRDSYDAFLDAVCELVAEADQRFGCKGSV
NAGK_SHIDS      MYYGFDIGGTKIALGVFDSGRQLQWEKRVPTPRDSYDAFLDAVCELVAEADQRFGCKGSV
NAGK_ECO57      MYYGFDIGGTKIALGVFDSGRQLQWEKRVPTPRDSYDAFLDAVCELVAEADQRFGCKGSV
NAGK_SHISS      MYYGFDIGGTKIALGVFDSGRQLQWEKRVPTPRDSYDAFLDAVCELVAEADQRFGCKGSV
NAGK_ECOL5      MYYGFDIGGTKIALGVFDSGRQLQWEKRVPTPRDSYDAFLDAVCELVAEADRRFGCKGSV
NAGK_ECOUT      MYYGFDIGGTKIALGVFDSGRQLQWEKRVPTPRDSYDAFLDAVCELVAEADRRFGCKGSV
NAGK_ECOL6      MYYGFDIGGTKIALGVFDSGRQLQWEKRVPTPRDSYDAFLDAVCELVAEADRRFGCKGSV
NAGK_SHIBS      MYYGFDIGGTKIALGVFDSGRQLQWEKRVPTPRDSYDAFLDAVCELVAEADQRFGCRGSV
NAGK_SHIFL      MYYGFDIGGTKIALGVFDSGRQLQWEKRVPTPRDSYDAFLDAVCELVAEADQRFGCKGSV
NAGK_SALCH      MYYGFDIGGTKIALGAFDSTRRLQWEKRVPTPHTSYSAFLDAVCELVAEADQRFGVKGSV
NAGK_SALTI      MYYGFDIGGTKIALGVFDSTRRLQWEKRVPTPHTSYSAFLDAVCELVAEADQRFGVKGSV
NAGK_SALTY      MYYGFDIGGTKIALGVFDSTRRLQWEKRVPTPHTSYSAFLDAVCELVEEADQRFGVKGSV
NAGK_SALPA      MYYGFDIGGTKIALGVFDSTRRLQWEKRVPTPHASYGAFLDAVCELVAEADQRFGVKGSV
NAGK_PECAS      MYYGFDMGGTKIELGVFDAELNKVWQKRVPTPRNNYDDLLAMLIDLVHEADAQVGVQGSV
NAGK_YERPS      MYYGFDMGGTKIELGVFDENLQRIWHKRVPTPREDYPQLLQILRDLTEEADTYCGVQGSV
NAGK_VIBVU      MYYGFDVGGTKIEFGAFNEKLERVATERVPTPTDDYPLLLETIAGLVAKYDQEFACEGKI
NAGK_VIBVY      MYYGFDVGGTKIEFGAFNEKLERVATERVPTPTDDYPLLLETIAGLVAKYDQEFACEGKI
NAGK_VIBPA      MYYGFDVGGTKIEFGAFNEKLERVATERVPTPTDNYELLVDTIAELVNKYDAEFGCEGTI
NAGK_VIBCH      MYYGFDVGGTKIEFGAFNEQLERVATERVATPTDDYAKLVETIAGLVHKYDAQFGVEGTV
NAGK_ALIF1      MYYGFDVGGTKIEFGAFNEKLERVATERIPTQTENYSLLVDDIASLIAKYDAEFGVEGKV
NAGK_PHOPR      MYYGFDVGGTKIEFGAFNEKLERVATERVATPRDDYDKLVDTIVGIIQKADNDLGCEGLV
NAGK_HAEIN      MYYGLDIGGTKIELAVFNEKLEKLYSERVPTPKTDYEEWLNTIVDLVNRADEKFGEVGTV
NAGK_HAEI8      MYYGLDIGGTKIELAVFNEELEKLYSERVPTPKTDYEEWLNTIVDLVNRADEKFGEVGTV
NAGK_HAES1      MYYGFDIGGTKIELAVFNEKLEKRYSERVDTPKHSYDEWLNVITHLVQKADEKFACKGTV
NAGK_MANSM      MLYGFDIGGTKIELAVFNDKLERQYTERVETPKDSYEQWLDVIVNLVEKADQKFACKGSV
NAGK_PASMU      MRYGFDIGGTKIELAVFNDQLEKQYSERVETPKESYEEWLNTIVRLVHKADEMFQCQGTV
                * **:*:***** :..*:   .    :*: *   .*   :  :  :  . *      * :

NAGK_ECOLI      GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_SHIDS      GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECO57      GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_SHISS      GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECOL5      GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECOUT      GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECOL6      GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_SHIBS      GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_SHIFL      GIGIPGMPETEDGKLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_SALCH      GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_SALTI      GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_SALTY      GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_SALPA      GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_PECAS      GIGVPGIQTGDEGALFTANLPATMGKPLRIDLSQRLQRDVRISNDANCFVLSEAWDAEFR
NAGK_YERPS      GIGIPGLPNADDGTVFTANVPSAMGQPLQADLSRLIQREVRIDNDANCFALSEAWDPEFR
NAGK_VIBVU      GLGLPGMEDADDATVLTVNVPAAKGKPLRADLEAKIGRSVKIENDANCFALSEAWDEELQ
NAGK_VIBVY      GLGLPGMEDADDATVLTVNVPAAKGKPLRADLEAKIGRSVKIENDANCFALSEAWDEELQ
NAGK_VIBPA      GLGLPGMEDADDATVLTVNVPAAKGKPLRADLEAKIGRSVKIENDANCFALSEAWDEELQ
NAGK_VIBCH      GLGIPGMEDADNGCVLTVNVPAAKGKPLRADLETKLGRAVKVENDANCFALSEAWDDELK
NAGK_ALIF1      GLGIPGMEDAETGALLTSNVPAAKGQFLRKDLEAKIGRSVKIDNDANCFALSEAWDEELK
NAGK_PHOPR      GIGLPGMEDARDGSVLTSNIPAAKGRFLRKDLEAKLGRTVTIDNDANCFALSEAWDESLQ
NAGK_HAEIN      GLGVPGFVNQQTGLAEIANIRVADNKPILCDLSTRLGREVRAENDANCFALSEAWDTENQ
NAGK_HAEI8      GLGVPGFVNQQTGLAEITNIRVADNKPILRDLSVRLGREVRAENDANCFALSEAWDTENQ
NAGK_HAES1      GIGVPGFVNQETGIAEITNIRVADNKPILKDLSERLGREVRAENDANCFALSEAWDKDNQ
NAGK_MANSM      GLGLPGFVNHETGIAEITNIRVADNKPIIKDLSERLGREVRAENDANCFALSEAWDEENQ
NAGK_PASMU      GLGIPGFVNPATGIAEIVNIRAADHKPIIQDLETRLGREVRAENDANCFALSEAWDEENA
                *:*:**:     .     *:  :  : :  **.  : * *  .******.****** .  

NAGK_ECOLI      QYPLVMGLILGTGVGGGLIFNGKPITGKSYITGEFGHMRLPVDALTMMG-LDFPLRRCGC
NAGK_SHIDS      QYPLVMGLILGTGVGGGLIFNGKPITGKSYITGEFGHMRLPVDALTMMG-LDFPLRRCGC
NAGK_ECO57      QYPLVMGLILGTGVGGGLIFNGKPITGKSYITGEFGHMRLPVDALTMMG-LDFPLRRCGC
NAGK_SHISS      QYPLVMGLILGTGVGGGLIFNGKPITGKSYITGEFGHMRLPVDALTMMG-LDFPLRRCGC
NAGK_ECOL5      QYPLVMGLILGTGVGGGLIFNGKPITGKSYITGEFGHMRLPVDALTMMG-LDFPLRRCGC
NAGK_ECOUT      QYPLVMGLILGTGVGGGLIFNGKPITGKSYITGEFGHMRLPVDALTMMG-LDFPLRRCGC
NAGK_ECOL6      QYPLVMGLILGTGVGGGLIFNGRPITGKSYITGEFGHMRLPVDALTMMG-LDFPLRRCGC
NAGK_SHIBS      QYPLVMGLILGTGVGGGLIFNGKPITGKSYITGEFGHMRLPVDALTMMG-LDFPLRRCGC
NAGK_SHIFL      QYPLVMGLILGTGVGGGLVFNGKPITGKSYITGEFGHMRLPVDALTMMG-LDFPLRRCGC
NAGK_SALCH      QYPLVMGLILGTGVGGGLVLNGKPITGQSYITGEFGHMRLPVDALTLMG-FDFPLRRCGC
NAGK_SALTI      QYPLVMGLILGTG-GGGLVLNGKPITGQSYITGEFGHMRLPVDALTLMG-FDFPLRRCGC
NAGK_SALTY      QYPLVMGLILGTGVGGGLVLNGKPITGQSYITGEFGHMRLPVDALTLMG-FDFPLRRCGC
NAGK_SALPA      QYPLVMGLILGTGVGGGLVLNGKPITGQSYITGEFGHMRLPVDALTLMG-FDFPLRRCGC
NAGK_PECAS      SYPVVLGLILGTGLGGGLVINGRPVDGRNGIAGEFGHLRLPSDALDIIG-VDIPRVKCGC
NAGK_YERPS      TYPTVLGLILGTGVGGGLIVNGSIVSGRNHITGEFGHFRLPVDALDILG-ADIPRVPCGC
NAGK_VIBVU      DAPSVMGLILGTGFGGGLIYEGKVFSGRNNVAGELGHMRLPLDAWFHLG-DNAPLLGCGC
NAGK_VIBVY      DAPSVMGLILGTGFGGGLIYEGKVFSGRNNVAGELGHMRLPLDAWFHLG-DNAPLLGCGC
NAGK_VIBPA      DEPSVLGLILGTGFGGGFIYDGKVFSGRNHVAGEVGHTRLPIDAWFHLG-ENAPLLGCGC
NAGK_VIBCH      EAASVMGLILGTGFGGGLVYEGKVFSGRNHVAGEIGHMRLPIDAWFHLG-EKAPLLGCGC
NAGK_ALIF1      DSPSVMGLILGTGFGGGLIFDGKAFSGYSHVAGELGHSRLPIDAWFHLG-ENAPLLECGC
NAGK_PHOPR      GEKSVLGLILGTGFGGGLVFDGHVFSGMNHVAGELGHTRMPIDAWFSLG-EKAPLFTCGC
NAGK_HAEIN      QYSTVLGLILGTGFGGGFVLNGKVHSGQVGMAGELGHLQLNYHALKLLGWDNAPIYQCGC
NAGK_HAEI8      QYPTVLGLILGTGFGGGFVLNGKVHSGQVGMAGELGHLQLNYHALKLLGWDNAPIYQCGC
NAGK_HAES1      QYPVVLGLILGTGFGGGLVFNGKVHSGQSGMAGELGHLQLNYHALKLLGWDKAPIYECGC
NAGK_MANSM      QYPFVLGLILGTGFGGGLIFNGKVHSGQIGMAGELGHLQLNYHALKLLGWDKAPIYDCGC
NAGK_PASMU      QYPSVLGLILGTGFGGGLIFNGKVHSGQTGMAGEVGHTQLNYHALRLLGGDNAPIYDCGC
                    *:******* ***:: :*    *   ::**.** ::  .*   :*  . *   ***

NAGK_ECOLI      GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN
NAGK_SHIDS      GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN
NAGK_ECO57      GQHGCIENYLSGRGFAWLYQHYYHQPLPAPEIIALYDQGDEQARAHVERYLDLLAVCLGN
NAGK_SHISS      GQIGCIENYLSGRGFAWLWQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN
NAGK_ECOL5      GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN
NAGK_ECOUT      GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN
NAGK_ECOL6      GQYGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGN
NAGK_SHIBS      GQHGCIENYLSGRGFAWLYQHYYHQQLQAPEIIALYNQGDEQARAHVERYLDLLAVSLGN
NAGK_SHIFL      GQHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVSLGN
NAGK_SALCH      GQMGCIENYLSGRGFAWLYQHYYDQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGN
NAGK_SALTI      GQMGCIENYLSGRGFAWLYQHYYDQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGN
NAGK_SALTY      GQMGCIENYLSGRGFAWLYQHYYDQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGN
NAGK_SALPA      GQMGCIENYLSGRGFAWLYQHYYHQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGN
NAGK_PECAS      GQFGCIENYISGRGFEWLYEHLYGEALPAVTIIRHYRGGEEKALEFVDRFMDLLAACLGN
NAGK_YERPS      GHRGCIENYISGRGFEWMYSHFYQHTLPATDIIAHYAAGEPKAVAHVERFMDVLAVCLGN
NAGK_VIBVU      GKKGCLDSYLSGRGFELLYAHYYGEEKKAIDIIKANAAGDEKAAEHVERFMELLAICFGN
NAGK_VIBVY      GKKGCLDSYLSGRGFELLYAHYYGEEKKAIDIIKANAAGDEKAAEHVERFMELLAICFGN
NAGK_VIBPA      DKKGCLDSYLSGRGFELLYAHYYGEEKKAIDIIKAHAEGEAKAVEHVERFMELLAICFAN
NAGK_VIBCH      GNKGCMDNYLSGRGFELLYEHYYGEKKKAIDIITAQKEGESKAVEHVERFMELLAICFAN
NAGK_ALIF1      GNKGCIDNYLSGRGFELLYAHYYGEQKKAIDIIKAHAEGDANAVEHVDRFMELLAICFAN
NAGK_PHOPR      DNKGCIDNYLSGRGFEQLYAHYYGENLKAIEIIKLHATGEAKAVEHVDRFMEMLAICLAN
NAGK_HAEIN      GNKACLDNYLSGRGFEMLYQDLKGETLSARKIINLFYQSNESAVDFVNLFVELAAISIGN
NAGK_HAEI8      GNKACLDNYLSGRGFEMLYRDLKGETLSAREIIDLFYQGNESAVDFVNLFVELAAISIGN
NAGK_HAES1      GNKACLDTYLSGRGFEMLYRDLQGKALSAKEIIRCFYDKDESAVKFVELFIELCAISIGN
NAGK_MANSM      GNRACLDTYLSGRGFEMLYRDLKGEALSAKEIIERFYAADKTAVDFVGLFIELCAISLGN
NAGK_PASMU      GNRACLDTYLSGRGFEMLYRDMQGEALSAQAIIQRFYAGDQSAVKFVELFIELCAISIGN
                .: .*::.*:*****  :: .   .   *  **      :  *  .*  :::: * .:.*

NAGK_ECOLI      ILTIVDPDLVVIGGGLSNFPAITTQLADRLPRHLLPVARVPRIERARHGDAGGMRGAAFL
NAGK_SHIDS      ILTIVDPDLVVIGGGLSNFPAITTQLADRLPRHLLPVARVPRIERARHGDAGGMRGAAFL
NAGK_ECO57      ILTIVDPDLVVIGGGLSNFPAITTQLADRLPRHLLPVARVPRIERARHGDAGGMRGAAFL
NAGK_SHISS      ILTIVDSDLVVIGGGLSNFPAITTQLADRLPRHLLPVARVPRIERARHGDAGGMRGAAFL
NAGK_ECOL5      ILTIVDPDLVVIGGGLSNFPAITTQLAERLPRHLLPVARVPRIERARHGDAGGMRGAAFL
NAGK_ECOUT      ILTIVDPDLVVIGGGLSNFPAITTQLAERLPRHLLPVARVPRIERARHGDAGGMRGAAFL
NAGK_ECOL6      ILTIVDPDLVVIGGGLSNFPAITTQLAERLPRHLLPVARVPRIERARHGDAGGMRGAAFL
NAGK_SHIBS      ILTIVDPDLVVIGGGLSNFPAITTQLADRLPCHLLPVARVPRIERARHGDAGGMRGAAFL
NAGK_SHIFL      ILTIVDPDLVVIGGGLSNFPAITTQLADRLPCHLLPVARVPRIERARHGDAGGMRGAAFL
NAGK_SALCH      ILTIVDPDLLVIGGGLSNFTAITTQLAERLPRHLLPVARAPRIERARHGDAGGMRGAAFL
NAGK_SALTI      ILTIVDPDLLVIGGGLSNFTAITTQLAERLPRHLLPVARAPRIERARHGDAGGMRGAAFL
NAGK_SALTY      ILTIVDPDLLVIGGGLSNFTAITTQLAERLPRHLLPVARAPRIERARHGDAGGMRGAAFL
NAGK_SALPA      ILTIVDPDLLVIGGGLSNFTAITTQLAERLPRHLLPVARAPRIERARHGDAGGMRGAAFL
NAGK_PECAS      LLTLFDPHLLVLGGGLSNFDEIYQILPTRLPSRLLPIAKLPRIEKARHGDAGGVRGAALL
NAGK_YERPS      LLTMLDPHLVVVGGGLSNFEKIYQELPKRLPAHLLRVARLPRIEKARYGDSGGVRGAAFL
NAGK_VIBVU      IFTANDPHVVALGGGLSNFELIYEEMPKRVPKYLLSVAKCPKIIKAKHGDSGGVRGAAFL
NAGK_VIBVY      IFTANDPHVVALGGGLSNFELIYEEMPKRVPKYLLSVAKCPKIIKAKHGDSGGVRGAAFL
NAGK_VIBPA      IFTATDPHVVVLGGGLSNFELIYEEMPKRIPKYLLSVAKCPKIIKAKHGDSGGVRGAAFL
NAGK_VIBCH      IFTANDPHVVVLGGGLSNYDLIYEEMPKRVPKHLLSVAKCPKIVKAKHGDSGGVRGAAFL
NAGK_ALIF1      LFTCFDPHVVALGGGLSNFELIYEELPKRLPKHLLSVGRVPRIIKAKHGDSGGVRGAAFL
NAGK_PHOPR      IFTGLDPHVVVLGGGLSNFELLYQELPKRIAKHLLSVAQVPKIVKAKHGDAGGVRGAAFL
NAGK_HAEIN      IITAFDPHMIVLGGGLSNFDYLYEALPKALPPHLMRKAKVPPIKKAKHGDSGGVRGAAAL
NAGK_HAEI8      IITAFDPHMIVLGGGLSNFDYLYEALPKALPPHLMRTAKVPPIKKAKHGDSGGVRGAAAL
NAGK_HAES1      IITALDPHVIILGGGLSNFDYLYEALPKALPQHLMRTAKVPLIKKAKFGDSGGVRGAAAL
NAGK_MANSM      IITALDPHVIVLGGGLSNFDYLYEALPKALPKHLMRSAKVPVIKKAKYGDSGGVRGAAAL
NAGK_PASMU      LITVLDPHVIVLGGGLSNFDYLYEALPKALPARLLRSANVPLIKKAKYGDSGGVRGAAAL
                ::*  *..:: :******:  :   :.  :.  *:  .. * * :*:.**:**:***: *

NAGK_ECOLI      HLTD-
NAGK_SHIDS      HLTD-
NAGK_ECO57      HLTD-
NAGK_SHISS      HLTD-
NAGK_ECOL5      HLTD-
NAGK_ECOUT      HLTD-
NAGK_ECOL6      HLTD-
NAGK_SHIBS      HLTD-
NAGK_SHIFL      HLTD-
NAGK_SALCH      HLTD-
NAGK_SALTI      HLTD-
NAGK_SALTY      HLTD-
NAGK_SALPA      HLTD-
NAGK_PECAS      HLMDN
NAGK_YERPS      HLAEK
NAGK_VIBVU      NIKG-
NAGK_VIBVY      NIKG-
NAGK_VIBPA      HIK--
NAGK_VIBCH      NIK--
NAGK_ALIF1      NIKD-
NAGK_PHOPR      NIKK-
NAGK_HAEIN      FLTK-
NAGK_HAEI8      FLTK-
NAGK_HAES1      FLSRD
NAGK_MANSM      FLTK-
NAGK_PASMU      FLSK-
                 :