CLUSTAL format seed alignment for MF_01288

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RHMD_BURCA      --------------MSMPTIRAVRALTVRGG--------------------GADYHDQDA
RHMD_BURCH      --------------MSMPTIRAVRALTVRGG--------------------GADYHDQDA
RHMD_BURCC      --------------MSMPTIRAVRALTVRGG--------------------GADYHDQDA
RHMD_BURCM      --------------MSMPTIRAVRALTVRGG--------------------GADYHDQDA
RHMD_PARPJ      --------------MAMPTIRHVRAFIVRGG--------------------GADYHDQPG
RHMD_PARXL      --------------MAMPTIRHVRAFIVRGG--------------------GADYHDQPG
RHMD_PARP8      --------------MAMPSIRHVRAFVVRGG--------------------GADYHDQAD
RHMD_BURA4      --------------MAMPTIKHVRAFTVRGG--------------------GADYHDQDD
RHMD_POLSJ      -------------MNNMPTIKHVRAFTVRGG--------------------GADYHDQGS
RHMD_VEREI      --------------MGMPFIKHVRAFTVRGG--------------------GADYHDQGG
RHMD_DELAS      -------------MTQIPTIKQVRAFTLKGG--------------------GADYHDQSD
RHMD_AZOC5      --------------MSVPTIREVRAYVVRGG--------------------GGDYHDQQG
RHMD_SACEN      -----------------MKIRQVRALTVTGG--------------------GADYHDQAE
RHMD_SALPC      ----------MENIMTLPKIKHVRAWFIGGATAEKGAG-------------GGDYHDQGG
RHMD_SALTY      ----------MENIMTLPKIKHVRAWFIGGATAEKGAG-------------GGDYHDQGG
RHMD_SALPA      ----------MENIMTLPKIKHVRAWFIGGATAEKGAG-------------GGDYHDQGG
RHMD_SALPK      ----------MENIMTLPKIKHVRAWFIGGATAEKGAG-------------GGDYHDQGG
RHMD_SALG2      ----------MENIMTLPKIKHVRAWFIGGATAEKGAG-------------GGDYHDQGG
RHMD_SALEP      ----------MENIMTLPKIKHVRAWFIGGATAEKGAG-------------GGDYHDQGG
RHMD_SALCH      ----------MENIMTLPKIKHVRAWFIGGATAEKGAG-------------GGDYHDQGG
RHMD_SALPB      ----------MENIMTLPKIKHVRAWFIGGATAEKGAG-------------GGDYHDQGG
RHMD_SALTI      ----------MENIMTLPKIKHVRAWFIGGATAEKGAG-------------GGDYHDQGG
RHMD_SALNS      --------------MTLPKIKHVRAWFIGGATAEKGAG-------------GGDYHDQGG
RHMD_SALDC      --------------MTLPKIKHVRAWFIGGATAEKGAG-------------GGDYHDQGG
RHMD_SALA4      --------------MTLPKIKHVRAWFIGGATAEKGAG-------------GGDYHDQGG
RHMD_SALSV      --------------MTLPKIKHVRAWFIGGATAEKGAG-------------GGDYHDQGG
RHMD_SALHS      --------------MTLPKIKHVRAWFIGGATAEKGAG-------------GGDYHDQGG
RHMD_ECOLC      ----------MENIMTLPKIKQVRAWFTGGATAEKGAG-------------GGDYHDQGA
RHMD_ECOBW      ----------MENIMTLPKIKQVRAWFTGGATAEKGAG-------------GGDYHDQGA
RHMD_ECODH      ----------MENIMTLPKIKQVRAWFTGGATAEKGAG-------------GGDYHDQGA
RHMD_ECOLI      --------------MTLPKIKQVRAWFTGGATAEKGAG-------------GGDYHDQGA
RHMD_ECOHS      ----------MENIMTLPKIKQVRAWFTGGATAEKGAG-------------GGDYHDQGA
RHMD_ECO57      ----------MENIMTLPKIKQVRAWFTGGATAEKGAG-------------GGDYHDQGA
RHMD_SHIBS      ----------MENIMTLPKIKQVRAWFTGGATAEKGAG-------------GGDYHDQGA
RHMD_ECOK1      ----------MENIMTLPKIKQVRAWFTGGAIAEKGAG-------------GGDYHDQGA
RHMD_ECO45      ----------MENIMTLPKIKQVRAWFTGGAIAEKGAG-------------GGDYHDQGA
RHMD_ECOUT      ----------MENIMTLPKIKQVRAWFTGGAIAEKGAG-------------GGDYHDQGA
RHMD_ECOL6      ----------MENIMTLPKIKQVRAWFTGGATAEKGAG-------------GGDYHDQGA
RHMD_ECOL5      ----------MENIMTLPKIKQVRAWFTGGATAEKGAG-------------GGDYHDQGA
RHMD_ECO81      ----------MENIMTLPKIKQVRAWFTGGATAEKGAG-------------GGDYHDQGA
RHMD_ECO27      ----------MENIMTLPKIKQVRAWFTGGATAEKGAG-------------GGDYHDQGA
RHMD_ECOSM      ----------MENSMTLPKIKQVRAWFTGGATAEKGAG-------------GGDYHDQGA
RHMD_KLEP3      --------------MTLPKIKHVRAWFTGGATAEQGAG-------------GGDYHDQGA
RHMD_KLEP7      --------------MTLPKIKHVRAWFIGGATAEQGAG-------------GGDYHDQGA
RHMD_TOLAT      --------------MVLPKIKEVRAWFTGGATAEKGAG-------------GADYHDQGN
RHMD_SHISS      MPAPGIFHVCWDGKVPLTYRPHNNGEHHDPTKNQTGSRLVYWRCDSRKRCWRGDYHDQGA
RHMD_CALMQ      -------MNDVDASIEPKRIKEVRAYVVKGG--------------------GADYHDQSS
                                       ..                           .*****  

RHMD_BURCA      GHWIDDHIATPMSRYPEYRQSRQSFGINVLGTLVIEVEASDGTVGFAVTTGGEIGAFIVE
RHMD_BURCH      GHWIDDHIATPMSRYPEYRQSRQSFGINVLGTLVIEVEASDGTVGFAVTTGGEIGAFIVE
RHMD_BURCC      GHWIDDHIATPMSRYPEYRQSRQSFGINVLGTLVIEVEASDGTVGFAVTTGGEIGAFIVE
RHMD_BURCM      GHWIDDHIATPMSRYPEYRQSRQSFGINVLGTLVIEIEASDGTVGFAVTTGGEIGAFIVE
RHMD_PARPJ      GHWIDDHISTPMARYPEYRQSRQSFGINVLGTLVVEIEASDGTVGFAVTTGGEIGAFIVE
RHMD_PARXL      GHWIDDHISTPMARYPEYRQSRQSFGINVLGTLVVEIEASDGTVGFAVTTGGEIGAFIVE
RHMD_PARP8      GHWIDDHISTPMARYPEYRQSRQSFGINVLGTLVVEIEASDGTVGFAVTTGGEIGAFIVE
RHMD_BURA4      GHWIDDHIATPMSRYPEYRESRRSFGINVLGTLVVEIEASDGSVGFAVTTGGEIGAFIVE
RHMD_POLSJ      GHWIDDHISTPMGRYPEYRQSRQSFGINVLGTLVVEIEASDGTVGFSVTTGGELGCWIVE
RHMD_VEREI      GHWIDDHIATPMSKYPEYRQSRQSFGINVLGTLVVEIEASDGTVGFSVTTGGDLGCFIVE
RHMD_DELAS      GHWIDDHIATPMAKYPEYRQSRRSFGINVLGTLVVEIEDSAGRVGFAVTTGGEPAAYIVE
RHMD_AZOC5      THWIDDHIATPMSKYPAYRQSRRTFGINVLGTLVVEVEASDGTVGFAVTTGGEPAAWIVE
RHMD_SACEN      DHWIDDHVATPMAKYPEYRASRQAFGINVLGTLVVEVEAEDGTVGVGVTTAGEPGAYIVE
RHMD_SALPC      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_SALTY      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENRQTGFAVSTAGEMGCFIVE
RHMD_SALPA      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_SALPK      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_SALG2      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_SALEP      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_SALCH      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_SALPB      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_SALTI      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_SALNS      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_SALDC      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_SALA4      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_SALSV      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_SALHS      NHWIADHIATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_ECOLC      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLVVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_ECOBW      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLVVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_ECODH      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLVVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_ECOLI      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLVVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_ECOHS      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLVVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_ECO57      NHWIDDHIATPMSKYRDYEQLRQSFGINVLGTLVVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_SHIBS      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLVVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_ECOK1      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLVVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_ECO45      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLVVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_ECOUT      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLVVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_ECOL6      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_ECOL5      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_ECO81      NHWIDDHIATPMSKYREYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_ECO27      NHWIDDHIATPMSKYREYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_ECOSM      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_KLEP3      NHWIDDHIATPMSKYKEYEQSRQSFGINVLGTLIVEVEADNGQTGFAVSTAGEMGCFIVE
RHMD_KLEP7      NHWIDDHIATPMSKYKQYEQSRQSFGINVLGTLIVEVEADNGQTGFAVSTAGEMGCFIVE
RHMD_TOLAT      HHWIDDHIATPMSKYKQYEQSRQSFGINVLGTLVIEVEADNGQIGFAVSTAGEMGCFIVE
RHMD_SHISS      NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
RHMD_CALMQ      EHWILGYIATPISIYPEYRASRASWGLNVLGSVVVEVESSDGEVGFGISTGGYPAAWIIE
                 *** .:::**:. *  *.  * ::*:****::::*:* .    *..::*.*  ..:*:*

RHMD_BURCA      RHLARFIEGQRVTDIEKMWDQMFHATLYY-GRKGVVLNAISGVDLALWDLLAKVRREPVH
RHMD_BURCH      RHLARFIEGQRVTDIEKMWDQMFHATLYY-GRKGVVLNAISGVDLALWDLLAKVRREPVH
RHMD_BURCC      RHLARFIEGQRVTDIEKMWDQMFHATLYY-GRKGVVLNAISGVDLALWDLLAKVRREPVH
RHMD_BURCM      RHLARFIEGQRVTDIEKMWDQMFYATLYY-GRKGVVLNAISGVDLALWDLLGKVRQEPVH
RHMD_PARPJ      KHLARFLEGQLVTDIEKMWDQMYFSTLYY-GRKGVVLNTISGVDLALWDLLAKVRKEPVY
RHMD_PARXL      KHLARFLEGQLVTDIEKMWDQMYFSTLYY-GRKGVVLNTISGVDLALWDLLAKVRKEPVY
RHMD_PARP8      KHLARFLEGQLVTDIEKMWDQMYFSTLYY-GRKGVVLNTISGVDLALWDLLAKVRKEPVY
RHMD_BURA4      RHLARFLEGRCVTDIETMWDQMYYATLYY-GRKGVVLNTISGVDLALWDLLGKVRGEPVY
RHMD_POLSJ      KHLARFIEGAKVTDIEKIWDQMFNATLYY-GRKGIVLNTISGVDLALWDLLAKVRKEPVH
RHMD_VEREI      KHLARFLEGARVTDIEKMWDQMYSATLYY-GRKGIVINTISGVDLALWDLLAKIRKEPVH
RHMD_DELAS      KHLARFLEGARVTDIERIWDQMYLSTLYY-GRKGIVINTISGVDLALWDLLGKVRGEPVH
RHMD_AZOC5      KHLARFIEGAKITDIELMWDQMYRSTLYY-GRKGLVVNTISGVDLALWDLLAKWRKEPVY
RHMD_SACEN      KHLARFVEGASVTDVEKIWDQMFNATLYY-GRKGLVLNAISAVDLALYDLLGKIRQEPVY
RHMD_SALPC      KHLNRFIEGKCVSDIKLIHDQMLGATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_SALTY      KHLNRFIEGKCVSDIKLIHDQMLGATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_SALPA      KHLNRFIEGKCVSDIKLIHDQMLGATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_SALPK      KHLNRFIEGKCVSDIKLIHDQMLGATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_SALG2      KHLNRFIEGKCVSDIKLIHDQMLGATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_SALEP      KHLNRFIEGKCVSDIKLIHDQMLGATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_SALCH      KHLNRFIEGKCVSDIKLIHDQMLGATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_SALPB      KHLNRFIEGKCVSDIKLIHDQMLGATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_SALTI      KHLNRFIEGKCVSDIKLIHDQMLGATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_SALNS      KHLNRFIEGKCVSDIKLIHDQMLGATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_SALDC      KHLNRFIEGKCVSDIKLIHDQMLGATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_SALA4      KHLNRFIEGKCVSDIKLIHDQMLGATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_SALSV      KHLNRFIEGKCVSDIKLIHDQMLGATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_SALHS      KHLNRFIEGKCVSDIKLIHDQMLGATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_ECOLC      KHLNRFIEGKCVSDIKLIHDQMLSATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_ECOBW      KHLNRFIEGKCVSDIKLIHDQMLSATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_ECODH      KHLNRFIEGKCVSDIKLIHDQMLSATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_ECOLI      KHLNRFIEGKCVSDIKLIHDQMLSATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_ECOHS      KHLNRFIEGKCVSDIKLIHDQMLSATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_ECO57      KHLNRFIEGKCVSDIKLIHDQMLNATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_SHIBS      KHLNRFIEGKCVSDIKLIHDQMLNATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_ECOK1      KHLNRFIEGKCVSDIKLIHDQMLNATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_ECO45      KHLNRFIEGKCVSDIKLIHDQMLNATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_ECOUT      KHLNRFIEGKCVSDIKLIHDQMLNATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_ECOL6      KHLNRFIEGKCVSDIKLIHDQMLNATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_ECOL5      KHLNRFIEGKCVSDIKLIHDQMLNATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_ECO81      KHLNRFIEGKCVSDIKLIHDQMLNATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_ECO27      KHLNRFIEGKCVSDIKLIHDQMLNATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_ECOSM      KHLNRFIEGKCVSDIKLIHDQMLNATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_KLEP3      KHLNRFIEGKCVSDIKLIHDQMLNATLYYAGSGGLVMNTLSCVDLALWDLFGKVVGLPVY
RHMD_KLEP7      KHLNRFIEGKCVSDIKLIHDQMLNATLYYAGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_TOLAT      KHLNRFIEGKCVSDIKLIHDQMLGATMYYAGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_SHISS      KHLNRFIEGKCVSDIKLIHDQMLNATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
RHMD_CALMQ      NHLSRFVVGKYVGEVEKTWDQMFKATIYY-GRRGIVMNAISAVDLALWDLMGKVRGLPVY
                .** **: *  : :::   ***  :*:** *  *:*:*::* *****:**:.*    **:

RHMD_BURCA      QLLGGKVRDELEFYATGARPDLAKEMGFIGGKLPLHHGPAEGEAGLRRNLDALADMRSRV
RHMD_BURCH      QLLGGKVRDELEFYATGARPDLAKEMGFIGGKLPLHHGPAEGEAGLRRNLDALADMRSRV
RHMD_BURCC      QLLGGKVRDELEFYATGARPDLAKEMGFIGGKLPLHHGPAEGEAGLRRNLDALADMRSRV
RHMD_BURCM      QLLGGKVRDELEFYATGARPDLAKEMGFIGGKLPLHHGPAEGDAGLRRNLDALADMRSRV
RHMD_PARPJ      QLLGGPVRDELVFYATGARPDLAKEMGFIGGKLPLQHGPAEGEAGLKQNLEKLADMRSRV
RHMD_PARXL      QLLGGPVRDELVFYATGARPDLAKEMGFIGGKLPLQHGPAEGDAGLRQNLDKLAEMRSRV
RHMD_PARP8      QLLGGPVRDELQFYATGARPDLAKEMGFIGGKLPLQHSPAEGEEGLRKNIDKLAEMRGRV
RHMD_BURA4      QLLGGPVRDELVFYATGARPDLAKQMGFIGGKLPLQHGPAENEEGLRKNLEKLADMRNRV
RHMD_POLSJ      ALLGGPVRDELTFYATGARPDLAKKMGFIGGKLPLHHGPAEREEGLKKNLELLGEMRQRV
RHMD_VEREI      ALLGGPVRDELIFYATGARPDLARQMGFIGGKMPLHHAPAEREEGLAKNLDMIGDMRSKV
RHMD_DELAS      QLLGGAVRDELQFYATGARPDLAQKMGFIGGKMPLHHGPAEGEEGLRRNLQELATMRERV
RHMD_AZOC5      HLLGGAVRDELQFYATGARPDLAKEMGFIGGKMALHHGPAEGEEGLRKNLDILNDMRNKV
RHMD_SACEN      ALLGGPVRDELQCYATTGRPDVAKELGFLGGKMTLQHGPAEGVEGLHANIERLRKMREQV
RHMD_SALPC      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_SALTY      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_SALPA      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPAHWGPHDGDAGIRKDAAMVADMREKC
RHMD_SALPK      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPAHWGPHDGDAGIRKDAAMVADMREKC
RHMD_SALG2      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_SALEP      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_SALCH      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_SALPB      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_SALTI      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_SALNS      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_SALDC      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_SALA4      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_SALSV      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_SALHS      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_ECOLC      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_ECOBW      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_ECODH      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_ECOLI      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_ECOHS      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_ECO57      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_SHIBS      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_ECOK1      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_ECO45      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_ECOUT      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_ECOL6      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_ECOL5      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_ECO81      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_ECO27      KLLGGAVRDEIQFYATDARPDLAKEMGFIGGKMPTHWGPHDGDAGIHKDAAMVADMREKC
RHMD_ECOSM      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKC
RHMD_KLEP3      KLLGGAVRDEIQFYATGARPDLAQEMGFIGGKMPTHWGPHDGDAGIRKDVAMVADMREKC
RHMD_KLEP7      KLLGGAVRDEIQFYATGARPDLAQEMGFIGGKMPTHWGPHDGDAGIRKDVAMVADMREKC
RHMD_TOLAT      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDKGIRKDAAMVAEYREKC
RHMD_SHISS      KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAVMVADMREKC
RHMD_CALMQ      DLLGGPVRDELTFYATGPRPDVAKSLGFIGGKLPLIHGPADGIEGLRENVRIFKEAREKV
                 **** ****:  ***  ***:*:.:**:***:.   .* :   *:  :   .   * : 

RHMD_BURCA      GADFWLMLDCWMSLDVPYATRLAHEA-HALGLKWIEECLPPDDYWGYAKLRRDVPRGMLV
RHMD_BURCH      GADFWLMLDCWMSLDVPYATRLAHEA-HALGLKWIEECLPPDDYWGYAKLRRDVPRGMLV
RHMD_BURCC      GADFWLMLDCWMSLDVPYATRLAHEA-HALGLKWIEECLPPDDYWGYAKLRRDVPRGMLV
RHMD_BURCM      GDDFWLMLDCWMSLDVPYATRLAHGA-HALGLKWIEECLPPDDYWGYAKLRRDVPRGMLV
RHMD_PARPJ      GDDFWLMYDCWMSLDVPYATRLAQAA-HEYGLKWIEECLPPDDYWGYAELRRNVPRGMMV
RHMD_PARXL      GDDFWLMYDCWMSLDVPYATRLAQAA-HEYGLKWIEECLPPDDYWGYAELRRNVPRGMMV
RHMD_PARP8      GGDFWLMYDCWMSLDVTYATKLAKAA-HEHGLKWIEEALPPDDYWGYAELRRNVPRGMMV
RHMD_BURA4      GDDFWLMFDCWMSLDVRYATRLANAA-HEYGLKWIEECLPPDDYWGYADLRRNVPRGMMV
RHMD_POLSJ      GDDFWLMYDCWMSLDVEYATRLANAA-SEYKLKWIEEALPPDDYWGYAELRRNVPRGMLV
RHMD_VEREI      GKDFWLMLDCWMSLDVEYATRLATAARNEHGLKWIEEALSPDDYWGYAELRRNVPRGMLV
RHMD_DELAS      GPDFWLMLDCWMSLDVNYATRLAQGA-QAHGLKWIEEALPPDDYWGYAALRKNVPTGMLV
RHMD_AZOC5      GKDFWLMQDCWMALDVEYATRFSTIAWNEMGLKWTEEALPPDDYWGYAALKKNAPKGHLI
RHMD_SACEN      GPDFWLMFDCWMALDVEYATRLAHAA-AEYDLKWLEEALIPDDYWGYGELRRRMPSTMLM
RHMD_SALPC      GPDFWLMLDCWMSQDVNYATKLAHAC-APFNLKWIEECLPPQQYEGYRELKRNAPAGMMV
RHMD_SALTY      GPDFWLMLDCWMSQDVNYATKLAHAC-APFNLKWIEECLPPQQYEGYRELKRNAPAGMMV
RHMD_SALPA      GPDFWLMLDCWMSQDVNYATKLAHAC-APFNLKWIEECLPPQQYEGYRELKRNAPAGMMV
RHMD_SALPK      GPDFWLMLDCWMSQDVNYATKLAHAC-APFNLKWIEECLPPQQYEGYRELKRNAPAGMMV
RHMD_SALG2      GPDFWLMLDCWMSQDVNYATKLAHAC-APFNLKWIEECLPPQQYEGYRELKRNAPAGMMV
RHMD_SALEP      GPDFWLMLDCWMSQDVNYATKLAHAC-APFNLKWIEECLPPQQYEGYRELKRNAPAGMMV
RHMD_SALCH      GPDFWLMLDCWMSQDVNYATKLAHAC-APFNLKWIEECLPPQQYEGYRELKRNAPAGMMV
RHMD_SALPB      GPDFWLMLDCWMSQDVNYATKLAHAC-APFNLKWIEECLPPQQYEGYRELKRNAPAGMMV
RHMD_SALTI      GPDFWLMLDCWMSQDVNYATKLAHAC-APFNLKWIEECLPPQQYEGYRELKRNAPAGMMV
RHMD_SALNS      GPDFWLMLDCWMSQDVNYATKLAHAC-APFNLKWIEECLPPQQYEGYRELKRNAPAGMMV
RHMD_SALDC      GPDFWLMLDCWMSQDVNYATKLAHAC-APFNLKWIEECLPPQQYEGYRELKRNAPAGMMV
RHMD_SALA4      GPDFWLMLDCWMSQDVNYATKLAHAC-APFNLKWIEECLPPQQYEGYRELKRNAPAGMMV
RHMD_SALSV      GPDFWLMLDCWMSQDVNYATKLAHAC-APFNLKWIEECLPPQQYEGYRELKRNAPAGMMV
RHMD_SALHS      GPDFWLMLDCWMSQDVNYATKLAHAC-APFNLKWIEECLPPQQYEGYRELKRNAPAGMMV
RHMD_ECOLC      GEDFWLMLDCWMSQDVNYATKLAHAC-APYNLKWIEECLPPQQYESYRELKRNAPVGMMV
RHMD_ECOBW      GEDFWLMLDCWMSQDVNYATKLAHAC-APYNLKWIEECLPPQQYESYRELKRNAPVGMMV
RHMD_ECODH      GEDFWLMLDCWMSQDVNYATKLAHAC-APYNLKWIEECLPPQQYESYRELKRNAPVGMMV
RHMD_ECOLI      GEDFWLMLDCWMSQDVNYATKLAHAC-APYNLKWIEECLPPQQYESYRELKRNAPVGMMV
RHMD_ECOHS      GEDFWLMLDCWMSQDVNYATKLAHAC-APYNLKWIEECLPPQQYEGYRELKRNAPVGMMV
RHMD_ECO57      GEDFWLMLDCWMSQDVNYATKLAHAC-APYNLKWIEECLPPQQYEGYRELKRNAPVGMMV
RHMD_SHIBS      GEDFWLMLDCWMSQDVNYATKLAHAC-APYNLKWIEECLPPQQYEGYRELKRNAPVGMMV
RHMD_ECOK1      GEDFWLMLDCWMSQDVNYATKLAHAC-APYNLKWIEECLPPQQYEGYRELKHNAPAGMMV
RHMD_ECO45      GEDFWLMLDCWMSQDVNYATKLAHAC-APYNLKWIEECLPPQQYEGYRELKHNAPAGMMV
RHMD_ECOUT      GEDFWLMLDCWMSQDVNYATKLAHAC-APYNLKWIEECLPPQQYEGYRELKHNAPAGMMV
RHMD_ECOL6      GEDFWLMLDCWMSQDVNYAIKLAHAC-APYNLKWIEECLPPQQYEGYRELKHNAPAGMMV
RHMD_ECOL5      GEDFWLMLDCWMSQDVNYAIKLAHAC-APYNLKWIEECLPPQQYEGYRELKHNAPAGMMV
RHMD_ECO81      GEDFWLMLDCWMSQDVNYAIKLAHAC-APYNLKWIEECLPPQQYEGYRELKHNAPAGMMV
RHMD_ECO27      GEDFWLMLDCWMSQDVNYATKLAHAC-APYNLKWIEECLPPQQYEGYRELKRNAPAGMMV
RHMD_ECOSM      GEDFWLMLDCWMSQDVNYATKLAHAC-APYNLKWIEECLPPQQYEGYRELKRNAPAGMMV
RHMD_KLEP3      GPDFWLMLDCWMSQDVNYATKLAHAC-APYNLKWIEECLPPQQYEGYRELKRQAPAGMMV
RHMD_KLEP7      GPDFWLMLDCWMSQDVNYATKLAHAC-APYNLKWIEECLPPQQYEGYRELKRQAPAGMMV
RHMD_TOLAT      GPDFWLMLDCWMSQDVNYATKLAYAC-APYNLKWIEECLPPQQYEGYRELKRNAPPGMMV
RHMD_SHISS      GEDFWLMLDCWMSQDVNYATKLAHAC-APYNLKWIEECLPPQQYEGYRELKRNAPVGMMV
RHMD_CALMQ      GDDFLLMYDCWMSLDLPYAQRLLSEL-KPYGLFWIEEPFIPDDYWSFGALANIAPP-TLV
                * ** ** ****: *: ** ::         * * ** : *::* .:  * .  *   ::

RHMD_BURCA      TTGEHEATRWGFRMLLEMECCDIIQPDVGWCGGLTELMRISALADARGVLVIPHGSSVYS
RHMD_BURCH      TTGEHEATRWGFRMLLEMECCDIIQPDVGWCGGLTELMRISALADARGVLVIPHGSSVYS
RHMD_BURCC      TTGEHEATRWGFRMLLEMECCDIIQPDVGWCGGLTELIRISALADARGVLVIPHGSSVYS
RHMD_BURCM      TTGEHEATRWGFRMLLEMECCDIIQPDVGWCGGLTELMRISALADARGVLVIPHGSSVYS
RHMD_PARPJ      STGEHEATRWGFRMLLEMQCCDLIQPDVGWCGGITELIKISALADAHNVMVVPHGSSVYS
RHMD_PARXL      STGEHEATRWGFRMLLEMQCCDLIQPDVGWCGGITELIKISALADAHNVMVVPHGSSVYS
RHMD_PARP8      STGEHEATRWGFRMLLEMGCCDLIQPDVGWCGGITELVKISALADAHNVLVVPHGSSVYS
RHMD_BURA4      STGEHEATRWGFRMLLEMGCCDLIQPDVGWCGGITELIKISALADAHNVMVVPHGSSVYS
RHMD_POLSJ      TTGEHEATRWGFRMLLEMECCDILQPDVGWCGGITELLKISALADAHGKLVVPHGSSVYS
RHMD_VEREI      TTGEHEATRWGFRLLLEMGCCDIIQPDVGWCGGITELIKISNLADAHGKLVVPHGSSVYS
RHMD_DELAS      TTGEHEATRWGFRQLLEMGCCDIIQPDVGWCGGITELLKISALADAHQALVIPHGSSVYS
RHMD_AZOC5      TTGEHEATRWGFKMLLDMECCDIIQPDVGWCGGITELIKITALADAAGVLVVPHGSSVYS
RHMD_SACEN      TTGEHEHTRYGFRLLLEMGRPDIIQPDVNWCGGITELIKISALADAHGAMVVPHGSSVYS
RHMD_SALPC      TSGEHHGTLQSFRTLAETG-IDIMQPDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYS
RHMD_SALTY      TSGEHHGTLQSFRTLAETG-IDIMQPDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYS
RHMD_SALPA      TSGEHHGTLQSFRTLAETG-IDIMQPDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYS
RHMD_SALPK      TSGEHHGTLQSFRTLAETG-IDIMQPDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYS
RHMD_SALG2      TSGEHHGTLQSFRTLAETG-IDIMQPDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYS
RHMD_SALEP      TSGEHHGTLQSFRTLAETG-IDIMQPDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYS
RHMD_SALCH      TSGEHHGTLQSFRTLAETG-IDIMQPDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYS
RHMD_SALPB      TSGEHHGTLQSFRTLAETG-IDIMQPDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYS
RHMD_SALTI      TSGEHHGTLQSFRTLAETG-IDIMQPDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYS
RHMD_SALNS      TSGEHHGTLQSFRTLAETG-IDIMQPDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYS
RHMD_SALDC      TSGEHHGTLQSFRTLAETG-IDIMQPDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYS
RHMD_SALA4      TSGEHHGTLQSFRTLAETG-IDIMQPDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYS
RHMD_SALSV      TSGEHHGTLQSFRTLAETG-IDIMQPDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYS
RHMD_SALHS      TSGEHHGTLQSFRTLSETG-IDIMQPDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYS
RHMD_ECOLC      TSGEHHGTLQSFRTLSETG-IDIMQPDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYS
RHMD_ECOBW      TSGEHHGTLQSFRTLSETG-IDIMQPDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYS
RHMD_ECODH      TSGEHHGTLQSFRTLSETG-IDIMQPDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYS
RHMD_ECOLI      TSGEHHGTLQSFRTLSETG-IDIMQPDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYS
RHMD_ECOHS      TSGEHHGTLQSFRTLSETG-IDIMQPDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYS
RHMD_ECO57      TSGEHHGTLQSFRTLSETG-IDIMQPDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYS
RHMD_SHIBS      TSGEHHGTLQSFRTLSETG-IDIMQPDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYS
RHMD_ECOK1      TSGEHHGTLQSFRTLSETG-IDIMQPDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYS
RHMD_ECO45      TSGEHHGTLQSFRTLSETG-IDIMQPDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYS
RHMD_ECOUT      TSGEHHGTLQSFRTLSETG-IDIMQPDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYS
RHMD_ECOL6      TSGEHHGTLQSFRTLSETG-IDIMQPDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYS
RHMD_ECOL5      TSGEHHGTLQSFRTLSENG-IDIMQPDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYS
RHMD_ECO81      TSGEHHGTLQSFRTLSETG-IDIMQPDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYS
RHMD_ECO27      TSGEHHGTLQSFRTLSETG-IDIMQPDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYS
RHMD_ECOSM      TSGEHHGTLQSFRTLSETG-IDIMQPDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYS
RHMD_KLEP3      TSGEHHGTLQSFRTLSETG-IDIMQPDVGWCGGLTTLVEIAAIAKARGQLVVPHGSSVYS
RHMD_KLEP7      TSGEHHGTLQSFRTLSETG-IDIMQPDVGWCGGLTTLVEIAAIAKARGQLVVPHGSSVYS
RHMD_TOLAT      TSGEHHGTLQSFQTLSETG-IDIMQPDVGWCGGLTTLVEVAAIAKARGQLVVPHGSSVYS
RHMD_SHISS      TSGEHHGTLQSFRTLSETG-IDIMQPDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYS
RHMD_CALMQ      ASGEHESTVHGFRLLLELGKVNVIQPDVTWVGGVTPMIKIAALAEAYGAWVIPHGSSVYG
                ::***. *  .*: * :    :::**** * **:* ::.:: :*.:    *:*******.

RHMD_BURCA      YHFVTTRHNSPFAEFLMMAPQADRVVPMFDPLLLDEPVPVGGRMKVP--DTPGFGVRLNP
RHMD_BURCH      YHFVTTRHNSPFAEFLMMAPQADRVVPMFDPLLLDEPVPVGGRMKVP--DTPGFGVRLNP
RHMD_BURCC      YHFVATRHNSPFAEFLMMAPQADRVVPMFDPLLLDEPVPVGGRMKVP--DTPGFGVRLNP
RHMD_BURCM      YHFVATRHNSPFAEFLMMAPQADRVVPMFDPLLLDEPVPVGGRMKVP--DTAGFGVRLNP
RHMD_PARPJ      YHFVVTRHNSPFAEFLMMAPKADEVVPMFTPLLLDEPVPVNGRMKVP--DTPGFGVRLNP
RHMD_PARXL      YHFVVTRHNSPFAEFLMMAPKADEVVPMFTPLLLDEPVPVNGRMKVP--DAPGFGVRLNP
RHMD_PARP8      YHFVVTRHNSPFAEFLMMAPKADQVVPMFTPLLLDEPVPVNGRMRVP--DTPGFGVRLNP
RHMD_BURA4      YHFVVTRHNSPFAEFLMMAPKADEVVPMFTPLLLDEPVPVNGRMKVP--DRPGFGVRLNP
RHMD_POLSJ      YHFVITRHNSPFSEFLMMAPKADEVVPMFNPMLLDEPVPVNGRMKASALDAPGFGVRLNP
RHMD_VEREI      YHFVITRQNSPFAEFLMMAPKADEVVPMFNPQLLDEPVPVNGRIKASALDAPGFGVRLNP
RHMD_DELAS      YHFVATRHNSPFAEFLMMAPKADEVVPMFHPQLLGEPVPVNGRMRLSALDRPGFGVELNP
RHMD_AZOC5      YHFVITRHNSPFAEFLMMHPVPDQVVPMFTPLLLDEPVPVNGRLKLD--DTPGFGVRLNP
RHMD_SACEN      YHFVITRHNSPFTEFLMMHPQATEVVPMFSPLLLDEPVPVGGRLRLP--ETPGFGVRLNP
RHMD_SALPC      HHAVITFTNTPFSEFLMTSPDCSTLRPQFDPILLDELVPVNGRIHKSVLDKPGFGVELNR
RHMD_SALTY      HHAVITFTNTPFSEFLMTSPDCSTLRPQFDPILLDEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_SALPA      HHAVITFTNTPFSEFLMTSPDCSTLRPQFDPILLDEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_SALPK      HHAVITFTNTPFSEFLMTSPDCSTLRPQFDPILLDEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_SALG2      HHAVITFTNTPFSEFLMTSPDCSTLRPQFDPILLDEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_SALEP      HHAVITFTNTPFSEFLMTSPDCSTLRPQFDPILLDEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_SALCH      HHAVITFTNTPFSEFLMTSPDCSTLRPQFDPILLDEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_SALPB      HHAVITFTNTPFSEFLMTSPDCSTLRPQFDPILLDEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_SALTI      HHAVITFTNTPFSEFLMTSPDCSTLRPQFDPILLDEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_SALNS      HHAVITFTNTPFSEFLMTSPDCSTLRPQFDPILLDEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_SALDC      HHAVITFTNTPFSEFLMTSPDCSTLRPQFDPILLDEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_SALA4      HHAVITFTNTPFSEFLMTSPDCSTLRPQFDPILLDEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_SALSV      HHAVITFTNTPFSEFLMTSPDCSTLRPQFDPILLDEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_SALHS      HHAVITFTNTPFSEFLMTSPDCSTLRPQFDPILLDEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_ECOLC      HHAVITFTNTPFSEFLMTSPDCSTMRPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_ECOBW      HHAVITFTNTPFSEFLMTSPDCSTMRPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_ECODH      HHAVITFTNTPFSEFLMTSPDCSTMRPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_ECOLI      HHAVITFTNTPFSEFLMTSPDCSTMRPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_ECOHS      HHAVITFTNTPFSEFLMTSPDCSTMRPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_ECO57      HHAVITFTNTPFSEFLMTSPDCSTMRPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_SHIBS      HHAVITFTNTPFSEFLMTSPDCSTMRPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_ECOK1      HHAVITFTNTPFSEFLMTSPDCSTMRPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_ECO45      HHAVITFTNTPFSEFLMTSPDCSTMRPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_ECOUT      HHAVITFTNTPFSEFLMTSPDCSTMRPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_ECOL6      HHAVITFTNTPFSEFLMTSPDCSTMRPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_ECOL5      HHAVITFTNTPFSEFLMTSPDCSTMRPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_ECO81      HHAVITFTNTPFSEFLMTSPDCSTMRPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_ECO27      HHAVITFTNTPFSEFLMTSPDCSTMRPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_ECOSM      HHAVITFTNTPFSEFLMTSPDCSTMRPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_KLEP3      HHAVITFTNTPFSEFLMTSPDCATLRPQFDPILLGEPVPERGRIHKSVLDKPGFGVELNR
RHMD_KLEP7      HHAVITFTNTPFSEFLMTSPDCATLRPQFDPILLGEPVPERGRIHKSVLDKPGFGVELNR
RHMD_TOLAT      HHAVITFTNTPFSEFLMTSPDCSVLRPQFDPILINEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_SHISS      HHAVITFTNTPFSEFLMTSPDCSTMRPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNR
RHMD_CALMQ      YHFIITRVNSPFAEYLVVSPDATKIVPQFHPLLRDEPIPQNGKVRLS--RKPGFGVELNR
                :* : *  *:**:*:*:  *    : * * * * .* :*  *:::      .****.** 

RHMD_BURCA      DVRMQRPYEH---
RHMD_BURCH      DVRMQRPYEH---
RHMD_BURCC      DVRMQRPYEH---
RHMD_BURCM      DVRMQRPYEH---
RHMD_PARPJ      ECALVRPYPR---
RHMD_PARXL      ECALVRPYAR---
RHMD_PARP8      ECKLERPYQH---
RHMD_BURA4      ECALVRPYTH---
RHMD_POLSJ      ECALQRPFPR---
RHMD_VEREI      DIALHRPYPRQAA
RHMD_DELAS      ECALHRPYTH---
RHMD_AZOC5      ECKLSRPYTH---
RHMD_SACEN      EVELRRPYDHD--
RHMD_SALPC      DCHLKRPYSH---
RHMD_SALTY      DCHLKRPYSH---
RHMD_SALPA      DCHLKRPYSH---
RHMD_SALPK      DCHLKRPYSH---
RHMD_SALG2      DCHLKRPYSH---
RHMD_SALEP      DCHLKRPYSH---
RHMD_SALCH      DCHLKRPYSH---
RHMD_SALPB      DCHLKRPYSH---
RHMD_SALTI      DCHLKRPYSH---
RHMD_SALNS      DCHLKRPYSH---
RHMD_SALDC      DCHLKRPYSH---
RHMD_SALA4      DCHLKRPYSH---
RHMD_SALSV      DCHLKRPYSH---
RHMD_SALHS      DCHLKRPYSH---
RHMD_ECOLC      DCNLKRPYSH---
RHMD_ECOBW      DCNLKRPYSH---
RHMD_ECODH      DCNLKRPYSH---
RHMD_ECOLI      DCNLKRPYSH---
RHMD_ECOHS      DCNLKRPYSH---
RHMD_ECO57      DCNLKRPYSH---
RHMD_SHIBS      DCNLKRPYSH---
RHMD_ECOK1      DCNLKRPYSH---
RHMD_ECO45      DCNLKRPYSH---
RHMD_ECOUT      DCNLKRPYSH---
RHMD_ECOL6      DCNLKRPYSH---
RHMD_ECOL5      DCNLKRPYSH---
RHMD_ECO81      DCNLNPPYSH---
RHMD_ECO27      DCNLKRPYSH---
RHMD_ECOSM      DCNLKRPYSH---
RHMD_KLEP3      DCNLKRPYQH---
RHMD_KLEP7      DCNLKRPYQH---
RHMD_TOLAT      DCKLKRPYTH---
RHMD_SHISS      DCNLKRPYSH---
RHMD_CALMQ      DL-LVRPFKST--
                :  :  *: