CLUSTAL format seed alignment for MF_01297

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y836_MYCBO       ------------MSSGAGSDATGAGGVHAAGSGDRAVAA----AVERAKATAARNIPAFD
Y865_MYCBP       ------------MSSGAGSDATGAGGVHAAGSGDRAVAA----AVERAKATAARNIPAFD
Y823_MYCTA       ------------MSSGAGSDATGAGGVHAAGSGDRAVAA----AVERAKATAARNIPAFD
Y813_MYCTU       ------------MSSGAGSDATGAGGVHAAGSGDRAVAA----AVERAKATAARNIPAFD
Y753_MYCA1       -----------------MTSPE---SSSAAGSGDRAVAA----AAERAKLTAGRNIPSFD
Y643_MYCPA       ---MVCALHAVPAHHRRVVTPAGDDPSGPAGSGDRAVAA----AAERAKLTAGRNIPSFD
Y4871_MYCMM      ----------------MTSDASQDGPDAVAGSGDRAVAA----AAERAKLTAARNIPTFD
Y429_MYCUA       -------------------------------------------------MTAARNIPTFD
Y4916_MYCSJ      --------------MTAPQEPEDAAGSIFSTSGDRAVAD----AAERAKVTASRNIPVFD
Y4620_MYCSK      --------------MTAPQEPEDAAGSIFSTSGDRAVAD----AAERAKVTASRNIPVFD
Y4533_MYCSS      --------------MTAPQEPEDAAGSIFSTSGDRAVAD----AAERAKVTASRNIPVFD
Y5792_MYCS2      --------------MTPAGDTPERG------SGDRAVAE----AAERAKATGARNIPVFD
Y1642_MYCGI      --------------MT---------------SGDDAVAA----AAERARQTAARNIPVFD
Y5105_MYCVP      --------------MS---------------SGDEAVAA----AAQRARVTAARNIPVFG
Y2200_MYCLE      --------------MTSDEVRDGAGSPADSSKGNKCTAAGMFQAAKRSTVSAARNIPAFD
Y732_MYCA9       -----------------------------MTEPDPAAAE--------QRPSVGRNLPTFQ
Y591_NOCFA       MSDLASEGSDPAERASEHSNGNAPADRPARRSGDQAVAD----AAERAKATGSRNIPVLP
Y4852_RHOJR      ---------------------------MRRGSGDAAVAD----AIERSKTTAARNIPQLP
Y2482_CORGB      MSEN---STPNNPVVPGAGADGPSLSDSASISGSDAVNL----AAEQSKSTAHRNIPGLG
Y2579_CORGL      MSEN---STPNNPVVPGAGADGPSLSDSASISGSDAVNL----AAEQSKSTAHRNIPGLG
Y2471_COREF      MSENETSKTGGNAGVPGSGADAPSLSDSPAISGNDAVNL----AAEQAKNTAHRNIPTLD
Y1915_CORDI      MPSK-------QVGWWTMSEHTNDEVQPTALSGNDAVNR----AAEQWKESAHRNIPGLG
Y374_CORJK       --------------------MAEEENKKFKVNANDAVNL----AAEQSKSTSDKNLPEFG
Y1611_CORU7      MSSD---KANNQSPDQGANTPAESTNSGPKLDGNQAVNL----AAEQSKSTADKNLPVFG
Y7110_SACEN      ---------------------MTSSDQPERGSGDAAVQA----AAERAEQTRGRNVPQFD
Y373_SALAI       ------------------------------------MSD------ENPLQPPWLNAPPVD
Y310_SALTO       ------------------------------------MSD------ENPLQPPWLNAPPVD
Y2717_MYCTU      ------------------------------------------------------------
Y2745_MYCTA      ------------------------------------------------------------
Y2736_MYCBO      ------------------------------------------------------------
Y2730_MYCBP      ------------------------------------------------------------
Y3611_MYCA1      ------------------------------------------------------------
Y2833_MYCPA      ------------------------------------------------------------
Y1006_MYCLE      ------------------------------------------------------------
Y1995_MYCMM      ------------------------------------------------------------
Y3360_MYCUA      ------------------------------------------------------------
Y408_MYCSJ       -----------------------------------------------------------M
Y421_MYCSS       -----------------------------------------------------------M
Y449_MYCVP       ------------------------------------------------------------
Y302_MYCGI       ------------------------------------------------------------
Y6574_MYCS2      ------------------------------------------------------------
Y4114_NOCFA      ------------------------------------------------------------
Y5653_RHOJR      ----------------------------------------------------MDENSTLS
Y1365_STRAW      -------------------------------------------------------MVDPA
Y442_STRGG       -------------------------------------------------------MHHPA
Y452_FRACC       -----------------------------------------------MSAGKRSAAGSAR
Y6164_FRASN      --------------------------------------MGADATGDTAARGDRAAHGDTA
Y2983_PAEAT      ------------------------------------------------------------
Y3010_ARTS2      ------------------------------------------------------------
Y970_RENSM       ------------------------------------------------------------
Y575_KOCRD       ------------------------------------------------------------
Y2499_CLAM3      ------------------------------------------------------------
Y2734_CLAMS      ------------------------------------------------------------
Y1835_LEIXX      ------------------------------------------------------------
Y882_KINRD       ------------------------------------------------------------
Y2872_THEFY      ------------------------------------------------------------
Y4030_STRAW      ------------------------------------------------------------
Y4179_STRCO      ------------------------------------------------------------
Y3970_STRGG      ------------------------------------------------------------
Y347_CUTAK       ------------------------------------------------------------
Y4252_NOCSJ      ------------------------------------------------------------
                                                                             

Y836_MYCBO       DLPVPADTANLREGADLNNALLALLPLVGVWRGEGEGRGPD----GDYRFGQQIVVSHDG
Y865_MYCBP       DLPVPADTANLREGADLNNALLALLPLVGVWRGEGEGRGPD----GDYRFGQQIVVSHDG
Y823_MYCTA       DLPVPADTANLREGADLNNALLALLPLVGVWRGEGEGRGPD----GDYRFGQQIVVSHDG
Y813_MYCTU       DLPVPADTANLREGADLNNALLALLPLVGVWRGEGEGRGPD----GDYRFGQQIVVSHDG
Y753_MYCA1       DLPLPADTANLREGADLSDALLALLPLVGVWRGEGEGRGHD----GDYRFGQQIVVSHDG
Y643_MYCPA       DLPLPADTANLREGANLSDALLALLPLVGVWRGEGEGRGHD----GDYRFGQQIVVSHDG
Y4871_MYCMM      DLPLPADTANLRHGANLHDALLALLPLVGVWRGEGEGRGPH----GDYRFGQQIVVSHDG
Y429_MYCUA       DLPLPADTANLRHGANLHDALLALLPLVGVWRGEGEGRGPH----GDYRFGQQIVVSHDG
Y4916_MYCSJ      DLPLPADTANLRKGVDFNDALLALLPLVGVWRGEGEGRGPH----GDYRFGQQIVVSHDG
Y4620_MYCSK      DLPLPADTANLRKGVDFNDALLALLPLVGVWRGEGEGRGPH----GDYRFGQQIVVSHDG
Y4533_MYCSS      DLPLPADTANLRKGVDFNDALLALLPLVGVWRGEGEGRGPH----GDYRFGQQIVVSHDG
Y5792_MYCS2      DLPLPADTANLRDGVSLSDSLLALLPLVGVWRGEGEGRDAD----GDYRFGQQIVVSHDG
Y1642_MYCGI      DLPLPSDTANLREGVDLDDALLALLPLIGVWRGEGEGRDAH----GDYRFGQQIIVSHDG
Y5105_MYCVP      DLPLPADTANLREGANLDDALLALLPLVGVWRGEGEGRAAH----GDYRFGQQIVVSHDG
Y2200_MYCLE      DLPVPSDTANLREGANLNSTLLALLPLVGVWRGEGEGRGPN----GDYHFGQQIVVSHDG
Y732_MYCA9       DLPIPADTANLREGPDLNAAMLALLPLVGVWRGEGEGRDTD----GDYRFGQQIVVAHDG
Y591_NOCFA       DLPLPEDTANLRLGPDLSPAMLALLPMVGVWRGEGEGNDPAR---GDYRFGQQIIVSHDG
Y4852_RHOJR      DLPLPEDTANLRLGPDLNNELLAVLPLVGVWRGEGEGHDPDT---GDYPFGQQIIVSHNG
Y2482_CORGB      DLPIPDDTANLREGPNLHDGLLALLPLVGVWRGEGQADTAED---GQYAFGQQITFAHDG
Y2579_CORGL      DLPIPDDTANLREGPNLHDGLLALLPLVGVWRGEGQADTAED---GQYAFGQQITFAHDG
Y2471_COREF      DLPIPEDTANLRLGPNLHDGLLALLPLVGVWRGEGQADTPEG---GQYSFGQQIIFSHDG
Y1915_CORDI      DLPIPDDTANLREGPNLHDGLLALLPLVGVWRGTGHADTAEE---GQYAFGQQITFAHDG
Y374_CORJK       DMPIPDDTANLRKGPNLHDGLLALLPLIGVWRGQGQAAPPGE---EEFTFGQQVVFAHDG
Y1611_CORU7      DLPIPEDTANLRFGPNLHDGLLALLPLVGVWRGQGQAAHPGE---EEFTFGQQLSIFHDG
Y7110_SACEN      DLPGVGDTANLRLGPELNQACLALLPLVGVWRGDGEAKHPSLE--ESYWFRQQVSFAHDG
Y373_SALAI       PYPY-EESHDLRTGPKLHPALDGLLPYVGVWRGRGRGGYPTI---EDFDYGQEIRISHDG
Y310_SALTO       SYPY-EESHDLRTGPKLHPTLDGLLPYIGVWRGRGRGGYPTI---EDFDFAQEIRISHDG
Y2717_MYCTU      ------------MTRDLAPALQALSPLLGSWAGRGAGKYPTIR---PFEYLEEVVFAHVG
Y2745_MYCTA      ------------MTRDLAPALQALSPLLGSWAGRGAGKYPTIR---PFEYLEEVVFAHVG
Y2736_MYCBO      ------------MTRDLAPALQALSPLLGSWAGRGAGKYPTIR---PFEYLEEVVFAHVG
Y2730_MYCBP      ------------MTRDLAPALQALSPLLGSWAGRGAGKYPTIR---PFEYLEEVVFAHVG
Y3611_MYCA1      ------------MPTDLHPDLAALAPLLGTWTGRGSGKYPTIQ---PFDYLEEVTFSHVG
Y2833_MYCPA      ------------MPTDLHPDLAALAPLLGTWTGRGSGKYPTIQ---PFDYLEEVTFSHVG
Y1006_MYCLE      ------------MPSDLCPDLQALAPLLGSWVGRGMGKYPTIQ---PFEYLEEVVFSHLD
Y1995_MYCMM      ------------MPADLHPDLDALAPLLGTWAGQGSGEYPTIE---PFEYLEEVVFSHVG
Y3360_MYCUA      ------------MPADLHPDLDALAPLLGTWAGQGAGEYPTIE---PFEYLEEVVFSHVG
Y408_MYCSJ       NARSTYPGDVAVTIPEVHPDLTALAPLLGTWSGKGSGEYPTIE---PFDYTEEITFGHTG
Y421_MYCSS       NARSTYPGDVAVTIPEVHPDLTALAPLLGTWSGKGSGEYPTIE---PFDYTEEITFGHTG
Y449_MYCVP       ---------MADSVPALHPDVAALAPLLGTWVGEGSGEYPTIE---PFGYTEEITFGHVG
Y302_MYCGI       ---------MVAPVP-LHPDVVALAPLLGVWVGEGTGEYPTVP---SFAYTEEITFGHVG
Y6574_MYCS2      -------------MIDLHPNIAPLAPLLGTWAGPGAGEYPTIQ---SFEYLEEITFGHVG
Y4114_NOCFA      ----MSAVAEPQPSVALHPDIAALAPLLGTWRGAGHGQYPTIE---SFDYHEEISFGHLG
Y5653_RHOJR      PAHSDAAASSSANTPPLPYVPSALAPFAGLWRGEGEGAYPTID---DFAYTEEIEFAPTG
Y1365_STRAW      PEHPYPDGHRPDEAPAPHALLEPVLGLLGSWYGRGEGGYPTLTG--DFGYAQELTFSHDG
Y442_STRGG       RELPFPDALRPGARPAPHPLLAPVTGYLGTWRGTGSGGYPTLDA--DFSYAQEVTFSHDG
Y452_FRACC       SDTAT-------STVDLHASLLPLAFLVGTWRGEGVGGYEGLD---GFHYGQEITFAADG
Y6164_FRASN      SGGATGGTAGNIATVDLHPSLLPLAFLVGTWRGEGVGGYEGME---SFHYGQEITFAADG
Y2983_PAEAT      --------MPIEIPTDLTPELVPLSWLIGEWEGRGRLGSGDED---SEHFVQRVSFTHNG
Y3010_ARTS2      --------MPIEIPTDLTPELVPLSWLIGEWEGSGRLGAGEED---SEHFSQHVSFTHNG
Y970_RENSM       --------MPVEIPRDLTPELVPLSWLLGQWEGQGRLGTGEAE---SEHFFQRVTFSSNG
Y575_KOCRD       --------MPIEIPTDLTPELVPFAWLLGTWEGNGFMGYGDAE---QRAFRQRVTFEQTG
Y2499_CLAM3      ---------MIEIPTGLPAELVPLSWLLGVWEGTGVVEYAVGDDVVRREFGQRISFSHDG
Y2734_CLAMS      ---------MIEIPTGLPAELVPLSWLLGVWEGSGVVEYAVGDETVRREFGQRISFSHDG
Y1835_LEIXX      ---------MIEIPTDLPAELVPLSWLIGVWEGTGVLDYAIGDDHTEREFGQRIGFSHDG
Y882_KINRD       --------MALPLRTDTPLTLVPLSWLLGRWEGAGVLGHPARGD-SDTRFGQVVEFGHDG
Y2872_THEFY      ------------MQSEMHPELAKLSFLLGRWEGLGVAGYPDTE---EFQFTQVIEFTHDG
Y4030_STRAW      ---------MIEIPSDLHKDLVPLAFLLGNWAGAGVHDFPGSE---KCNFGQEVSFTHDG
Y4179_STRCO      ---------MIEIPSDLHKDLVPLVFLLGDWAGAGVHDFPGAE---KCNFGQEVSFTHDG
Y3970_STRGG      ---------MIEIPSDLHPDLVPLAFLLGNWAGAGVSDFPGAE---KCNFGQEVTFSHDG
Y347_CUTAK       --------MPFQIPDDLNRDLMPLAWMIGHWEGEGHGNTPDDG---EFSFGCQVDFTDNG
Y4252_NOCSJ      --------MPFELPDNLHPDCGPVAWLLGRWGGRGHGDYPTIE---GFQYGQELVFTHDG
                                        .    * * * *              :   : .   .

Y836_MYCBO       GDYLNWESRSWRLT-ATGDY---QEPGL-------------------REAGFWRFVADP-
Y865_MYCBP       GDYLNWESRSWRLT-ATGDY---QEPGL-------------------REAGFWRFVADP-
Y823_MYCTA       GDYLNWESRSWRLT-ATGDY---QEPGL-------------------REAGFWRFVADP-
Y813_MYCTU       GDYLNWESRSWRLT-ATGDY---QEPGL-------------------REAGFWRFVADP-
Y753_MYCA1       GDYLNWEARSWRLN-ETGDY---QERGL-------------------RETGFWRFVRDP-
Y643_MYCPA       GDYLNWEARSWRLN-DTGDY---QERGL-------------------RETGFWRFVRDP-
Y4871_MYCMM      GDYLNWEARSWRLD-EDGQY---EEPGL-------------------RETGFWRFVSDPE
Y429_MYCUA       GDYLNWEARSWRLD-EDGQY---EEPGL-------------------RETGFWRFVSDPE
Y4916_MYCSJ      GDYLNWEARSWRLT-ESGEY---DRVGL-------------------RETGFWRFVSDP-
Y4620_MYCSK      GDYLNWEARSWRLT-ESGEY---DRVGL-------------------RETGFWRFVSDP-
Y4533_MYCSS      GDYLNWEARSWRLT-ESGEY---DRVGL-------------------RETGFWRFVSDP-
Y5792_MYCS2      GDYLNWEARSWRLD-ESGEY---HSPAL-------------------RETGYWRFVTDP-
Y1642_MYCGI      ADYLNWEARSWRLD-DGGDY---DRRDL-------------------RETGFWRFVNDP-
Y5105_MYCVP      GDYLNWEARSWHLD-DDGEY---ARPGL-------------------RETGFWRFVSDP-
Y2200_MYCLE      GNYLNWEARSWRLN-DAGEY---QETSL-------------------RETGFWRFVSDP-
Y732_MYCA9       SDYLTWDARSWRLD-ADGQF---EQLTL-------------------RETGFWRFAPDP-
Y591_NOCFA       GDYLSWESRSWFIE-ADGSY---GGPDL-------------------RETGFWRVGVDG-
Y4852_RHOJR      GNYLKWESQTWVLD-ADGEY---VRPDL-------------------HETGFWRISGDGI
Y2482_CORGB      ENYLSFESRMWKLD-EEGNP---TGVDQ-------------------RESGFWRINLKD-
Y2579_CORGL      ENYLSFESRMWKLD-EEGNP---TGVDQ-------------------RESGFWRINLKD-
Y2471_COREF      ENYLSFESRVWRLD-SEGGT---VGPDQ-------------------RETGFWRINLQD-
Y1915_CORDI      ENYLTYESRIWKLD-DEGNS---TDLDY-------------------RESGFWRISLKD-
Y374_CORJK       ENRISYDSRTWRMD-DDGKP---TEIPD------------------RRESGFLRINDDD-
Y1611_CORU7      ENRLGFESRTWKIN-PPAEE---GAEADGDEASAESAGEPEVGELLRREAGFWRIDNDD-
Y7110_SACEN      RPFLFYESRAWRLDREGGEV---VAPDF-------------------REVGWLRPQPDD-
Y373_SALAI       RPFLCYESRAWLLD-EQSRP---IRPAG-------------------REMGWWRPVLAG-
Y310_SALTO       RPFLCYESRAWLLD-EQSRP---IRPAG-------------------REMGWWRPVLDG-
Y2717_MYCTU      KPFLTYTQQTRAVADG-------KPLHS--------------------ETGYLRVCRP--
Y2745_MYCTA      KPFLTYTQQTRAVADG-------KPLHS--------------------ETGYLRVCRP--
Y2736_MYCBO      KPFLTYTQQTRAVADG-------KPLHS--------------------ETGYLRVCRP--
Y2730_MYCBP      KPFLTYTQQTRAVADG-------KPLHS--------------------ETGYLRVCRP--
Y3611_MYCA1      KPFLAYAQKTRAAADG-------KPLHA--------------------ETGYLRVPQP--
Y2833_MYCPA      KPFLAYAQKTRAAADG-------KPLHA--------------------ETGYLRVPQP--
Y1006_MYCLE      RPFLTYTQKTRAITDG-------KPLHA--------------------ETGYLRVPQP--
Y1995_MYCMM      KPFLVYAQKTRAVADG-------APLHA--------------------ETGYLRVPKP--
Y3360_MYCUA      KPFLVYAQKTRAVADG-------TPLHA--------------------ETGYLRVPKP--
Y408_MYCSJ       KPFLTYVQRTRAADDG-------RPLHA--------------------ETGYLRAPTP--
Y421_MYCSS       KPFLTYVQRTRAADDG-------RPLHA--------------------ETGYLRAPTP--
Y449_MYCVP       KPFLTYAQRTRAADDG-------RPLHA--------------------ETGYLRASAP--
Y302_MYCGI       KPFLSYVQRTRAADDG-------RPLHS--------------------ETGYVRSPAP--
Y6574_MYCS2      KPFLTYQQRTKARDDG-------RPLHA--------------------EVGYIRVPAP--
Y4114_NOCFA      RPFLTYRQRTRAADGS-------RPMHA--------------------ETGYLRRPRP--
Y5653_RHOJR      KPFLAYRSRTREAGSG-------RPLHS--------------------ESGFLRLVGE--
Y1365_STRAW      RPFLRYEARAWLLDADD---APLRPSAR--------------------ECGWWRLQPD--
Y442_STRGG       RPFLAYEARAWLLDADG---QPLRPSAR--------------------ETGWWRLQPD--
Y452_FRACC       RPALGYVSHTWWADEPRDGREPGSPLAT--------------------ETGFWRVQP---
Y6164_FRASN      RPALGYVSHTWWADEPRDGREPGSPMAT--------------------ETGFWRVQPPAT
Y2983_PAEAT      LPYLQYRAETWLSDDAGEK---LRPLTV--------------------ETGFWALERKLE
Y3010_ARTS2      LPYLQYRAESWLTDDEGTR---LRPLTV--------------------ETGFWALERKQR
Y970_RENSM       LPYLEYVAESWLTDEEGMK---LRPLSV--------------------EMGFWALDRKLG
Y575_KOCRD       LPFVIYRAQTTLLDEEGEP---QREATY--------------------EQGFWELARPRE
Y2499_CLAM3      LPHLNYSSYAWVEGDDGP-----VPFVT--------------------ETGYWRLRRRVT
Y2734_CLAMS      LPHLNYSSYAWIEGDDGP-----VPFVT--------------------ETGYWRLRRRVT
Y1835_LEIXX      QNYLAYSSTAWLLDSDR------TPLAA--------------------ESGYWRLSRTLI
Y882_KINRD       RDFLTYTSTTWALDEDGST---TEPLDV--------------------ETGYWRPQ----
Y2872_THEFY      HPHLNYRSQVWRVNEDGSR---GEPVTS--------------------ESGYWRVR----
Y4030_STRAW      RDFLEYHSHTWVLDADGNK---VRPLET--------------------ESGFWRVDAA--
Y4179_STRCO      RDFLEYQSHTWVLDNDGNK---VRPLES--------------------EHGFWRIDAN--
Y3970_STRGG      RDFLEYVSHTWVLDDEGKQ---VRPLET--------------------ETGYWRIDKD--
Y347_CUTAK       GDYLHYICQTFTMNPDGTP---AAPLRM--------------------ETGFWRPNVDT-
Y4252_NOCSJ      RPFFHYFARAWIVDDAGEK---VREAAQ--------------------EAGFLRCKPE--
                    . :                                          * *:        

Y836_MYCBO       --------------------------YDPSESQAIELLLAHSAGYVELFYGRP-----RT
Y865_MYCBP       --------------------------YDPSESQAIELLLAHSAGYVELFYGRP-----RT
Y823_MYCTA       --------------------------YDPSESQAIELLLAHSAGYVELFYGRP-----RT
Y813_MYCTU       --------------------------YDPSESQAIELLLAHSAGYVELFYGRP-----RT
Y753_MYCA1       --------------------------DDPSESQAIELLLAHSAGYVELFYGRP-----RT
Y643_MYCPA       --------------------------DDPSESQAIELLLAHSAGYVELFYGRP-----RT
Y4871_MYCMM      --------------------------DDPSESQAIELLLAHSAGYVELFYGRP-----LT
Y429_MYCUA       --------------------------DDPSESQAIELLLAHSAGYVELFYGRP-----LT
Y4916_MYCSJ      --------------------------ADPSESQAIELLLAHSAGYIELFYGHP-----RN
Y4620_MYCSK      --------------------------ADPSESQAIELLLAHSAGYIELFYGHP-----RN
Y4533_MYCSS      --------------------------ADPSESQAIELLLAHSAGYIELFYGHP-----RN
Y5792_MYCS2      --------------------------ADPHETQAIELLLAHSSGYIELFYGRP-----LN
Y1642_MYCGI      --------------------------NDPGESQAIELLLAHSSGYIELFYGRP-----LN
Y5105_MYCVP      --------------------------GDPEESQAIELLLAHSAGYIELFYGRP-----LN
Y2200_MYCLE      --------------------------YDPTESQAIELLLAHSAGYVELFYGRP-----RN
Y732_MYCA9       --------------------------NDPDENQAIELVLAHAAGFVELFYGQP-----LN
Y591_NOCFA       ------------------------------DDEVIELLLTHSSGIVELFYGTA-----LT
Y4852_RHOJR      --------------------------PGSTNEEVVELLLAHSSGIVELFYGQA-----LT
Y2482_CORGB      ---------------------------------EIEFVCTHAGGVVEIYYGQP-----LN
Y2579_CORGL      ---------------------------------EIEFVCTHAGGVVEIYYGQP-----LN
Y2471_COREF      ---------------------------------EIEFVCAHASGVVEIYYGQP-----IN
Y1915_CORDI      ---------------------------------EIEVVLTHSTGVAEIFYGEP-----MN
Y374_CORJK       ---------------------------------EIEMILTHSDGMVEILYGSP-----LN
Y1611_CORU7      ---------------------------------NIELLIAHSDGMIELMYGKP-----LT
Y7110_SACEN      ---------------------------------TIEFLLVHSGGLSEMFFGKP-----RN
Y373_SALAI       ----------------------------DRATGEWEALMTTPTGVMELHLGK------RT
Y310_SALTO       ----------------------------DRATNEWEALMSTPTGVMELHLGK------RT
Y2717_MYCTU      --------------------------------GCVELVLAHPSGITEIEVGTY----SVT
Y2745_MYCTA      --------------------------------GCVELVLAHPSGITEIEVGTY----SVT
Y2736_MYCBO      --------------------------------GCVELVLAHPSGITEIEVGTY----SVT
Y2730_MYCBP      --------------------------------GCVELVLAHPSGITEIEVGTY----SVT
Y3611_MYCA1      --------------------------------GRLELVLAHPSGITEIEVGSY----AVT
Y2833_MYCPA      --------------------------------GRLELVLAHPSGITEIEVGSY----AVT
Y1006_MYCLE      --------------------------------GHIELVLAHHSDIAEIEVGTY----SVT
Y1995_MYCMM      --------------------------------GQVELVLAHPSGITEIEVGTY----SAS
Y3360_MYCUA      --------------------------------GQVELVLAHPSGITEIEVGTY----SAS
Y408_MYCSJ       --------------------------------NNVEWILAHPTGITEIQEGPL----TAD
Y421_MYCSS       --------------------------------NNVEWILAHPTGITEIQEGPL----TAD
Y449_MYCVP       --------------------------------DRIEWILAHPTGITEIQEGQL----TAD
Y302_MYCGI       --------------------------------HCVEWILAHPTGITEILEGILERIVTGE
Y6574_MYCS2      --------------------------------DRVEWVLAHPTGITEIQEGTL----TVG
Y4114_NOCFA      --------------------------------DHVELILAHPTGITEICEGSL----TIA
Y5653_RHOJR      --------------------------------DEAELLVAQPTGFTEIHRGQV------R
Y1365_STRAW      --------------------------------GRVEALITQPTGIAEIMVGRA------T
Y442_STRGG       --------------------------------GRVEALITQPTGIAEISVGHA------R
Y452_FRACC       -----------------------GEDGK----PVVEVMLAHPFGIAEIYVGTV------T
Y6164_FRASN      EP---------------------GPDGKVNGSPVVEVMLAHPFGIAEIYVGTV------T
Y2983_PAEAT      EGDGGPGLIPADIVPVLKTADEVEERRNKEGGFDISVSIAHPGGITELYYGQIK----GP
Y3010_ARTS2      EEDGGPGLIPADIVPVLKSADEVEALRNSDGGFDISVSISHPGGISELYYGQIK----GP
Y970_RENSM       EADGGPGLIPADIVPALTTADDVEKLRNDTSGFDITATIVHPGGISELYYGTIK----GP
Y575_KOCRD       DGDIGPGMLPPDPVPVLTSAEDVEKLRNADGGFDISVSILQPGGVAELYLGQIK----GP
Y2499_CLAM3      DGDPGPAMLPPTGERPFTTADEVETLRNADGGFDVEVALVHPGGVSELYVGQVK----SA
Y2734_CLAMS      DGDPGPAMLPPTDERPFTTAEEVETLCNADGGFDVEVALVHPGGVSELYVGQVK----SA
Y1835_LEIXX      EGDAGPGMLPGVGPRPFGTAQSVEALRASHGGFDIDVSIVHPNGVSELYIGRVN----GP
Y882_KINRD       ---------PVD----LDTPAPAEGPRP----VELEVLLAHPTGVVEVLVGTAR----GP
Y2872_THEFY      ------------------TGKAAQQEDPDQPPIHVEVLISHPEGYSEVYLGTVF----AH
Y4030_STRAW      --------------------------------RKVEAVMTRDDGVVEIWYGELA----AK
Y4179_STRCO      --------------------------------RKVEVTMTRDDGVIEIWYGELA----DQ
Y3970_STRGG      --------------------------------RKVEVVMARDQGVIEIWYGELA----DQ
Y347_CUTAK       --------------------------------RKVDVLMAAPEGWAEVWTGNID----GA
Y4252_NOCSJ      --------------------------------GRVELLLTHNTGFAEVWYGEAA----DG
                                                            .  *:  *         

Y836_MYCBO       QSSWELVTDAL----ARSRSG-VLVGGAKRLYGIVEGGD--LAYVEERVD-----ADGGL
Y865_MYCBP       QSSWELVTDAL----ARSRSG-VLVGGAKRLYGIVEGGD--LAYVEERVD-----ADGGL
Y823_MYCTA       QSSWELVTDAL----ARSRSG-VLVGGAKRLYGIVEGGD--LAYVEERVD-----ADGGL
Y813_MYCTU       QSSWELVTDAL----ARSRSG-VLVGGAKRLYGIVEGGD--LAYVEERVD-----ADGGL
Y753_MYCA1       QSSWELVTDAL----ARSRSG-VLVGGAKRLYGIVEGGD--LAYVEERVD-----ADGGL
Y643_MYCPA       QSSWELVTDAL----ARSRSG-VLVGGAKRLYGIVEGGD--LAYVEERVD-----ADGGL
Y4871_MYCMM      QSSWELVTDAL----ARSRSG-VLVGGAKRLYGIIEGGD--LAYVEERVD-----ADGGL
Y429_MYCUA       QSSWELVTDAL----ARSRSG-VLVGGAKRLYGIIEGGD--LAYVEERVD-----ADGGL
Y4916_MYCSJ      QSSWELVTDAL----ARSKSG-MLVGGAKRLYGIVEGGD--LAYVEERVD-----ADGGL
Y4620_MYCSK      QSSWELVTDAL----ARSKSG-MLVGGAKRLYGIVEGGD--LAYVEERVD-----ADGGL
Y4533_MYCSS      QSSWELVTDAL----ARSKSG-MLVGGAKRLYGIVEGGD--LAYVEERVD-----ADGGL
Y5792_MYCS2      QSSWELVTDAL----ARSKSG-TLVGGAKRLYGIVEGGD--LGYVEERVD-----ADGGL
Y1642_MYCGI      QASWELVTDAL----ARSKSG-VLVGGAKRLYGIIEGGD--LAYVEERVD-----ADGGL
Y5105_MYCVP      QSSWELVTDAL----ARSKSG-MLVGGAKRLYGIIEGGD--LAYVEERVD-----ADGGL
Y2200_MYCLE      ASSWELVTDAL----ACSKSG-VLVGGAKRLYGIVEGGD--LAYVEERVD-----ADGGL
Y732_MYCA9       ASSWELVTDAL----ARSKSG-ALIGGAKRLYGIVDGGD--LAYVEERVG-----ADGGL
Y591_NOCFA       QSSWELATDVV----IRSQSG-VVVGGAKRLYGIVEGGD--LAYVEERVV-----ADGPL
Y4852_RHOJR      QSSWELATDVV----IRSTSG-VLVGGAKRLYGIVEGGD--LAYVEERII-----ADGEL
Y2482_CORGB      ERAWQLESAST----MVTATGPSTLGPGKRLYGLLPTNE--LGWVDERL------VGDAL
Y2579_CORGL      ERAWQLESAST----MVTATGPSTLGPGKRLYGLLPTNE--LGWVDERL------VGDAL
Y2471_COREF      ERAWELESAST----MVTATGPVTLGPGKRLYGLLPTNE--LGWVDERL------VDKEL
Y1915_CORDI      ERAWQIESAST----MVTAQGPATLGPGKRLYGLMPNNN--LGWVDERM------VDGEM
Y374_CORJK       ERAWQLESAST----MATATGPTNLGPGKRLYGLMPNND--LGWVDERL------IDGEM
Y1611_CORU7      ERAWQLESAST----LATETGPSALGPGKRLYGLMPNND--LGWVDERL------IDGEM
Y7110_SACEN      QTTWEFGTDAV----VRTPSA-EDATAASRLYGVVEGA---LAYVEERAT-----SEHEL
Y373_SALAI       GTQLEFATDAV----VRTPTA-KEVTAGHRLFGIVEGA---LLYAQEMAA-----VGHGL
Y310_SALTO       GTQLEFATDAV----VRTPTA-KEVTAGHRLFGIVEGA---LLYAQEMAA-----VGHGL
Y2717_MYCTU      GDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDG-DE--LSYSLQMRAV-----GQPL
Y2745_MYCTA      GDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDG-DE--LSYSLQMRAV-----GQPL
Y2736_MYCBO      GDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDG-DE--LSYSLQMRAV-----GQPL
Y2730_MYCBP      GDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDG-DE--LSYSLQMRAV-----GQPL
Y3611_MYCA1      GGLIEMRMSTT---SIGLTPTAKEVTALGRWFRIDG-DK--LSYSVQMGAV-----GQPL
Y2833_MYCPA      GGLIEMRMSTT---SIGLTPSAKEVTALARWFRIDG-DE--LSYSVQMGAV-----GQPL
Y1006_MYCLE      GDLIEVELVTT---TIGLVPTAKQVTALGRFFRIDG-DE--FAYSVQMGAV-----GQPL
Y1995_MYCMM      GGVIEMEMVTT---AIGMTPTAKEVTALSRSFRMVG-DE--LSYRLRMGAV-----GLPL
Y3360_MYCUA      GGVIEMEMVTT---AIGMTPTAKEVTALSRSFRMVG-DE--LSYRLRMGAV-----GLPL
Y408_MYCSJ       GDTLRMDLIST---DIGRSESAKEVMAVGRSMQISG-DT--LTYTLRMAAV-----GRPL
Y421_MYCSS       GDTLRMDLIST---DIGRSESAKEVMAVGRSMQISG-DT--LTYTLRMAAV-----GRPL
Y449_MYCVP       GDGLRMELVSS---SIGRSGSAKEVTDVGRSIELRG-DT--LTYTLRMAAV-----GQPL
Y302_MYCGI       GDTLRIDVEST---AVGRSASAKEVSAVGRTIELAG-DT--LTYSVRMAAV-----GMPL
Y6574_MYCS2      GDRITMDVKAT---TIGLTASAKNVTALARSFRITG-DE--LTYTLQMGAV-----GQPL
Y4114_NOCFA      DGELRMDFDST---HIGRSSTAKLVTALGRSFRVAG-DT--IEYSLRMAAV-----GEPL
Y5653_RHOJR      EGTIELSMVVL-----SASPDAKPVHSIRRQLSVRG-GD--LTYDLWMAHD-----LTPL
Y1365_STRAW      GNTIDLSTHEV-----ALAPTAKKVNATRRRYTLTDDDT--LTFHHDLEAV-----GQPM
Y442_STRGG       DGAVDLATERV-----ALAPTAKEVDATRRRYTLTDPDT--LTFVHDLAAV-----GRPL
Y452_FRACC       GTRIDLDHNVL-----IRTATARDVTRSVRLYGLVEGCD--LAYAIDMEAE-----GKPM
Y6164_FRASN      GTRIDLDSNVL-----IRTATAREVTRSVRLYGLIEGGD--LAYAIDMEAG-----GKPL
Y2983_PAEAT      Q--IQLSTDMV----MRGS-HSKEYTAATRIFGLVDGN---LLWRWDVAA-----SGKAL
Y3010_ARTS2      Q--IQLSTDMV----MRGS-HSKEYTAATRIFGLVDGK---LLWRWDVATGAGSTQGGGL
Y970_RENSM       Q--IELSTDAV----MRGA-GAKDYSAATRIFGLVNGD---LFWRWDVAA-----EGNSL
Y575_KOCRD       R--VDLRTDAV----IRAQ-GAKEYQSGTRLYGLVNNH---LMWAWDMAA-----DGREL
Y2499_CLAM3      R--IDLATDAV----LRTE-GAKAYTGATRLYGLVERD---LLWAWDIAA-----LGQPL
Y2734_CLAMS      R--IDLATDAV----LRTE-GAKSYTGATRLYGFVERD---LLWAWDIAA-----LGQPL
Y1835_LEIXX      R--IDLATDAV----VRTA-GAKEYTAATRLYGLVENH---LLWAWDIAA-----LGQEL
Y882_KINRD       R--IDLSSDVV----ARTA-TAHEYTAGNRMYGMVEGD---LLWALDVAL-----EGHPL
Y2872_THEFY      R--VELHTDVV----VRTE-TGLPAAASHRLYGLFGDNRETLGYAWDLAAN-----SKEL
Y4030_STRAW      KPQIDLVTDAV----ARTA-AAGPYSGGKRLYGYVKSD---LMWVGEKQT-----PEVEL
Y4179_STRCO      KPQIDLVTDAV----ARTA-ASQPYTGGKRLYGYVKSD---LMWVGEKQT-----PEVEL
Y3970_STRGG      KPQIDLVTDAV----ARTA-ASGPYSGGKRLYGYVKSD---LMWVGEKAT-----PEVEL
Y347_CUTAK       K--IELVTDAV----ARTEEALVPYTGGQRLYGQVEGD---LLWTFDRAT-----VDAPL
Y4252_NOCSJ      K--LELTTDAV----VRTE-SAKEYTGGKRLYGNVEGD---LLYAYDMAA-----MGQPL
                      .                       *           : :               :

Y836_MYCBO       VPHLSARLSRFVG------------------------
Y865_MYCBP       VPHLSARLSRFVG------------------------
Y823_MYCTA       VPHLSARLSRFVG------------------------
Y813_MYCTU       VPHLSARLSRFVG------------------------
Y753_MYCA1       VPHLSARLSRFAG------------------------
Y643_MYCPA       VPHLSARLSRFAG------------------------
Y4871_MYCMM      VPHLSARLSRYAG------------------------
Y429_MYCUA       VPHLSARLSRYAG------------------------
Y4916_MYCSJ      VPHLSARLARYVG------------------------
Y4620_MYCSK      VPHLSARLARYVG------------------------
Y4533_MYCSS      VPHLSARLARYVG------------------------
Y5792_MYCS2      VPHLSARLSRYVG------------------------
Y1642_MYCGI      VPHLSARLSRFVG------------------------
Y5105_MYCVP      VPHLSARLTRFVG------------------------
Y2200_MYCLE      VPNLSARLYRFAG------------------------
Y732_MYCA9       EPHLSARLSRFAG------------------------
Y591_NOCFA       EPRLSARLQRYIG------------------------
Y4852_RHOJR      RPHLSARLSRYVG------------------------
Y2482_CORGB      KPRMSAQLTRVIG------------------------
Y2579_CORGL      KPRMSAQLTRVIG------------------------
Y2471_COREF      KPRMSAQLHRIIG------------------------
Y1915_CORDI      RPRMSAELSRVIG------------------------
Y374_CORJK       VPWQSAQLSRVVG------------------------
Y1611_CORU7      VPWMSAQLKRVRG------------------------
Y7110_SACEN      QPRLSAKLDRVVG------------------------
Y373_SALAI       TPHLSARLIRVGG------------------------
Y310_SALTO       TPHLSARLIRVGG------------------------
Y2717_MYCTU      QDHLAAVLHRQR-------------------------
Y2745_MYCTA      QDHLAAVLHRQR-------------------------
Y2736_MYCBO      QDHLAAVLHRQR-------------------------
Y2730_MYCBP      QDHLAAVLHRQR-------------------------
Y3611_MYCA1      QDHLAAVLHRQR-------------------------
Y2833_MYCPA      QDHLAAVLHRQR-------------------------
Y1006_MYCLE      QDHLVAVLHRKQ-------------------------
Y1995_MYCMM      QHHLGARLRRKS-------------------------
Y3360_MYCUA      QHHLGARLRRKS-------------------------
Y408_MYCSJ       QHHLSAVLHRVSS------------------------
Y421_MYCSS       QHHLSAVLHRVSS------------------------
Y449_MYCVP       QHHLSAVLRRVR-------------------------
Y302_MYCGI       QHHLSAVLHRA--------------------------
Y6574_MYCS2      QHHLAATLRRTPA------------------------
Y4114_NOCFA      THHLAATLRRD--------------------------
Y5653_RHOJR      THHLHGHLRRD--------------------------
Y1365_STRAW      QHHLSARLRRRG-------------------------
Y442_STRGG       QHHLSARLRREAPGQGI--------------------
Y452_FRACC       QSHLSARLHRVSD------------------------
Y6164_FRASN      QSHLSARLHRSPS------------------------
Y2983_PAEAT      EAHASAFLHKVS-------------------------
Y3010_ARTS2      EAHASAILSKIS-------------------------
Y970_RENSM       EAHASAILKKTAAPESAEQRPSE--------------
Y575_KOCRD       ATHASAELTRIEPAAPSGS------------------
Y2499_CLAM3      RTHASGRVSHVD-------------------------
Y2734_CLAMS      RTHASGRVSHVD-------------------------
Y1835_LEIXX      RTHASARLAKAE-------------------------
Y882_KINRD       RSYASARLKRVS-------------------------
Y2872_THEFY      QPYMSAQLQRVDRKS----------------------
Y4030_STRAW      RPYMSAHLKKVVTPEDVERWAKALPDDMPDDGIAFFK
Y4179_STRCO      RPYMSAHLKKVVTPEDVERWAKALPDDMPDDGIAFFK
Y3970_STRGG      RPYMSAHLKKVVTPEEVAEMARNLPD-MPDDGIAFFK
Y347_CUTAK       QPYMWARLKRS--------------------------
Y4252_NOCSJ      QPHLWARLVRQ--------------------------
                      . : :