CLUSTAL format seed alignment for MF_01279

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PEPQ_ECOLI       ----MESLASLYKNHIATLQERTRDALARFKLDALLIHSGELFNVFLDDHPYPFKVNPQF
PEPQ_SHIFL       ----MESLASLYKNHIATLQERTRDALARFKLDALLIHSGELFNVFLDDHPYPFKVNPQF
PEPQ_SHIBS       ----MESLASLYKNHIATLQERTRDALARFKLDALLIHSGELFNVFLDDHPYPFKVNPQF
PEPQ_SHISS       ----MESLASLYKNHIATLQERTRDALARFKLDALLIHSGELFNVFLDDHPYPFKVNPQF
PEPQ_ECO57       ----MESLASLYKNHIATLQERTRDALTRFKLDALLIHSGELFNVFLDDHPYPFKVNPQF
PEPQ_SHIDS       ----MESLASLYKNHIATLQERTRDALTRFKLDALLIHSGELFNVFLDDHPYPFKVNPQF
PEPQ_ECOK1       ----MESLASLYKNHIATLQERTRDALARFKLDALLIHSGELFNVFLDDHPYPFKVNPQF
PEPQ_ECOL5       ----MESLASLYKNHIATLQERTRDALARFKLDALLIHSGELFNVFLDDHPYPFKVNPQF
PEPQ_ECOL6       ----MESLASLYKNHIATLQERTRDALARFKLDALLIHSGELFNVFLDDHPYPFKVNPQF
PEPQ_ECOUT       ----MESLASLYKNHIATLQERTRDALARFKLDALLIHSGELFNVFLDDHPYPFKVNPQF
PEPQ_SHIF8       ----MESLASLYKNHIATLQERTRDALARFKLDALLIHSGELFNVFLDDHPYPFKVNPQF
PEPQ_SALCH       ----MESLAALYKNHIVTLQERTRDVLARFKLDALLIHSGELFNVFLDDHPYPFKVNPQF
PEPQ_SALPA       ----MESLAALYKNHIVTLQERTRDVLARFKLDALLIHSGELFNVFLDDHPYPFKVNPQF
PEPQ_SALTI       ----MESLAALYKNHIVTLQERTRDVLARFKLDALLIHSGELFNVFLDDHPYPFKVNPQF
PEPQ_SALTY       ----MESLAALYKNHIVTLQERTRDVLARFKLDALLIHSGELFNVFLDDHPYPFKVNPQF
PEPQ_PECAS       ----MEKLASLYHHHLATLQTRAQAVLARHKLDALLIHSGELLTVFLDDHDYPFKVNPQF
PEPQ_YERPA       ----METLASLYNEHLSTLQQRTRDVLERHQLDALLIHSGELQRLFLDDRDYPFKVNPQF
PEPQ_YERPE       ----METLASLYNEHLSTLQQRTRDVLERHQLDALLIHSGELQRLFLDDRDYPFKVNPQF
PEPQ_YERPN       ----METLASLYNEHLSTLQQRTRDVLERHQLDALLIHSGELQRLFLDDRDYPFKVNPQF
PEPQ_YERPP       ----METLASLYNEHLSTLQQRTRDVLERHQLDALLIHSGELQRLFLDDRDYPFKVNPQF
PEPQ_YERPS       ----METLASLYNEHLSTLQQRTRDVLERHQLDALLIHSGELQRLFLDDRDYPFKVNPQF
PEPQ_YERE8       ----METLASLYNEHLSTLQQRTRDVLERHQLDALLIHSGELQRIFLDDRDYPFKVNAQF
PEPQ_PHOLL       ----MEKLASLYHEHISTLQQRTCEALARNQFDALLIHSGELQHIFLDDRDYPFKVNACF
PEPQ_SODGM       ----MESLSSLYRDHIATLQQRTREILQRQQLEGLLIHAGEPISRFLDDHDYPFKVNPQF
PEPQ_AERHH       ----MSSYSQLFAQHLDTLQQRTRDILQQQGLSGLAIHSGQTHRIFLDDQDYPFKVNPQF
PEPQ_AERS4       ----MSSYSQLFAQHLDTLQHRTRDILQQQGLSGLAIHSGQTHRIFLHDQDYPFKVNPHF
PEPQ_COLP3       MTTLNAKLASQYPAHIAQLQQMTKSVLSRENLEGLVIHSGQEVKAFLDDNCYPFKVNPHF
PEPQ_PSET1       ----MDKLAVLYAEHIATLQQRTRTICEREGLEGLVIHSGQAKRQFLDDMYYPFKVNPHF
PEPQ_PSEA6       ----MQQLAELYPQHISELQSRTKEALSREGIDGLIIHSGQAKRMFLDDNNYPFKCNPQF
PEPQ_SHEDO       ----MDQLAHHFSEHIVELNRRVAEIIAREKLSGLVIHSGQHHRQFLDDMNYPFKVNPQF
PEPQ_SHEFN       ----MDQLAHLYHAHMAELNRRVGEICQRENLSGLVIHSGQPHRQFLDDLNYPFKVNPQF
PEPQ_SHESA       ----MDHLAHHYHAHIAELNRRVAEIVSREALSGLVIHSGQPHRMFLDDINYPFKANPHF
PEPQ_SHESR       ----MDHLAHHYHAHIAELNRRVAEIVSREALSGLVIHSGQPHRMFLDDINYPFKANPHF
PEPQ_SHESM       ----MDHLAHHYHAHIAELNRRVAEIVSREALSGLVIHSGQPHRMFLDDINYPFKANPHF
PEPQ_SHEON       ----MDHLAHYYHAHIDELNRRVAEIVSREALSGLVIHSGQPHRMFLDDINYPFKANPHF
PEPQ_SHESW       ----MDQLAHHYRAHIAELNRRVAEILSREALSGLVIHSGQPHRMFLDDINYPFKANPHF
PEPQ_SHELP       ----MENLATLYPAHIIELNRRVAEITAREQLAGLVIHSGQPHRQFLDDLDYPFKVNPHF
PEPQ_SHEAM       ----MENLAPLYVNHINEQNRRVADVLAREQLEGLAIHSGQYHRQFLDDINYPFKANPHF
PEPQ1_IDILO      -MTATADLWPLFPDHIKQLQTRAERLFKRENLDLVAIHSGQQKRWFLDDMNYPFRANPHF
PEPQ_ACTP2       -------MKQLFTQHIKRLQQVVQTILETNFLSGLWIHSGTARYHFLDDQTAPFKINPHF
PEPQ_XANAC       --MPQPSLSSLYSDHLRTLTARADEALQRGGFEHLVVPSGSTHYQLFDDRDYPYAVNPQF
PEPQ_XANC5       --MPQPSLSSLYSDHLRTLTARADEALQRGGFEHLVVPSGSTHYQLFDDRDYPYAVNPQF
PEPQ_XANOM       --MTQPSLNSLYSDHLRTLTARADEALQRGGFAHLVVPSGNTHYQLFDDRDYPYAVNPQF
PEPQ_XANOR       --MTQPSLNSLYSDHLRTLTARADEALQRGGFAHLVVPSGNTHYQLFDDRDYPYAVNPQF
PEPQ_XANC8       --MTQPSLSVLYSDHLRTLTARADQALQRGGFDHLVIPSGTTHYQLFDDRDYPFAVNPQF
PEPQ_XANCP       --MTQPSLSVLYSDHLRTLTARADQALQRGGFDHLVIPSGTTHYQLFDDRDYPFAVNPQF
PEPQ_MARHV       --MPNQDILDLQPAHIRELQNRYERAMADHGYDSLLIASGAAPYRYRDDQAYVFQGFGPF
PEPQ2_IDILO      --------MSAYAEHIKTVCSRFDKALEDNNFESVLVYSGQPRVDFLDDNAPPYRVNPLF
PEPQ_HAHCH       ------MSDSAYQNHLSILRKRFDQALLETDFDGVILASGRLTYYFGDDHSHPFHPYAMA
                               *:                  : : :*       .*    :      

PEPQ_ECOLI       KAWVPVTQVPNCWLLVD-GVNKPKLWFYLPVDYWHNVEPLP-TSFWTEDVEVIALPKADG
PEPQ_SHIFL       KAWVPVTQVPNCWLLVD-GVNKPKLWFYLPVDYWHNVEPLP-TSFWTEDVEVIALPKADG
PEPQ_SHIBS       KAWVPVTQVPNCWLLVD-GVNKPKLWFYLPVDYWHNVEPLP-TSFWTEDVEVIALPKADG
PEPQ_SHISS       KAWVPVTQVPNCWLLVD-GVNKPKLWFYLPVDYWHNVEPLP-TSFWTEDVEVIALPKADG
PEPQ_ECO57       KAWVPVTQVPNCWLLVD-GVNKPKLWFYLPVDYWHNVEPLP-TSFWTEDVEVIALPKADG
PEPQ_SHIDS       KAWVPVTQVPNCWLLVD-GVNKPKLWFYLPVDYWHNVEPLP-TSFWTEDVEVIALPKADG
PEPQ_ECOK1       KAWVPVTQVPNCWLLVD-GVNKPKLWFYLPVDYWHNVEPLP-NSFWTEDVEVIALPKADG
PEPQ_ECOL5       KAWVPVTQVPNCWLLVD-GVNKPKLWFYLPVDYWHNVEPLP-NSFWTEDVEVIALPKADG
PEPQ_ECOL6       KAWVPVTQVPNCWLLVD-GVNKPKLWFYLPVDYWHNVEPLP-NSFWTEDVEVIALPKADG
PEPQ_ECOUT       KAWVPVTQVPNCWLLVD-GVNKPKLWFYLPVDYWHNVEPLP-NSFWTEDVEVIALPKADG
PEPQ_SHIF8       KAWVPVTQVPNCWLLVD-GVNKPKLWFYLPVDYWHNVEPLP-TSFWTEDVEVIALPKADG
PEPQ_SALCH       KAWVPVTQVPNCWLLVD-GVNKPKLWFYLPVDYWHNVEPLP-TSFWTEEVEVVALPKADG
PEPQ_SALPA       KAWVPVTQVPNCWLLVD-GVNKPKLWFYLPVDYWHNVEPLP-TSFWTEEVEVVALPKADG
PEPQ_SALTI       KAWVPVTQVPNCWLLVD-GVNKPKLWFYLPVDYWHNVEPLP-TSFWTEEVEVVALPKADG
PEPQ_SALTY       KAWVPVTQVPNCWLLVD-GVNKPKLWFYLPVDYWHNVEPLP-TSFWTEEVEVVALPKADG
PEPQ_PECAS       KAWVPVTQVPNCWLWID-GVNPPKLWFYSPVDYWHSVAPVP-ESFWTAGVEIAVLRNADD
PEPQ_YERPA       KAWVPVTEVPNCWLWVD-GVNTPKLWFYSPVDYWHSVEPLP-DSFWTKNIDVQPLLNADD
PEPQ_YERPE       KAWVPVTEVPNCWLWVD-GVNTPKLWFYSPVDYWHSVEPLP-DSFWTKNIDVQPLLNADD
PEPQ_YERPN       KAWVPVTEVPNCWLWVD-GVNTPKLWFYSPVDYWHSVEPLP-DSFWTKNIDVQPLLNADD
PEPQ_YERPP       KAWVPVTEVPNCWLWVD-GVNTPKLWFYSPVDYWHSVEPLP-DSFWTKNIDVQPLLNADD
PEPQ_YERPS       KAWVPVTEVPNCWLWVD-GVNTPKLWFYSPVDYWHSVEPLP-DSFWTKNIDVQPLLNADD
PEPQ_YERE8       KAWVPVTQVPNCWLWVD-GVNTPKLWFYSPVDYWHCVEPLP-DSFWTKAIDIQPLVNAND
PEPQ_PHOLL       KAWVPVTKVPNCWLWVD-GINKPKLWFYSPVDYWHSVEPLP-TSYWTKEVEMIHLANAGD
PEPQ_SODGM       KAWFPVTRVPHCWLWVD-GVNKPKLWYYLSIDYWYLVEPLP-DSFWTPYVDIVPFADPDE
PEPQ_AERHH       KAWLPVLDNPHCWLLVD-GVNKPVLLFYRPVDFWHKVAELP-NAFWVDFFDIRFLTRPEQ
PEPQ_AERS4       KAWLPVLDNPHCWLLVD-GVSKPVLLFYRPVDFWHKVAELP-NAFWVDFFDIRFLTRPEQ
PEPQ_COLP3       KYWLPLIDIPNSWLVVN-GEDKPTLIYYQPVDFWHKVTPLA-ESYWGEFFNIKILTKASE
PEPQ_PSET1       KAWLPVLDNPHCWIVVN-GSDKPKLIFYRPVDFWHKVPDEP-RDFWAEYFDIELLLQPDQ
PEPQ_PSEA6       KAWLPVIDNPNCWLIVN-GSDKPKLIFYRPKDFWHKVPPEP-NDFWVEQFDVVLLTQADA
PEPQ_SHEDO       KAWVPVIDNPNCWLIVN-GRDKPTLVFYRPVDFWHKVSDVP-DAFWTEHVDIKLLTKADR
PEPQ_SHEFN       KAWLPILDTPNCWVIAN-GQDKPTLVFYRPVDFWHKVNDVP-QAFWTEHFDIQLLTKPDR
PEPQ_SHESA       KAWLPVLDNPNCWLVVN-GRDKPQLIFYRPVDFWHKVSDVP-EMFWTEHFEIKLLTKADK
PEPQ_SHESR       KAWLPVLDNPNCWLVVN-GRDKPQLIFYRPVDFWHKVSDVP-EMFWTEHFEIKLLTKADK
PEPQ_SHESM       KAWLPVLDNPNCWLVVN-GRDKPQLIFYHPVDFWHKVSDVP-EMFWTEHFEIKLLTKADK
PEPQ_SHEON       KAWLPVLDNPNCWLVVN-GRDKPQLIFYRPVDFWHKVADVP-DMFWTEHFDIKLLTKADK
PEPQ_SHESW       KAWLPVLDNPNCWLVVN-GRDKPQLIFYRPVDFWHKVSDVP-DMFWTEHFDIKLLTKADK
PEPQ_SHELP       KAWLPVIDNPHCWLIVN-GRDKPQLIFYRPVDFWHKVADLP-EDFWTTEIEIKVLTKADK
PEPQ_SHEAM       KAWLPVLDIPNCWILTN-GRDKPVLVFYRPVDFWHKVSDVP-ESFWTEHFEIKLLTKAEK
PEPQ1_IDILO      KAWCPETQLANAWVILK-PNTRPTLVLLSSPDFWHTTASLE-GAPWLEEFHVEHISSPEA
PEPQ_ACTP2       NYLFPFPTAENCWLFLD-GKNKPTVYFYAPNDYWHTPPVAPTDAFFADEFQWVILQDSQE
PEPQ_XANAC       KAWVPLTRVPDSWLVYT-PGKRPTVIFYQPFDYWHVVPDAP-SGWWVDHCDIHIIRTPDQ
PEPQ_XANC5       KAWVPLTRVPNSWLVYT-PGKRPTVIFYQPFDYWHVVPDAP-SGWWVDHCDIHIIRTPEQ
PEPQ_XANOM       KAWLPLTRVPHSWLVYT-PGKRPIVIFYQPFDYWHVVPDAP-SGWWVEHCDIHIIRRPDE
PEPQ_XANOR       KAWLPLTRVPHSWLVYT-PGKRPIVIFYQPFDYWHVVPDAP-SGWWVEHCDIHIIRRPDE
PEPQ_XANC8       KAWVPLTRMPHSWLVYT-PGKRPTVIFYQPFDYWHVVPDAP-SGWWVEHCDIHIIRTPEA
PEPQ_XANCP       KAWVPLTRMPHSWLVYT-PGKRPTVIFYQPFDYWHVVPDAP-SGWWVEHCDIHIIRTPEA
PEPQ_MARHV       LHWTGLAGQEHSWLLVR-PGQKPVLWLYQPVDFWHANPVMA-EEPWLEVVDVRSRQQSGA
PEPQ2_IDILO      KYWVPVTESPKSAIFYRKGSQRPTVYLFQARDFWHAPVNVP-EEEWQQHVDLKIIDDLSM
PEPQ_HAHCH       QQWAPFDLMPDVFIHIQ-RGETPRLLWPAKQDFWHVVYPIP-EGGWCDQWRVEPVSSLQE
                           .  :        * :      *:*:          :              

PEPQ_ECOLI       IGSLLPAA-RGNIGYIGPVPERALQLGIEASNINPKGVIDYLHYYRSFKTEYELACMREA
PEPQ_SHIFL       IGSLLPAA-RGNIGYIGPVPERALQLGIEASNINPKGVIDYLHYYRSFKTEYELACMREA
PEPQ_SHIBS       IGSLLPAA-RGNIGYIGPVPERALQLGIEASNINPKGVIDYLHYYRSFKTEYELACMREA
PEPQ_SHISS       IGSLLPAA-RGNIGYIGPVPERALQLGIEASNINPKGVIDYLHYYRSFKTEYELACMREA
PEPQ_ECO57       IGSLLPAA-RGNIGYIGPVPERALQLGIEASNINPKGVIDYLHYYRSFKTEYELACMREA
PEPQ_SHIDS       IGSLLPAA-RGNIGYIGPVPERALQLGIEASNINPKGVIDYLHYYRSFKTEYELACMREA
PEPQ_ECOK1       IGSLLPAA-RGNIGYIGPVPERALQLGIEASNINPKGVIDYLHYYRSFKTEYELACMREA
PEPQ_ECOL5       IGSLLPAA-RGNIGYIGPVPERALQLGIEASNINPKGVIDYLHYYRSFKTEYELACMREA
PEPQ_ECOL6       IGSLLPAA-RGNIGYIGPVPERALQLGIEASNINPKGVIDYLHYYRSFKTEYELACMREA
PEPQ_ECOUT       IGSLLPAA-RGNIGYIGPVPERALQLGIEASNINPKGVIDYLHYYRSFKTEYELACMREA
PEPQ_SHIF8       IGSLLPAA-RGNIGYIGLVQERALQLGIEASNINPKGVIDYLHYYRSFKTEYELACMREA
PEPQ_SALCH       IGSQLPAA-RGNIGYIGPVPERALQLDIAASNINPKGVIDYLHYYRAYKTDYELACMREA
PEPQ_SALPA       IGSQLPAA-RGNIGYIGPVPERALQLDIAASNINPKGVIDYLHYYRAYKTDYELACMREA
PEPQ_SALTI       IGSQLPAA-RGNIGYIGPVPERALQLDIAASNINPKGVIDYLHYYRAYKTDYELACMREA
PEPQ_SALTY       IGSQLPAA-RGNIGYIGPVPERALQLDIAASNINPKGVIDYLHYYRAYKTDYELACMREA
PEPQ_PECAS       IGQLLPAQ-RERVAYIGYAPQRAQDLGIRADNINPQGVLDYLHYHRAYKTDYELACMREA
PEPQ_YERPA       IAQQLPVQ-RERVAYIGYAQQRAQALGFSAENINPQPVLDYLHYYRSYKTDYELACMREA
PEPQ_YERPE       IAQQLPVQ-RERVAYIGYAQQRAQALGFSAENINPQPVLDYLHYYRSYKTDYELACMREA
PEPQ_YERPN       IAQQLPVQ-RERVAYIGYAQQRAQALGFSAENINPQPVLDYLHYYRSYKTDYELACMREA
PEPQ_YERPP       IAQQLPVQ-RERVAYIGYAQQRAQALGFSAENINPQPVLDYLHYYRSYKTDYELACMREA
PEPQ_YERPS       IAQQLPVQ-RERVAYIGYAQQRAQALGFSAENINPQPVLDYLHYYRSYKTDYELACMREA
PEPQ_YERE8       IAQLLPVQ-RERVAYIGYAQQRAQALGFSAENINPKPVLDYLHFYRSYKTDYELACMREA
PEPQ_PHOLL       INSALSTYVKQNVAYIGCSPQRAKEIGFSERNINPKSVLDYLHFHRSYKTDYELVCMREA
PEPQ_SODGM       IAALLPPR--DNVAYLGSSPHRASLLGMERDFINPQPVLDYLHYHRAYKTDYELACMREA
PEPQ_AERHH       VADHLPAN-KQEWAYLGGHLEVAELLGLG--QPNPEAVLNYLHYHRAYKTAYELECLRDA
PEPQ_AERS4       IADHLPAS-KQEWAYLGGHLEVAELLGLG--QPNPEAVLNYLHYHRAYKTPYELECLREA
PEPQ_COLP3       VDKLLPYD-KKGFAYIGSHIEVATALGFE--AINPEPLLNYVHYHRGYKSKYEHECLRQS
PEPQ_PSET1       VEKLLPYD-KANYAYVGEYLEVAQALGFS--VMNPEPVLNYFHYHRAYKTQYELECLRNA
PEPQ_PSEA6       VEKHLPYD-RSRFAYIGEYIEVAKALGFD--LVNPDRVLNYLHYQRAYKTDYELVCMRQA
PEPQ_SHEDO       VAEFLPKD-ITNWAYLGEHLDVADVLGFT--SRNPDAVMNYLHYHRASKTQYELECMRQA
PEPQ_SHEFN       IADFLPKD-LASWAYIGEHLDVADVLGFA--ARNPDAVMNYLHYHRADKTQYELECMRRA
PEPQ_SHESA       VAELLPSD-ITNWAYLGEHLDVAEVLGFT--SRNPDSVMSYLHFHRTTKTEYELECMRRA
PEPQ_SHESR       VAELLPSD-ITNWAYLGEHLDVAEVLGFT--SRNPDSVMSYLHFHRTTKTEYELECMRRA
PEPQ_SHESM       VAELLPSD-ITNWAYLGEHLDVAEVLGFT--SRNPDSVMSYLHFHRTTKTEYELECMRRA
PEPQ_SHEON       VAELLPTD-IANWAYLGEHLDVAEVLGFT--SRNPDSVMSYLHFHRTTKTEYELECMRRA
PEPQ_SHESW       VAELLPKD-TVNWAYLGEHLDVAEVLGFT--SRNPDAVMSYLHYHRTTKTEYELECMRRA
PEPQ_SHELP       VADLLPGK-LQEWAYIGEHLDVADVLGFG--SRNPEAVMSYLHYHRASKTAYELACMRRA
PEPQ_SHEAM       VADLLPKN-LDTWAYIGEHLDVADVLGFK--NRNPDGVMNYFHWHRSFKTDYELACMREA
PEPQ1_IDILO      IEKLLPYD-KKSAAYLGEHIEVAKALGFE--NINPDPVLHFFHYHRLFKTDYEIACLTQA
PEPQ_ACTP2       IAKFIQNP--TACTFIGEDENLAESLGFN--QINPQKVLNQFHFERSIKSEFEIEAIYQA
PEPQ_XANAC       ALALLPKH-AERCAILGEPHSTLGAYVPN----NPQPVLDYLEYQRAFKTPYELALLRIA
PEPQ_XANC5       ALALLPKH-AERCAILGEPQSTLGAYVPN----NPQPVLDYLEYQRAFKTPYELALLRIA
PEPQ_XANOM       ALALLPKQ-AERCAILGEAQSTLGAYVPN----NPQPVLDYLEYQRAFKTAYELALLRIA
PEPQ_XANOR       ALALLPKQ-AERCAILGEAQSTLGAYVPN----NPQPVLDYLEYQRAFKTAYELALLRIA
PEPQ_XANC8       ALPLLPAR-TERCAILGEAASALGACVPN----NPAAVLDFLDYQRAFKTPYELAVMRLA
PEPQ_XANCP       ALPLLPAR-TERCAILGEAASALGACVPN----NPAAVLDFLDYQRAFKTPYELAVMRLA
PEPQ_MARHV       PELDSPGR----LVVIGDPLVLDGVPGDH----NPAALVAAVEEARVRKTPYEIECLAHA
PEPQ2_IDILO      LTEDLGSD-LEQSAFIGEDF-AQPVSDWRVKARNPQALIDHLHFHRSIKTQWEVDNLREA
PEPQ_HAHCH       WLPQISGK----TAWIGPEYNEAPGLNPNL-SVNPEALLHRLNYQRAYKTEFEIDCLWRA
                                :*                **  ::  ..  *  *: :*   :  :

PEPQ_ECOLI       QKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTDVPYSNIVALNEHAAVLHYTKLD
PEPQ_SHIFL       QKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTDVPYSNIVALNEHAAVLHYTKLD
PEPQ_SHIBS       QKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTDVPYSNIVALNEHASVLHYTKLD
PEPQ_SHISS       QKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTDVPYSNIVALNEHASVLHYTKLD
PEPQ_ECO57       QKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTDVPYSNIVALNEHAAVLHYTKLD
PEPQ_SHIDS       QKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTDVPYSNIVALNEHAAVLHYTKLD
PEPQ_ECOK1       QKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTDVPYSNIVALNEHAAVLHYTKLD
PEPQ_ECOL5       QKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTDVPYSNIVALNEHAAVLHYTKLD
PEPQ_ECOL6       QKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTDVPYSNIVALNEHAAVLHYTKLD
PEPQ_ECOUT       QKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTDVPYSNIVALNEHAAVLHYTKLD
PEPQ_SHIF8       QKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTDVPYSNIVALNEHAAVLHYTKLD
PEPQ_SALCH       QKMAVSGHRAAEEAFRSGMSEFDINLAYLTATGHRDTDVPYSNIVALNEHAAVLHYTKLD
PEPQ_SALPA       QKMAVSGHRAAEEAFRSGMSEFDINLAYLTATGHRDTDVPYSNIVALNEHAAVLHYTKLD
PEPQ_SALTI       QKMAVSGHRAAEEAFRSGMSEFDINLAYLTATGHRDTDVPYSNIVALNEHAAVLHYTKLD
PEPQ_SALTY       QKMAVSGHRAAEEAFRSGMSEFDINLAYLTATGHRDTDVPYSNIVALNEHAAVLHYTKLD
PEPQ_PECAS       QKTAVIGHRAAHEAFLSGMSEFDINLAYLTATGHRDIDVPYGNIIALNEHAAVLHYTQLD
PEPQ_YERPA       QKTAVVGHRAAYEAFQSGMSEFDINLAYLMATGHRDTDVPYDNIVALNEHSAVLHYTILQ
PEPQ_YERPE       QKTAVVGHRAAYEAFQSGMSEFDINLAYLMATGHRDTDVPYDNIVALNEHSAVLHYTILQ
PEPQ_YERPN       QKTAVVGHRAAYEAFQSGMSEFDINLAYLMATGHRDTDVPYDNIVALNEHSAVLHYTILQ
PEPQ_YERPP       QKTAVVGHRAAYEAFQSGMSEFDINLAYLMATGHRDTDVPYDNIVALNEHSAVLHYTILQ
PEPQ_YERPS       QKTAVVGHRAAYEAFQSGMSEFDINLAYLMATGHRDTDVPYDNIVALNEHSAVLHYTILQ
PEPQ_YERE8       QKTAVAGHNAAHEAFLSGMSEFDINLAYLMATGQRDTDVPYDNIVALNEHSAVLHYTTLQ
PEPQ_PHOLL       QKTAIVGHLAAYEAFQAGMSEFDINISYLMATGHRDTDVPYNNIIAMNENAAVLHYTALQ
PEPQ_SODGM       QKSAVNGHRAAKEAFLSGMCEFDINIAYLSACGHRDTDVPYDNIIALNEHAAVLHYTRLD
PEPQ_AERHH       NRIGVRGHIAAKDSFMAGASEFEINLAYMKAVGQGANEAPYGNIVAINRNAAILHYTHLS
PEPQ_AERS4       NRIGVRGHIAAKDSFMAGASEFEINLAYMKAVGQGANDAPYGNIVAINRNAAILHYTHLS
PEPQ_COLP3       NALAVKAHQAARNAFLQGDSEYDIQQAYLKSIGYGTNDTPYGNIVALNKNCSILHYMSLD
PEPQ_PSET1       NRIAVDGHKAARDTFFNGGSEFDIQQAYLMATRQSENEMPYGNIVALNENCAILHYTHFE
PEPQ_PSEA6       NALAVAGHNAAAAAFKAGKSEFDINQAYLAAVRQSDNQVPYNNIVALNENSAILHYMEQD
PEPQ_SHEDO       NKIAVKGHQAAKNAFYNGGSEFEIQQQYLSSVGQTVNEVPYGNIVALNQNAAILHYTALE
PEPQ_SHEFN       NQIAVKGHLAAKNAFYDGASEFEIQQRYLLEIGQGENEVPYGNIVALNQNAAILHYTALE
PEPQ_SHESA       NQIAVQGHLAAKNAFYNGASEFEIQQQYLSAVGQGENEVPYGNIIALNQNAAILHYTALE
PEPQ_SHESR       NQIAVQGHLAAKNAFYNGASEFEIQQQYLSAVGQGDNEVPYGNIIALNQNAAILHYTALE
PEPQ_SHESM       NQIAVQGHLAAKNAFYNGASEFEIQQQYLSAVGQGENEVPYGNIIALNQNAAILHYTALE
PEPQ_SHEON       NQIAVQGHQAAKNAFYNGASEFEIQQQYLSAVGQGENEVPYGNIIALNQNAAILHYTALE
PEPQ_SHESW       NQIAVQGHLAAKNAFYNGASEFEIQQHYLSAVGQSENEVPYGNIIALNQNAAILHYTALE
PEPQ_SHELP       SEIGVRGHVAAKSAFYAGASEFEIQQAYLAATDMGENDVPYGNIIALNQNAAILHYTALE
PEPQ_SHEAM       NRVAVAGHNAAREAFYKGASEFEIQQQYLSAIGQGENDVPYGNIIALNQNAAILHYTALE
PEPQ1_IDILO      NHIAAEGHVAAADAFFNGASEFDCLLKYMAATRQGQNEVPYNHIIGQNENASVLHHWMPD
PEPQ_ACTP2       QFAALKGHQAAKQAFFEGKSEFEINLAYLKASQQSDLNVPYGNIVAINQHSAILHYTQLD
PEPQ_XANAC       QQLAVRGHRAAEAAFRAGQSEFGIHMAYCAAVGQDANDLPYGNIIALNEHGAVLHYTELG
PEPQ_XANC5       QQLAVRGHRAAEAAFRAGQSEFGIHMAYCAAVGQDANDLPYGNIIALNEHGAVLHYTELG
PEPQ_XANOM       QQLAVRGHRAAEAAFRAGQSEFGIHMAYCAAVGQDANELPYGNIIALNEHGAVLHYTELG
PEPQ_XANOR       QQLAVRGHRAAEAAFRAGQSEFGIHMAYCAAVGQDANELPYGNIIALNEHGAVLHYTELG
PEPQ_XANC8       QQLAVRGHRAAEAAFRAGQSEFGIHMAYCSAVGQDANELPYGNIIALNEHGAVLHYTELG
PEPQ_XANCP       QQLAVRGHRAAEAAFRAGQSEFGIHMAYCSAVGQDANELPYGNIIALNEHGAVLHYTELG
PEPQ_MARHV       NRIALAGHRAAREAFLAGDSEFGINLAYQQATGQREVEAPYHSIIGLNEHAGTLHYQYYD
PEPQ2_IDILO      NRLAAKAHVAAKEAFFAGKSELEIHHAYLGAIDFRESQVPYNSIVALNSHSAILHYDVYD
PEPQ_HAHCH       NQAGAAGHKAAQAAFLTGKSECDVYRDFLAASGQLSNQEPYPGIVALNENAAVLHYEKKN
                 .  .  .* **  :*  * .*      :         : **  *:. * : . **:    

PEPQ_ECOLI       --HQAPEEMRSFLLDAGAEYNGYAADLTRTWSA------KSDNDYAQLVKDVNDEQLALI
PEPQ_SHIFL       --HQAPEEMRSFLLDAGAEYNGYAADLTRTWSA------KSDNDYAQLVKDVNDEQLALI
PEPQ_SHIBS       --HQAPEEMRSFLLDAGAEYNGYAADLTRTWSA------KSDNDYAQLVKDVNDEQLALI
PEPQ_SHISS       --HQAPEEMRSFLLDAGAEYNGYAADLTRTWSA------KSDNDYAQLVKDVNDEQLALI
PEPQ_ECO57       --HQASEEMRSFLLDAGAEYNGYAADLTRTWSA------KSDNDYAQLVKDVNDEQLALI
PEPQ_SHIDS       --HQAPEEMRSFLLDAGAEYNGYAADLTRTWSA------KSDNDYAQLVKDVNDEQLALI
PEPQ_ECOK1       --HQAPEEMRSFLLDAGAEYNGYAADLTRTWSA------KSDNDYAQLVKDVNDEQLALI
PEPQ_ECOL5       --HQAPEEMRSFLLDAGAEYNGYAADLTRTWSA------KSDNDYAQLVKDVNDEQLALI
PEPQ_ECOL6       --HQAPEEMRSFLLDAGAEYNGYAADLTRTWSA------KSDNDYAQLVKDVNDEQLALI
PEPQ_ECOUT       --HQAPEEMRSFLLDAGAEYNGYAADLTRTWSA------KSDNDYAQLVKDVNDEQLALI
PEPQ_SHIF8       --HQAPEEMRSFLLDAGAEYNGYAADLTRTWSA------KSDNDYAQLVKDVNDEQLALI
PEPQ_SALCH       --HQAPSEMRSFLLDAGAEYNGYAADLTRTWSA------KSDNDYAHLVKDVNDEQLALI
PEPQ_SALPA       --HQAPSEMRSFLLDAGAEYNGYAADLTRTWSA------KSDNDYAHLVKDVNDEQLALI
PEPQ_SALTI       --HQAPSEMRSFLLDAGAEYNGYAADLTRTWSA------KSDNDYAHLVKDVNDEQLALI
PEPQ_SALTY       --HQAPSEMRSFLLDAGAEYNGYAADLTRTWSA------KSDNDYAHLVKDVNDEQLALI
PEPQ_PECAS       --HQVPSDVRSFLIDAGAEYNGYAADLTRTYSA------QSDGAFAQLIKDLNQEMLALI
PEPQ_YERPA       --HQPPAEIRSFLIDAGAEYNGYAADLTRTYTA------DRDSDFAALISDLNTEQLALI
PEPQ_YERPE       --HQPPAEIRSFLIDAGAEYNGYAADLTRTYTA------DRDSDFAALISDLNTEQLALI
PEPQ_YERPN       --HQPPAEIRSFLIDAGAEYNGYAADLTRTYTA------DRDSDFAALISDLNTEQLALI
PEPQ_YERPP       --HQPPAEIRSFLIDAGAEYNGYAADLTRTYTA------DRDSDFAALISDLNTEQLALI
PEPQ_YERPS       --HQPPAEIRSFLIDAGAEYNGYAADLTRTYAA------DRDSDFAALISDLNTEQLALI
PEPQ_YERE8       --HQPPAEIRSFLIDAGAEYNGYAADLTRTYVAGSKNTADSKNDFAALIKDLNNEQLGLI
PEPQ_PHOLL       --HNAPSDIRSFLIDAGAEYNGYAADITRTYSA------KSNNEFASLIKDMDAEQKALI
PEPQ_SODGM       --QHTPEHVMSFLIDAGTEYNGYAADLTRTYAA------QKDSDFAALIAAMNSEQQALI
PEPQ_AERHH       AQRVPDAERYSFLIDAGVDVHGYASDITRTW------AWRRG-EFADLIAALDAQQQEII
PEPQ_AERS4       ALRVSDAERYSFLIDAGVDFHGYASDITRTW------AWRRG-EFADLIATLDSQQQEII
PEPQ_COLP3       --KMTPQVHQSFLIDAGANFNGYSADITRTY------SYKND-KFAELIARMDQLMLNAV
PEPQ_PSET1       --AKAPQQHNSFLIDAGANFNGYAADITRTY------DFKKQGEFAELVQAMTAAQIELG
PEPQ_PSEA6       --VVAPSESRSFLIDAGASFHGYAADITRTYCNG---SIPNSSHFAELINGMHQVTLSLA
PEPQ_SHEDO       --HTKPAQRLSFLLDAGANFHGYASDITRTY------AFEKN-SFCDLISALNAVELAII
PEPQ_SHEFN       --HVKPAQRLSFLIDAGASYHGYAADITRTY------SFEKN-RFYELIVALDKVQLAII
PEPQ_SHESA       --HQNPARRLSFLIDAGASYFGYASDITRTY------AFEKN-RFDELITAMNKAQLELI
PEPQ_SHESR       --HQNPARRLSFLIDAGASYFGYASDITRTY------AFEKN-RFDELITAMNKAQLELI
PEPQ_SHESM       --HQNPARRLSFLIDAGASYFGYASDITRTY------AFEKN-RFDELITAMNKAQLELI
PEPQ_SHEON       --HQNPARRLSFLIDAGASYFGYASDITRTY------AFEKN-RFDELITAMNKAQLELI
PEPQ_SHESW       --HQSPAKRLSFLIDAGASYFGYASDITRTY------AFEKN-RFDELIAAMNKAQLELI
PEPQ_SHELP       --HVSPKQRLSFLIDAGGSFHGYASDITRTY------AFEKN-LFGDLIAAMDKLQLAII
PEPQ_SHEAM       --HAAPANRHSFLIDAGASFNGYAADITRTY------AFEKN-VFDELIKAMDKMQRELV
PEPQ1_IDILO      --KKASGSLKSMLVDAGAEVCGYAADISRTW-------SKQHNEYEELIAALDQITLALI
PEPQ_ACTP2       --YAPNPQQQSFLIDAGATIHGYASDITRTYAA------DPNSEFAAMIKQMEQYKYRII
PEPQ_XANAC       --QQPPQPLRSFLIDAGASAYGYASDITRTYAA------DPDSDFQALIDAVDAAQLRMG
PEPQ_XANC5       --QQPPQPLRSFLIDAGASAYGYASDITRTYAA------DPGSDFQALIDAVDAAQLRMG
PEPQ_XANOM       --QQPPQPLRSFLIDAGASAYGYASDITRTYAA------DPGSDFQALINAVDAAQLRMG
PEPQ_XANOR       --QQPPQPLRSFLIDAGASAYGYASDITRTYAA------DPGSDFQALINAVDAAQLRMG
PEPQ_XANC8       --RQAPQPLRSFLIDAGASAHGYASDITRTYAA------DAGSEFQALIDAVDAAQLRMG
PEPQ_XANCP       --RQAPQPLRSFLIDAGASAHGYASDITRTYAA------DAGSEFQALIDAVDAAQLRMG
PEPQ_MARHV       --LKPPRRPRSLLIDAGVRYRGYCSDITRTTAG------PDEPRFTALVHGLEKLQLRLC
PEPQ2_IDILO      --TVPPKQIRSFLIDAGARYRGYCSDITRSYAY-------EEGFYANLVEAMDKAQQELL
PEPQ_HAHCH       --PLKPDAMRTLLIDAGAAYGGYASDITRTYTA-------GSGLFAELIERVNTLQLSIA
                           ::*:***    **.:*::*:              :  ::  :        

PEPQ_ECOLI       ATMKAGVSYVDYHIQFHQRIAKLLRKHQIITDMSEEAMVENDLTGPFMPHGIGHPLGLQV
PEPQ_SHIFL       ATMKAGVSYVDYHIQFHQRIAKLLRKHQIITDMSEEAMVENDLTGPFMPHGIGHPLGLQV
PEPQ_SHIBS       ATMKAGVSYVDYHLQFHQRIAKLLRKHQIITDMSEEAMVENDLTGPFMPHGIGHPLGLQV
PEPQ_SHISS       ATMKAGVSYVDYHIQFHQRIAKLLRKHQIITDMSEEAMVENDLTGPFMPHGIGHPLGLQV
PEPQ_ECO57       ATMKAGVSYVDYHIQFHQRIAKLLRKHQIITDMSEEAMVENDLTGPFMPHGIGHPLGLQV
PEPQ_SHIDS       ATMKAGVSYVDYHIQFHQRIAKLLRKHQIITDMSEEAMVENDLTGPFMPHGIGHPLGLQV
PEPQ_ECOK1       ATMKAGVSYVDYHIQFHQRIAKLLRKHQIITDMSEEAMVENDLTGPFMPHGIGHPLGLQV
PEPQ_ECOL5       ATMKAGVSYVDYHIQFHQRIAKLLRKHQIITDMSEEAMVENDLTGPFMPHGIGHPLGLQV
PEPQ_ECOL6       ATMKAGVSYVDYHIQFHQRIAKLLRKHQIITDMSEEAMVENDLTGPFMPHGIGHPLGLQV
PEPQ_ECOUT       ATMKAGVSYVDYHIQFHQRIAKLLRKHQIITDMSEEAMVENDLTGPFMPHGIGHPLGLQV
PEPQ_SHIF8       ATMKAGVSYVDYHIQFHQRIAKLLRKHQIITDMSEEAMVENDLTGPFMPHGIGHPLGLQV
PEPQ_SALCH       ATMKAGVSYVDYHIQFHQRIAKLLRKHQIITDMSEEAMVENDLTGPFMPHGIGHPLGLQV
PEPQ_SALPA       ATMKAGVSYVDYHIQFHQRIAKLLRKHQIITDMSEEAMVENDLTGPFMPHGIGHPLGLQV
PEPQ_SALTI       ATMKAGVSYVDYHIQFHQRIAKLLRKHQIITDMSEEAMVENDLTGPFMPHGIGHPLGLQV
PEPQ_SALTY       ATMKAGVSYVDYHIQFHQRIAKLLRKHQIITDMSEEAMVENDLTGPFMPHGIGHPLGLQV
PEPQ_PECAS       DTMQAGVRYTDYHIQMHQRIAKLLKSHQLVRDISEEAMVEQGLTLPFLPHGLGHPLGLQV
PEPQ_YERPA       DTIKSGERYTDYHVQMHQRIAKLLRTHNLVTGISEEAMVEQGITCPFLPHGLGHPLGLQV
PEPQ_YERPE       DTIKSGERYTDYHVQMHQRIAKLLRTHNLVTGISEEAMVEQGITCPFLPHGLGHPLGLQV
PEPQ_YERPN       DTIKSGERYTDYHVQMHQRIAKLLRTHNLVTGISEEAMVEQGITCPFLPHGLGHPLGLQV
PEPQ_YERPP       DTIKSGERYTDYHVQMHQRIAKLLRTHNLVTGISEEAMVEQGITCPFLPHGLGHPLGLQV
PEPQ_YERPS       DTIKSGERYTDYHVQMHQRIAKLLRTHNLVTGISEEAMVEQGITCPFLPHGLGHPLGLQV
PEPQ_YERE8       KTLKCGVNYTEYNVQMHQRIAKLLRTHNLVTGISEEAMVEQGITCPFLPHGLGHPLGLQV
PEPQ_PHOLL       STIKVGTRYTEYHIQMHHRIAKLLKKYGIVKDVSEEVMVEEGLTTPFFPHGIGHPLGLQV
PEPQ_SODGM       ATIETGVNYIDYHLQMHGRIAKLLKQFDILSGLSEDAMVTEGLTLPFLPHGLGHPLGLQV
PEPQ_AERHH       EEIKPGRRYSELHLQMHHRLARLLQATELVD-MSVDEMIHTGVTNVFFPHGLGHFLGLQV
PEPQ_AERS4       EEIKPGRRYSELHLQMHHKLARLLQSVELVD-MSVDEMIHTGVTNVFFPHGLGHFLGLQV
PEPQ_COLP3       AGLKPGVSYVDLHIETHRAIGQVLRDFNFIN-VDADTAVESGIISTFFPHGLGHHLGLQV
PEPQ_PSET1       TGLKPGMLYGDLHVECHNRVAQILSDFDIVK-LPAEEIVERKITSTFFPHGLGHHLGLQV
PEPQ_PSEA6       DSLKPGVPYSDIHIAAHAQVAQLLHQFDIVN-LSPDDILAEQIVSTFFPHGIGHFLGLQV
PEPQ_SHEDO       DRIKPGVKYTDLHIETHHHIAQLLLDFNLAT-GDAAGLVDQGITNVFFPHGLGHMLGLQV
PEPQ_SHEFN       EQMKPGVKYVDLHIATHHYIGQLLIDFGLAN-GTAEQLVAQGVTSAFFPHGLGHMLGLQV
PEPQ_SHESA       DMMRPGVRYPDLHLATHGKVAQMLLDFELAT-GDAQGLVDQGITSAFFPHGLGHMLGLQV
PEPQ_SHESR       DMMRPGVRYPDLHLATHGKVAQMLLDFELAT-GDAQGLVDQGITSAFFPHGLGHMLGLQV
PEPQ_SHESM       DMMRPGVRYPDLHLATHGKVAQMLLDFELAT-GDAQGLVDQGITSAFFPHGLGHMLGLQV
PEPQ_SHEON       DMMRPGVRYPDLHLATHGKVAQMLLDFDLAT-GDAQGLVEQGITSAFFPHGLGHMLGLQV
PEPQ_SHESW       DMMRPGVRYPDLHLATHAKVAQMLLDFDLAT-GDAQGLVDQGITSAFFPHGLGHMLGLQV
PEPQ_SHELP       EMMRPGVKYVDLHLATHQKLAQLLLDFKLVQ-GDPQGLIEQGITSAFFPHGLGHMLGLQV
PEPQ_SHEAM       DMMRPGVRFTDLHLATHHKLAQLLLEFGIAR-GEASDLVEQGVTSVFFPHGLGHMLGLQV
PEPQ1_IDILO      DKMKPGVEFPALHQLAHEQIANVLFAFGFVS-CSPEQMIEDGITTVFLPHGLGHPLGLQV
PEPQ_ACTP2       DQLTVGVNYLSYHTQMQQWIAEMLYEYDFVR-LTPEQIFEEGISRAFLPHGLGHLLGLQV
PEPQ_XANAC       QNVRAGVDYKQLHIDAHLALMGILKEFGILT-VSPEAALATGVSAAFFPHGLGHLIGLQV
PEPQ_XANC5       QNVRAGVDYKQLHIEAHLALMGILKEFGVLT-VSPEAALATGVSAAFFPHGLGHLIGLQV
PEPQ_XANOM       QNVRAGVDYKQLHIDAHLALMGILKEFGVLT-VSPEAALATGISAAFFPHGLGHLIGLQV
PEPQ_XANOR       QNVRAGVDYKQLHIDAHLALMGILKEFGVLT-VSPEAALATGISAAFFPHGLGHLIGLQV
PEPQ_XANC8       NAVRAGMDYKQLHVDAHLSLMGILHDFGIIT-VSPEAALATGVSAAFFPHGLGHLIGLQV
PEPQ_XANCP       NAVRAGMDYKQLHVDAHLSLMGILHDFGIIT-VSPEAALATGVSAAFFPHGLGHLIGLQV
PEPQ_MARHV       EMVSPGVDYVDIHRKAHLGIATLLSASGLVSGLADEAMVEQGITRAFFPHGIGHFLGIQV
PEPQ2_IDILO      SEIKPGVSYYDLHVSMHLKVAQILSDFEFIK-GDAQSIYDKGYTSAFMPHGLGHFIGLQV
PEPQ_HAHCH       AQAVHGKAFSELHQATLAGVANILHETRICS-LSVEAQLDKRIPQVFFPHGLGHLLGLQV
                      *  :   :      :  :*    .                 *:***:** :*:**

PEPQ_ECOLI       HDVAGFMQDDSGTHLAAPAKYPYLRCTRILQPGMVLTIEPGIYFIESLLAPWREGQFSKH
PEPQ_SHIFL       HDVAGFMQDDSGTHLAAPAKYPYLRYTRILQPGMVLTIEPGIYFIESLLAPWREGQFSKH
PEPQ_SHIBS       HDVAGFMQDDSGTHLAAPAKYPYLRCTRILQPGMVLTIEPGIYFIESLLAPWREGQFSKH
PEPQ_SHISS       HDVAGFMQDDSGTHLAAPAKYPYLRCTRILQPGMVLTIEPGIYFIESLLAPWREGQFSKH
PEPQ_ECO57       HDVAGFMQDDSGTHLAAPAKYPYLRCTRILQPGMVLTIEPGIYFIESLLAPWREGQFSKH
PEPQ_SHIDS       HDVAGFMQDDSGTHLAAPAKYPYLRCTRILLPGMVLTIEPGIYFIESLLAPWREGQFSKH
PEPQ_ECOK1       HDVAGFMQDDSGTHLAAPAKYPYLRCTRILQPGMVLTIEPGIYFIESLLAPWREGQFSKH
PEPQ_ECOL5       HDVAGFMQDDSGTHLAAPAKYPYLRCTRILQPGMVLTIEPGIYFIESLLAPWREGQFSKH
PEPQ_ECOL6       HDVAGFMQDDSGTHLAAPAKYPYLRCTRILQPGMVLTIEPGIYFIESLLAPWREGQFSKH
PEPQ_ECOUT       HDVAGFMQDDSGTHLAAPAKYPYLRCTRILQPGMVLTIEPGIYFIESLLAPWREGQFSKH
PEPQ_SHIF8       HDVAGFMQDDSGTHLAAPAKYPYLRCTRILQPGMVLTIEPGIYFIESLLAPWREGQFSKH
PEPQ_SALCH       HDVAGFMQDDSGTHLAAPSKYPYLRCTRVLQPRMVLTIEPGIYFIESLLAPWREGPFSKH
PEPQ_SALPA       HDVAGFMQDDSGTHLAAPSKYPYLRCTRVLQPRMVLTIEPGIYFIESLLAPWREGPFSKH
PEPQ_SALTI       HDVAGFMQDDSGTHLAAPSKYPYLRCTRVLQPRMVLTIEPGIYFIESLLAPWREGPFSKH
PEPQ_SALTY       HDVAGFMQDDSGTHLAAPSKYPYLRCTRVLQPRMVLTIEPGIYFIESLLAPWREGPFSKH
PEPQ_PECAS       HDVAGFMQDDRGTHLAAPTQHPYLRCTRVLEPGMVMTIEPGIYFIESLLAPWREGECSQH
PEPQ_YERPA       HDTAGFMQDDKGTNLNAPSKYPYLRCTRVLQPRMVLTIEPGLYFIDSLLAPWRIGEFSKH
PEPQ_YERPE       HDTAGFMQDDKGTNLNAPSKYPYLRCTRVLQPRMVLTIEPGLYFIDSLLAPWRIGEFSKH
PEPQ_YERPN       HDTAGFMQDDKGTNLNAPSKYPYLRCTRVLQPRMVLTIEPGLYFIDSLLAPWRIGEFSKH
PEPQ_YERPP       HDTAGFMQDDKGTNLNAPSKYPYLRCTRVLQPRMVLTIEPGLYFIDSLLAPWRIGEFSKH
PEPQ_YERPS       HDTAGFMQDDKGTNLNAPSKYPYLRCTRVLQPRMVLTIEPGLYFIDSLLAPWRIGEFSKH
PEPQ_YERE8       HDTAGFMQDDKGAHLSAPSKYPYLRCTRILQPRMVLTIEPGLYFIESLLAPWRSGEFSQH
PEPQ_PHOLL       HDVAGFMQDDTGTHLAAPDMYPYLRCTRILEPRMVLTIEPGLYFIESLLAPWRESEFSKH
PEPQ_SODGM       HDVAGFMQDDRGTSLAPQSRYTHLRCTRVLQPRMVLTIEPGLYFIESLLAPWRANTFGRH
PEPQ_AERHH       HDAGGFMQDERGTHLSAPEQFPYLRCTRVMEVGQVFTIEPGLYFIDSLLEPLRLGEQGKR
PEPQ_AERS4       HDAGGFMQDERGTHLSAPEQFPYLRCTRVMEVGQVFTIEPGLYFIDSLLEPLRQSEQGKR
PEPQ_COLP3       HDVGGFMADERGTHVNTPAEHPFLRTSRVIETNQVFTIEPGLYFIDSLLADLKASANADQ
PEPQ_PSET1       HDMGGFMADEMGAQQAAPEGHPFLRCTRIIEKNQVFTIEPGLYFIDSLLGDLAQTDNKQF
PEPQ_PSEA6       HDVAGHVADDRGTPNPPPAEHPFLRTTRMIEARQVFTIEPGLYFIDSLLADLKSTEKSKF
PEPQ_SHEDO       HDMGGYLHDERGTHIPAPEAHPYLRCTRTLEANQVLTIEPGLYIIDSLLDELKQDSRKQQ
PEPQ_SHEFN       HDMGGYSHDERGTHIAAPEAHPFLRCTRVLAANQVLTIEPGLYIIDTLLNQLSATA-KQA
PEPQ_SHESA       HDVGGFSFDERGTHIPAPEAHPFLRCTRILAPNQVLTMEPGLYIIDTLLNELKQDSRGQQ
PEPQ_SHESR       HDVGGFSFDERGTHIPAPEAHPFLRCTRILAPNQVLTMEPGLYIIDTLLNELKQDSRGQQ
PEPQ_SHESM       HDVGGFAFDERGTHIPAPEAHPFLRCTRILAPNQVLTMEPGLYIIDTLLNELKQDSRDQQ
PEPQ_SHEON       HDVGGFAFDERGTHIPAPEAHPFLRCTRILAPNQVLTMEPGLYIIDSLLNELKQNSRGKQ
PEPQ_SHESW       HDVGGFSHDERGTHIAAPEAHPFLRCTRILAPNQVLTMEPGLYIIDTLLNELKQDSRGLQ
PEPQ_SHELP       HDMGGFLHDERGTHIAPPEAHPFLRCTRTLAANQVLTIEPGLYIIDSLLNELKQDGRADW
PEPQ_SHEAM       HDVAGFAHDERGTHLAAPERHPFLRCTRVLAPRHVLTIEPGFYIIDSLLTELKADGRAEA
PEPQ1_IDILO      HDVGAAQADERGTPIAPPSGHLTLKTTRTVEPRQVYTIEPGIYFIEPLLQKLANSRNKHL
PEPQ_ACTP2       HDAAGFQQNPRGTRKSPPEVYPSLRCTRDLAENMVLTIEPGFYFIDMLLNPLQNSPLARH
PEPQ_XANAC       HDVAGFAASDRGGRIERPPGHPYLRLTRVLEPGMVVTIEPGVYFIDMLLDEVKKNGHAAS
PEPQ_XANC5       HDVAGFAASDRGGRIERPAGHPYLRLTRVLEPGMVVTIEPGVYFIDMLLDEVKKNGHAAS
PEPQ_XANOM       HDVAGFAASDRGGRIQRPEGHPYLRLTRVLEPGMVVTIEPGVYFIDMLLDEVKKNGHAAS
PEPQ_XANOR       HDVAGFAASDRGGRIQRPEGHPYLRLTRVLEPGMVVTIEPGVYFIDMLLDEVKKNGHAAS
PEPQ_XANC8       HDVAGFAASDRGGRIERPDGHPYLRLTRVLEPGMVVTIEPGVYFIDMLLDEVKKNGHAAS
PEPQ_XANCP       HDVAGFAASDRGGRIERPDGHPYLRLTRVLEPGMVVTIEPGVYFIDMLLDEVKKNGHAAS
PEPQ_MARHV       HDVAGKPTP-------SPEDAPFLRLTRTLEAGMVVTIEPGLYFIPSLLEPLLNGPEAQY
PEPQ2_IDILO      HDVGGFLKDDKGNSYERSERHPFLRLLRDIEVGHVFTIEPGLYVVDQLLEEHKDSA---D
PEPQ_HAHCH       HDVGGHQQDKTGTLRKPDESAPFLRLTRTLEKDMVITIEPGLYFIPMLLDNMVKNIAGHG
                 ** ..                  *:  * :    * *:***.*.:  **           

PEPQ_ECOLI       FNWQKIEALKPFGGIRIEDNVVIHENNVENMTRDLKLA----------
PEPQ_SHIFL       FNWQKIEALKPFGGIRIEDNVVIHENNVENMTRDLKLA----------
PEPQ_SHIBS       FNWQKIEALKPFSGIRIEDNVVIHENNVENMTRDLKLA----------
PEPQ_SHISS       FNWQKIEALKPFGGIRIEDNVVIHENNVENMTRDLKLA----------
PEPQ_ECO57       FNWQKIEALKPFGGIRIEDNVVIHENNVENMTRDLKLA----------
PEPQ_SHIDS       FNWQKIEALKPFGGIRIEDNVVIHENNVENMTRDLKLA----------
PEPQ_ECOK1       FNWQKIEALKPFGGIRIEDNVVIHENNVENMTRDLKLA----------
PEPQ_ECOL5       FNWQKIEALKPFGGIRIEDNVVIHENNVENMTRDLKLA----------
PEPQ_ECOL6       FNWQKIEALKPFGGIRIEDNVVIHENNVENMTRDLKLA----------
PEPQ_ECOUT       FNWQKIEALKPFGGIRIEDNVVIHENNVENMTRDLKLA----------
PEPQ_SHIF8       FNWQKIEALKPFGGIRIEDNVVIHENNVENMTRDLKLA----------
PEPQ_SALCH       FNWQKIEALKPFGGIRIEDNVVIHENGVENMTRDLKLA----------
PEPQ_SALPA       FNWQKIEALKPFGGIRIEDNVVIHENGVENMTRDLKLA----------
PEPQ_SALTI       FNWQKIEALKPFGGIRIEDNVVIHENGVENMTRDLKLA----------
PEPQ_SALTY       FNWQKIEALKPFGGIRIEDNVVIHENGVENMTRDLKLA----------
PEPQ_PECAS       FDWQKIDALKPFGGIRIEDNIVIHEGRVENMTRDLNLA----------
PEPQ_YERPA       FNWDRIDALKPYGGIRIEDNIVIHDKRVENMTRDLKLA----------
PEPQ_YERPE       FNWDRIDALKPYGGIRIEDNIVIHDKRVENMTRDLKLA----------
PEPQ_YERPN       FNWDRIDALKPYGGIRIEDNIVIHDKRVENMTRDLKLA----------
PEPQ_YERPP       FNWDRIDALKPYGGIRIEDNIVIHDKRVENMTRDLKLA----------
PEPQ_YERPS       FNWDRIDALKPYGGIRIEDNIVIHDKRVENMTRDLKLA----------
PEPQ_YERE8       FNWDLIETLKPYGGIRIEDNIVIHENRVENMTRDLKLA----------
PEPQ_PHOLL       FDWNKIGTLKLFGGIRIEDNIVIHENKVENMTRDLQLP----------
PEPQ_SODGM       FNWSRIESFKPYGGIRIEDNIVIHDNHIENMTRALKLE----------
PEPQ_AERHH       VNWNKVEALRPYGGIRIEDNVVLHANGVENLTRQAGL-----------
PEPQ_AERS4       VNWNKVEALRPFGGIRIEDNIVLHANGVENMTRQAGL-----------
PEPQ_COLP3       VNWQNVDEMRCFGGIRIEDNIIVHQSHNENMTRDLGLS----------
PEPQ_PSET1       INWQKVESFKPYGGIRIEDNIIVHEDSLENMTRNLALD----------
PEPQ_PSEA6       INWDVVDTFRPFGGIRIEDNIIVHRDKNENMTRDLGLN----------
PEPQ_SHEDO       INWDQVAHFRPFGGIRIEDNVIVHQDRNENMTREFGLID---------
PEPQ_SHEFN       INWTTVDEMRPFGGIRIEDNVIVHQDRVENMTREFGLVD---------
PEPQ_SHESA       INWRTVDELRPFGGIRIEDNVIVHQDRNENMTRELGLA----------
PEPQ_SHESR       INWRTVDELRPFGGIRIEDNVIVHQDRNENMTRELGLA----------
PEPQ_SHESM       INWRTVDELRPFGGIRIEDNVIVHQDRNENMTRELGLA----------
PEPQ_SHEON       INWNSVDELRPFGGIRIEDNVVVHQDRNENMTRELGLA----------
PEPQ_SHESW       INWQTVDELRPFGGIRIEDNVIVHQDRNENMTRELGLAD---------
PEPQ_SHELP       INWQMVDQVRPFGGIRIEDNVIVHSDHNENMTRDLGLHG---------
PEPQ_SHEAM       VNWDMVNTLRPFGGIRIEDNVIVHQERNENMTRDLGLN----------
PEPQ1_IDILO      INWRRVDEFKPFGGVRIEDNIVVYRERNDNLTRQTALDAYVKKVTRLA
PEPQ_ACTP2       INWQKIAEFKQFGGIRTEDNIVMRSQGAENLTQKAEIELQLSDH----
PEPQ_XANAC       VDWQRVEAFKPYGGIRIEDEVVCTDGSAENLTRPVFAAA---------
PEPQ_XANC5       VNWQRVEAFKPYGGIRIEDEVVCTDGSAENLTRPVFASA---------
PEPQ_XANOM       VNWQRVEAFKPYGGIRIEDEVVCTDGNAENLTRPVFAAA---------
PEPQ_XANOR       VNWQRVEAFKPYGGIRIEDEVVCTDGNAENLTRPVFAAA---------
PEPQ_XANC8       VNWDRVAQFAPYGGIRIEDEVVCTDGDPENLTRPVFAAP---------
PEPQ_XANCP       VNWDRVAQFAPYGGIRIEDEVVCTDGDPENLTRPVFAAP---------
PEPQ_MARHV       LNRALIDELKSCGGIRIEDNVVVTAAGARNLTRECE------------
PEPQ2_IDILO      INWEKVDELRPYGGVRIEDSIVVGADGNENLTRDAFKELGAE------
PEPQ_HAHCH       CDLDLIETLKPYGGIRIEDNVVVQEGRSRNLTREAFSALLA-------
                  :   :  .   .*:* **.::       *:*: