CLUSTAL format seed alignment for MF_01289

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DGOD_RALSO       MKITRLTTYRLPPRWMFLKIETDEGVAGWGEPVIEGRARTVEAAVHELADYLVGQDPRRI
DGOD_VEREI       MKITQLTTYRVPPRWMFLRIETDEGLIGWGEPVVEGHARAVQAAVHELEPYLIGQDPARI
DGOD_PECAS       MKITKITTYRLPPRWMFLKIETDEGIVGWGEPVIEGRARTVEAAVHELSDYLIGQDPARI
DGOD_SERP5       MKITKMTTYRLPPRWMFLKIETDEGIVGWGEPVIEGRARSVEAAVHELSEYVVGQDPARI
DGOD_SALCH       MKITHITTYRLPPRWMFLKIETDEGVVGWGEPVIESRARTVEAAVHEFADYLIGKDPARI
DGOD_SALPB       MKITHITTYRLPPRWMFLKIETDEGVVGWGEPVIEGRARTVEAAVHEFADYLIGKDPARI
DGOD_SALTY       MKITHITTYRLPPRWMFLKIETDEGVVGWGEPVIEGRARTVEAAVHEFADYLIGKDPARI
DGOD_KLEP7       MKITNITTYRLPPRWMFLKIETDEGIVGWGEPVIEGRARTVEAAVHEFGDYLIGQDPARI
DGOD_ENT38       MKITNITTYRLPPRWMFLKIETDEGVVGWGEPVIEGRARTVEAAVHELKEYLIGQDPARI
DGOD_ECOK1       MKITKITTYRLPPRWMFLKIETDEGVVGWGEPVIEGRARTVEAAVHELSDYLIGQDPSRI
DGOD_ECOL5       MKITKITTYRLPPRWMFLKIETDEGVVGWGEPVIEGRARTVEAAVHELSDYLIGQDPSRI
DGOD_ECOUT       MKITKITTYRLPPRWMFLKIETDEGVVGWGEPVIEGRARTVEAAVHELSDYLIGQDPSRI
DGOD_ECOLC       MKITKITTYRLPPRWMFLKIETDEGVVGWGEPVIEGRARTVEAAVHELGDYLIGQDPSRI
DGOD2_ECOSM      MKITKITTYRLPPRWMFLKIETDEGVVGWGEPVIEGRARTVEAAVHELGDYLIGQDPSRI
DGOD_ECODH       MKITKITTYRLPPRWMFLKIETDEGVVGWGEPVIEGRARTVEAAVHELGDYLIGQDPSRI
DGOD_ECO24       MKITKITTYRLPPRWMFLKIETDEGVVGWGEPVIEGRARTVEAAVHELGDYLIGQDPSRI
DGOD_ECOLI       MKITKITTYRLPPRWMFLKIETDEGVVGWGEPVIEGRARTVEAAVHELGDYLIGQDPSRI
DGOD_ECOHS       MKITKITTYRLPPRWMFLKIETDEGVVGWGEPVIEGRARTVEAAVHELGDYLIGQDPSRI
DGOD1_ECOSM      MKITKITTYRLPPRWMFLKIETDEGVVGWGEPVIEGRARTVEAAVHELGDYLIGQDPSRI
DGOD_CROS8       MKITKLTTYRLPPRWMFLKIETDEGVVGWGEPVIEGRARTVEAAVHELGEYLIGQDPARI
DGOD_XANOM       MKITRLTTYHAAPRWLFLKVETDEGITGWGEPVIEGRARSVEAAVHELAGYVVGKDPARI
DGOD_XANOP       MKITRLTTYHAAPRWLFLKVETDEGITGWGEPVIEGRARSVEAAVHELAGYVVGKDPARI
DGOD_XANAC       MKITRLTTYHAAPRWLFLKVETDEGITGWGEPVIEGRARSVEAAVHELAGYVVGKDPARI
DGOD_XANC5       MKITRLTTYHAAPRWLFLKVETDEGITGWGEPVIEGRARSVEAAVHELAGYVVGKDPARI
DGOD_XANC8       MKITRLTTYHAAPRWLFLKVETDEGITGWGEPVIEGRARSVEAAVHELAGYVVGKDPARI
DGOD_XANCB       MKITRLTTYHAAPRWLFLKVETDEGITGWGEPVIEGRARSVEAAVHELAGYVVGKDPARI
DGOD_XANCP       MKITRLTTYHAAPRWLFLKVETDEGITGWGEPVIEGRARSVEAAVHELAGYVVGKDPARI
                 ****.:***: .***:**::*****: ******:*.:**:*:*****:  *::*:** **

DGOD_RALSO       NDLWQTLYRGGFYRGGPILMSAIAGIDQALWDIKGKVLGVPVYELLGGLVRDRMRTYSWV
DGOD_VEREI       NDLWQVMYRAGFYRGGAVFMSAIAGVDQALWDIKGKALGVPVYQLLGGLVRDRMRTYGWV
DGOD_PECAS       NDIWQVLYRAGFYRGGPILMSAIAGIDQALWDIKGKALGVPVYQLLGGLVRDKIKAYSWV
DGOD_SERP5       NDIWQTLYRGGFYRGGPILMSAIAGIDQALWDIKGKALGVPVYQLLGGLVRDKIKAYSWV
DGOD_SALCH       NDLWQVMYRAGFYRGGPIMMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSWV
DGOD_SALPB       NDLWQVMYRAGFYRGGPIMMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSWV
DGOD_SALTY       NDLWQVMYRAGFYRGGPIMMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSWV
DGOD_KLEP7       NDLWQVMYRGGFYRGGPIMMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSWV
DGOD_ENT38       NDLWQVMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSWV
DGOD_ECOK1       NDLWQVMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSWV
DGOD_ECOL5       NDLWQVMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSWV
DGOD_ECOUT       NDLWQVMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSWV
DGOD_ECOLC       NDLWQVMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSWV
DGOD2_ECOSM      NDLWQVMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSWV
DGOD_ECODH       NDLWQVMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSWV
DGOD_ECO24       NDLWQVMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSWV
DGOD_ECOLI       NDLWQVMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSWV
DGOD_ECOHS       NDLWQVMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSWV
DGOD1_ECOSM      NDLWQVMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLNSPVWQLMGGLVRDKIKAYSWV
DGOD_CROS8       NDLWQVMYRGGFYRGGPILMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSWV
DGOD_XANOM       NDLWQTMYRAGFYRGGAILMSAIAGIDQALWDIKGKALGVPVYELLGGLVRDRMKTYRWV
DGOD_XANOP       NDLWQTMYRAGFYRGGAILMSAIAGIDQALWDIKGKALGVPVYELLGGLVRDRMKTYRWV
DGOD_XANAC       NDLWQTLYRAGFYRGGAILMSAIAGIDQALWDIKGKALGVPVYELLGGLVRDRMKTYRWV
DGOD_XANC5       NDLWQTLYRAGFYRGGAILMSAIAGIDQALWDIKGKTLGVPVYELLGGLVRDRMKTYRWV
DGOD_XANC8       NDLWQTMYRAGFYRGGAILMSAIAGIDQALWDIKGKALGVPVYELLGGLVRDRMKTYRWV
DGOD_XANCB       NDLWQTMYRAGFYRGGAILMSAIAGIDQALWDIKGKALGVPVYELLGGLVRDRMKTYRWV
DGOD_XANCP       NDLWQTMYRAGFYRGGAILMSAIAGIDQALWDIKGKALGVPVYELLGGLVRDRMKTYRWV
                 **:**.:**.******.::******:**********.*. **::*:******::::* **

DGOD_RALSO       GGDRPADVIAGMKALQAGGFDHFKLNGCEEMGIIDSARAVDAAVARVAEIRAAFGNTVEF
DGOD_VEREI       GGDRPADVIDGIRQRVDAGFTHFKLNGCEELGIIDSSRAVDAAVARVAQIRAAFGNTVEF
DGOD_PECAS       GGDRPSEVIAGIKKLTEIGFDTFKLNGCEEMGIIDNSRKVDAAVAVVAEIREAFGNSIEF
DGOD_SERP5       GGDRPSDVIAGINKLTEIGFDTFKLNGCEEMGIIDSARKVDAAVAVVAQIREAFGNRIEF
DGOD_SALCH       GGDRPADVIDGIEKLRGIGFDTFKLNGCEEMGVIDNSRAVDAAVNTVAQIREAFGSEIEF
DGOD_SALPB       GGDRPADVIDGIEKLRGIGFDTFKLNGCEEMGVIDNSRAVDAAVNTVAQIREAFGSEIEF
DGOD_SALTY       GGDRPADVIDGIEKLRGIGFDTFKLNGCEEMGVIDNSRAVDAAVNTVAQIREAFGSEIEF
DGOD_KLEP7       GGDRPAEVIDGIKKLRGIGFDTFKLNGCEEMGIIDNSRAVDAAVNTVAQIREAFGNEIEF
DGOD_ENT38       GGDRPAEVIDGIKTLRNIGFDTFKLNGCEEMGVIDNSRAVDKAVNTVAQIREAFGNEIEF
DGOD_ECOK1       GGDRPADVIDGIKTLREIGFDTFKLNGCEELGLIDNSRAVDAAVNTVAQIREAFGNQIEF
DGOD_ECOL5       GGDRPADVIDGIKTLREIGFDTFKLNGCEELGLIDNSRAVDAAVNTVAQIREAFGNQIEF
DGOD_ECOUT       GGDRPADVIDGIKTLREIGFDTFKLNGCEELGLIDNSRAVDAAVNTVAQIREAFGNQIEF
DGOD_ECOLC       GGDRPADVIDGIKTLREIGFDTFKLNGCEELGLIDNSRAVDAAVNTVAQIREAFGNQIEF
DGOD2_ECOSM      GGDRPADVIDGIKTLREIGFDTFKLNGCEELGLIDNSRAVDAAVNTVAQIREAFGNQIEF
DGOD_ECODH       GGDRPADVIDGIKTLREIGFDTFKLNGCEELGLIDNSRAVDAAVNTVAQIREAFGNQIEF
DGOD_ECO24       GGDRPADVIDGIKTLREIGFDTFKLNGCEELGLIDNSRAVDAAVNTVAQIREAFGNQIEF
DGOD_ECOLI       GGDRPADVIDGIKTLREIGFDTFKLNGCEELGLIDNSRAVDAAVNTVAQIREAFGNQIEF
DGOD_ECOHS       GGDRPADVIGGIKTLREIGFDTFKLNGCEELGLIDNSRAVDAAVNTVAQIREAFGNQIEF
DGOD1_ECOSM      GGDRPANVIDGIKILREIGFDTFKLNGCEELGLIDNSRAVDAAVNTVAQIREAFGNQIEF
DGOD_CROS8       GGDRPAEVIAGIKTLRQIGFDTFKLNGCEELGIIDDSRKVDAAVNTVAQIREEFGSDIEF
DGOD_XANOM       GGDRPGAIIQQITDYRALGFDTFKFNGTEEMKLIDSARAVDAAVVKVAEIREAFGNTIDF
DGOD_XANOP       GGDRPGAIIQQITDYRALGFDTFKFNGTEEMKLIDSARAVDAAVVKVAEIREAFGNTIDF
DGOD_XANAC       GGDRPGAIIQQITDYRALGFDTFKFNGTEEMKLIDSARAVDAAVVKVAEIRGAFGNTIDF
DGOD_XANC5       GGDRPGAIIQQITDYRALGFDTFKFNGTEEMKLIDSARAVDAAVVKVAEIREAFGNSIDF
DGOD_XANC8       GGDRPGAIIAQINDYRALGFDTFKFNGTEEMKLIDSARAVDAAVVKVAEIRETFGNSIDF
DGOD_XANCB       GGDRPGAIIAQINDYRALGFDTFKFNGTEEMKLIDSARAVDAAVVKVAEIRETFGNSIDF
DGOD_XANCP       GGDRPGAIIAQINDYRALGFDTFKFNGTEEMKLIDSARAVDAAVVKVAEIRETFGNSIDF
                 *****. :*  :      **  **:** **: :**.:* ** **  **:**  **. ::*

DGOD_RALSO       GLDFHGRVSAPMAKVLIRALEPYRPLFIEEPVLAEQAESYARLAAQTHLPIAAGERMFSR
DGOD_VEREI       GLDFHGRVSVAMAAVLIKELEYLRPLFIEEPVLAEQAEHYPKLAAKTHLPLAAGERMYSR
DGOD_PECAS       GLDFHGRVDAPMAKILIKELEPYRPLFIEEPVLAEQAEYYPRLAAQTHLPIAAGERMFSR
DGOD_SERP5       GLDFHGRVDAPMAKILIKELEPYRPLFIEEPVLAEQAEYYPRLAAQTHIPIAAGERMYSR
DGOD_SALCH       GLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAEYYPRLAAQTHIPIAAGERMFSR
DGOD_SALPB       GLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAEYYPRLAAQTHIPIAAGERMFSR
DGOD_SALTY       GLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAEYYPRLAAQTHIPIAAGERMFSR
DGOD_KLEP7       GLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAEYYPRLAAQTHIPIAAGERMFSR
DGOD_ENT38       GLDFHGRVSAPMAKVLIKELEQYRPLFIEEPVLAEQAEYYPKLAAQTHIPIAAGERMFSR
DGOD_ECOK1       GLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAEYYPKLAAQTHIPLAAGERMFSR
DGOD_ECOL5       GLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAEYYPKLAAQTHIPLAAGERMFSR
DGOD_ECOUT       GLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAEYYPKLAAQTHIPLAAGERMFSR
DGOD_ECOLC       GLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAEYYPKLAAQTHIPLAAGERMFSR
DGOD2_ECOSM      GLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAEYYPKLAAQTHIPLAAGERMFSR
DGOD_ECODH       GLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAEYYPKLAAQTHIPLAAGERMFSR
DGOD_ECO24       GLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAEYYPKLAAQTHIPLAAGERMFSR
DGOD_ECOLI       GLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAEYYPKLAAQTHIPLAAGERMFSR
DGOD_ECOHS       GLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAEYYPKLAAQTHIPLAAGERMFSR
DGOD1_ECOSM      GLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAEYYPKLAAQTHIPLAAGERMFSR
DGOD_CROS8       GLDFHGRVSAPMAKILIKELEPYRPLFIEEPVLAEQAEYYPRLAAQTHIPIAAGERMFSR
DGOD_XANOM       GIDFHGRVGAPMAKALLRELEPFKPLFVEEPVLAEQAEYYPRLAASTSIPLAAGERMFSR
DGOD_XANOP       GIDFHGRVGAPMAKALLRELEPFKPLFVEEPVLAEQAEYYPRLAASTSIPLAAGERMFSR
DGOD_XANAC       GIDFHGRVGAPMAKALLRELEPFKPLFVEEPVLAEQAEYYPRLAASTSIPLAAGERMFSR
DGOD_XANC5       GIDFHGRVGAPMAKALLRELEPFKPLFVEEPVLAEQAEYYPRLAASTSIPLAAGERMFSR
DGOD_XANC8       GIDFHGRVGAPMAKALLRELEPFKPLFVEEPVLAEQAEYYPRLAASTCIPLAAGERMFSR
DGOD_XANCB       GIDFHGRVGAPMAKALLRELEPFKPLFVEEPVLAEQAEYYPRLAASTCIPLAAGERMFSR
DGOD_XANCP       GIDFHGRVGAPMAKALLRELEPFKPLFVEEPVLAEQAEYYPRLAASTCIPLAAGERMFSR
                 *:******...**  *:: **  :***:********** *.:***.* :*:******:**

DGOD_RALSO       FEFKRVLEAGGLAILQPDLSHAGGITECLKIAGMAEAYDVALAPHCPLGPIALAACLHID
DGOD_VEREI       FEFKRVLAAGGIAILQPDLSHAGGISECLKIAAMAEAHDVAIAPHCPLGPIALASCLHVD
DGOD_PECAS       FDFKRVLADGGLAIIQPDLSHAGGITECFKIAAMAEAYDVALAPHCPLGPIALASCLHLD
DGOD_SERP5       FDFKRVLADGGLAIIQPDLSHAGGITECFKIAAMAETYDVALAPHCPLGPIALAACLHVD
DGOD_SALCH       FEFKRVLDAGGLAILQPDLSHAGGITECYKIAGMAEAYDVALAPHCPLGPIALAACLHID
DGOD_SALPB       FEFKRVLDAGGLAILQPDLSHAGGITECYKIAGMAEAYDVALAPHCPLGPIALAACLHID
DGOD_SALTY       FEFKRVLDAGGLAILQPDLSHAGGITECYKIAGMAEAYDVALAPHCPLGPIALAACLHID
DGOD_KLEP7       FEFKRVLEAGGVAILQPDLSHAGGITECYKIAGMAEAYDVGLAPHCPLGPIALAACLHVD
DGOD_ENT38       FEFKRVLEAGGLAILQPDLSHAGGITECYKIAGMAEAYDVALAPHCPLGPIALAACLHVD
DGOD_ECOK1       FDFKRVLEAGGISILQPDLSHAGGITECYKIAGMAEAYDVTLAPHCPLGPIALAACLHID
DGOD_ECOL5       FDFKRVLEAGGISILQPDLSHAGGITECYKIAGMAEAYDVTLAPHCPLGPIALAACLHID
DGOD_ECOUT       FDFKRVLEAGGISILQPDLSHAGGITECYKIAGMAEAYDVTLAPHCPLGPIALAACLHID
DGOD_ECOLC       FDFKRVLEAGGISILQPDLSHAGGITECYKIAGMAEAYDVTLAPHCPLGPIALAACLHID
DGOD2_ECOSM      FDFKRVLEAGGISILQPDLSHAGGITECYKIAGMAEAYDVTLAPHCPLGPIALAACLHID
DGOD_ECODH       FDFKRVLEAGGISILQPDLSHAGGITECYKIAGMAEAYDVTLAPHCPLGPIALAACLHID
DGOD_ECO24       FDFKRVLEAGGISILQPDLSHAGGITECYKIAGMAEAYDVTLAPHCPLGPIALAACLHID
DGOD_ECOLI       FDFKRVLEAGGISILQPDLSHAGGITECYKIAGMAEAYDVTLAPHCPLGPIALAACLHID
DGOD_ECOHS       FDFKRVLEAGGISILQPDLSHAGGITECYKIAGMAEAYDVTLAPHCPLGPIALAACLHID
DGOD1_ECOSM      FDFKRVLEAGGISILQPDLSHAGGITECYKIAGMAEAYDVTLAPHCPLGPIALAACLHID
DGOD_CROS8       FEFKRVLEAGGLAILQPDLSHAGGITECAKIAAMAEAYDVGLAPHCPLGPIALAACLHVD
DGOD_XANOM       FEFKNVLCAGGIGMVQPDLSHAGGITECVKIAAIAEAYDVGFAPHCPLGPIALAACLHVD
DGOD_XANOP       FEFKNVLCAGGIGMVQPDLSHAGGITECVKIAAIAEAYDVGFAPHCPLGPIALAACLHVD
DGOD_XANAC       FEFKNVLCAGGIGMVQPDLSHAGGITECVKIAAMAEAYDVGFAPHCPLGPIALAACLHVD
DGOD_XANC5       FEFKNVLCAGGIGMVQPDLSHAGGITECVKIAAMAEAYDVGFAPHCPLGPIALAACLHVD
DGOD_XANC8       FEFKNVLCAGGIGMVQPDLSHAGGITECVKIAAMAEAYDVGFAPHCPLGPIALAACLHVD
DGOD_XANCB       FEFKNVLCAGGIGMVQPDLSHAGGITECVKIAAMAEAYDVGFAPHCPLGPIALAACLHVD
DGOD_XANCP       FEFKNVLCAGGIGMVQPDLSHAGGITECVKIAAMAEAYDVGFAPHCPLGPIALAACLHVD
                 *:**.**  **:.::**********:** ***.:**::** :************:***:*

DGOD_RALSO       FVSWNATLQEQSMGIHYNQGAELLDYVRNKADFALEGGYIRPPRLPGLGVDIDEALVIER
DGOD_VEREI       YVSWNATLQEQGMGMHYNRGGEVLDYVLNPQDFRLDNGFIAPFTKPGLGVEINEALVLER
DGOD_PECAS       FVARNAVLQEQSMGIHYNKGAELLDYVINKEDFAMTDGHFYPLNKPGLGVEINEELVIER
DGOD_SERP5       FVARNAVFQEQSMGIHYNQGAELLDYVVNKDDFKMTDGHFYPLTKPGLGVEINEELVIER
DGOD_SALCH       FVSRNAVFQEQSMGIHYNKGAELLDFVKNKEDFSMDGGFFKPLTKPGLGVDIDEARVIEL
DGOD_SALPB       FVSRNAVFQEQSMGIHYNKGAELLDFVKNKEDFSMDGGFFKPLTKPGLGVDIDEARVIEL
DGOD_SALTY       FVSRNAVFQEQSMGIHYNKGAELLDFVKNKEDFSMDGGFFKPLTKPGLGVDIDEARVIEL
DGOD_KLEP7       FVSHNAVFQEQSMGIHYNKGAELLDFVKNKEDFNMEGGFFKPLMKPGLGVEIDEARVIEL
DGOD_ENT38       FVSRNAVFQEQSMGIHYNKGAELLDFVKNKEDFNMEGGFFKPLTKPGLGVEIDEAKVIEL
DGOD_ECOK1       FVSYNAVLQEQSMGIHYNKGAELLDFVKNKEDFSMVGGFFKPLTKPGLGVEIDEAKVIEF
DGOD_ECOL5       FVSYNAVLQEQSMGIHYNKGAELLDFVKNKEDFSMVGGFFKPLTKPGLGVEIDEAKVIEF
DGOD_ECOUT       FVSYNAVLQEQSMGIHYNKGAELLDFVKNKEDFSMAGGFFKPLTKPGLGVEIDEAKVIEF
DGOD_ECOLC       FVSYNAVLQEQSMGIHYNKGAELLDFVKNKEDFSMVGGFFKPLTKPGLGVEIDEAKVIEF
DGOD2_ECOSM      FVSYNAVLQEQSMGIHYNKGAELLDFVKNKEDFSMVGGFFKPLTKPGLGVEIDEAKVIEF
DGOD_ECODH       FVSYNAVLQEQSMGIHYNKGAELLDFVKNKEDFSMVGGFFKPLTKPGLGVEIDEAKVIEF
DGOD_ECO24       FVSYNAVLQEQSMGIHYNKGAELLDFVKNKEDFSMVGGFFKPLTKPGLGVEIDEAKVIEF
DGOD_ECOLI       FVSYNAVLQEQSMGIHYNKGAELLDFVKNKEDFSMVGGFFKPLTKPGLGVEIDEAKVIEF
DGOD_ECOHS       FVSYNAVLQEQSMGIHYNKGAELLDFVKNKEDFSMVGGFFKPLTKPGLGVEIDEAKVIEF
DGOD1_ECOSM      FVSYNAVLQEQSMGIHYNKGAELLDFVKNKEDFSMVGGFFKPLTKPGLGVEIDEAKVIEF
DGOD_CROS8       FISRNAVFQEQSMGIHYNQGAELLDFVKNKDDFKMEGGYFQPLMKPGLGVEIDEEQVVAR
DGOD_XANOM       FVSHNAVLQEQSIGIHYNEGADLLDYVINKDDFHCVDGSIAALPKPGLGVEIDEDMLKRA
DGOD_XANOP       FVSHNAVLQEQSIGIHYNEGADLLDYVINKDDFHCVDGSIAALPKPGLGVEIDEDMLKRA
DGOD_XANAC       FVSHNAVLQEQSIGIHYNEGADLLDYVVNKDDFHCVDGSIAALPKPGLGVEIDEEMLKRA
DGOD_XANC5       FVSHNAVLQEQSIGIHYNEGADLLDYVINKDDFHCVDGSIAALPKPGLGVEIDEEMLKRT
DGOD_XANC8       FVSHNAVLQEQSIGIHYNEGADLLDYVINKEDFHCVDGSIAALPKPGLGVEINEDMLKRA
DGOD_XANCB       FVSHNAVLQEQSIGIHYNEGADLLDYVINKEDFHCVDGSIAALPKPGLGVEINEDMLKRA
DGOD_XANCP       FVSHNAVLQEQSIGIHYNEGADLLDYVINKEDFHCVDGSIAALPKPGLGVEINEDMLKRA
                 ::: **.:***.:*:***.*.::**:* *  **   .* : .   *****:*:*  :   

DGOD_RALSO       SRSAPDWRNPVWRHADGSVAEW
DGOD_VEREI       SRDCPDWRNPVWRHADGSVAEW
DGOD_PECAS       SKNAPDWRNPVWRYPDGAVAEW
DGOD_SERP5       SKQATDWRNPVWRYPDGAVAEW
DGOD_SALCH       SKSAPDWRNPLWRHADGSVAEW
DGOD_SALPB       SKSAPDWRNPLWRHADGSVAEW
DGOD_SALTY       SKSAPDWRNPLWRHADGSVAEW
DGOD_KLEP7       SKNAPDWRNPLWRYEDGSVAEW
DGOD_ENT38       SKNAPDWRNPLWRHEDGSVAEW
DGOD_ECOK1       SKNAPDWRNPLWRHEDNSVAEW
DGOD_ECOL5       SKNAPDWRNPLWRHEDNSVAEW
DGOD_ECOUT       SKNAPDWRNPLWRHEDNSVAEW
DGOD_ECOLC       SKNAPDWRNPLWRHEDNSVAEW
DGOD2_ECOSM      SKNAPDWRNPLWRHEDNSVAEW
DGOD_ECODH       SKNAPDWRNPLWRHEDNSVAEW
DGOD_ECO24       SKNAPDWRNPLWRHEDNSVAEW
DGOD_ECOLI       SKNAPDWRNPLWRHEDNSVAEW
DGOD_ECOHS       SKNAPDWRNPLWRHEDNSVAEW
DGOD1_ECOSM      SKNAPDWRNPLWRHEDNSVAEW
DGOD_CROS8       SQGCADWRNPLWRHADGSVAEW
DGOD_XANOM       NENPPDWRNPVWRHSDGSIAEW
DGOD_XANOP       NENPPDWRNPVWRHSDGSIAEW
DGOD_XANAC       NENPPDWRNPVWRHSDGSIAEW
DGOD_XANC5       NENPPDWRNPVWRHSDGSIAEW
DGOD_XANC8       NENPPDWRNPVWRHADGSIAEW
DGOD_XANCB       NENPPDWRNPVWRHADGSIAEW
DGOD_XANCP       NENPPDWRNPVWRHADGSIAEW
                 ..  .*****:**: *.::***