CLUSTAL format seed alignment for MF_01299

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

OADC_BRASB       ----------MTFRARREVLRTILTGERCIHPGSVYDAISIRIAEDLGFELGMFGGSAAS
OADC_BRASO       ----------MTFRLRREALRTILTSDRCVNPGSVYDAISIRIAEDLGFPLGMFGGSAAS
OADC_BRADU       ----------MAFRSRREKLRSILSGPGCIHPGSVYDAISIRIAEDLGFPLGMFGGSVAS
OADC_RHOP2       ----------MAWRDRRGALRAILEGSACVRPASVYDAISIRIADDLRFPLGMFGGSVAS
OADC_RHOPS       ----------MAWRNRRGALRAILSGSACVRPASVYDAISIRIADDLGFPLGMFGGSVAS
OADC_RHOPA       ----------MAWRDRRGALRAILTGSACVRPASVYDAISIRIADDLGFPFGMFGGSVAS
OADC_RHOPT       ----------MAWRDRRGALRAILTGSACVRPASVYDAISIRIADDLGFPFGMFGGSVAS
OADC_RHOP5       ----------MAWRNRRGALRAILSGSHCTRPASVYDPISMRIADDLGFEVGMFGGSVAS
OADC_RHOPB       ----------MTWRSRREALRAILSGSRCARPASVFDPISMRIAEDLGFEVGMFGGSVAS
OADC_PSEAE       -------MHRASHHELRAMFRALLDSSRCYHTASVFDPMSARIAADLGFECGILGGSVAS
OADC_PSEAB       -------MHRASHHELRAMFRALLDSSRCYHTASVFDPMSARIAADLGFECGILGGSVAS
OADC_PSEA7       -------MHRASHHELRAMFRALLDSSRCYHTASVFDPMSARIAADLGFECGILGGSVAS
OADC_PSEMY       ----MPILQRASHHELRSAFRALLASERCYHTASVFDPMSARIAADLDFEVGILGGSVAS
OADC_PSE14       -------MPKASHQDLRRSFRALTSSNSCFHTASVFDPMSARIAADLGFEVGILGGSVAS
OADC_PSEU2       -------MPKASHQDLRRSFRALTSSNACFHTASVFDPMSARIAADLGFEVGILGGSVAS
OADC_PSESM       -------MPKASHQDLRRSFRALTSSNSCFHTASVFDPMSAQIAADLGFEVGILGGSVAS
OADC_PSEF5       -------MSRLSHQDLRRGFRELIASNSCYHTASVFDPMSARIAADLGFEVGILGGSVAS
OADC1_PSEPF      -------MTRLSHQDLRRNFRQLLASDTCYHTASVFDPMSARIAADLGFEVGILGGSVAS
OADC_PSEP1       -------MPKASHQDLRFAFRELLASGSCFHTASVFDPMSARIAADLGFEVGILGGSVAS
OADC_PSEPK       -------MPKASHQDLRFAFRELLASGSCFHTASVFDPMSARIAADLGFEVGILGGSVAS
OADC_PSEPG       -------MPKASHQDLRFAFRELLASGSCFHTASVFDPMSARIAADLGFEVGILGGSVAS
OADC1_PSEPW      -------MPKASHQDLRFAFRELLASGSCYHTASVFDPMSARIAADLGFEVGILGGSVAS
OADC_PSEE4       -------MPKASHHDLRFAFRELLASGSCYHTASVFDPMSARIAADLGFEVGILGGSVAS
OADC_PSEU5       -------MPRLSHHDLRRNFRELLNADRCFHTASVFDPMSARIAADLGFEVGILGGSVAS
OADC_CHRSD       -------MATPSQHDLRNDFRALLASSECYFTASVFDPMSARIAADLGFEVGILGGSVAS
OADC_MARMS       -------MATPSQHDLRNDFRALLASGKCYYTASTFDPMSARIAADLGFEVGILGGSVAS
OADC2_PSEPF      -------MIERSHHDLRKVFGELLQGDTCKFAASVFDPISVRMAYDLGFDVAIQGGSVAS
OADC2_PSEPW      -------MIERSHHELRKAFGDLLQGHVCKFAASVFDPISVRMASDLGFEVGIQGGSVAS
OADC_PARXL       MLNEHGRRLLLGPTTQRRRLRQILDREDCVTMATIFDPVSARLAEQLGYEAGLMGGSLAS
                                 *  :  :     *   .: :*.:* ::* :* :  .: *** **

OADC_BRASB       LAVLGDPDIALITLTELADQMRRMSRAATLPVLVDADHGYGNAMNVRRTVQELEAAGAAG
OADC_BRASO       LAILGDPDIALITLTELAEQMRRMSRAAVLPVLVDADHGYGNAMNVRRTVQELEAAGAAG
OADC_BRADU       LAVLGDPDITLITLTELAEQMRRMSRASALPVLVDADHGYGNALNVRRTVQELETAGAAG
OADC_RHOP2       LAILGDPDSALITLTELAEQMRRMARAAALPVLVDADHGYGNALNVRRTVQELEAAGCAG
OADC_RHOPS       LAILGDPDIALITLTELAEQMRRMARAAALPVLVDADHGYGNALNVRRTVQELEAAGAAG
OADC_RHOPA       LAILGDPDIALITLTELAEQVRRMSRAAALPVVVDADHGYGNALNVRRTVEELEAAGAAG
OADC_RHOPT       LAILGDPDIALITLTELAEQVRRMSRAAALPVVVDADHGYGNALNVRRTVEELEAAGAAG
OADC_RHOP5       LAILGDPDIALITLTELAEQVRRMSRAAALPVLVDADHGYGNALNVRRTVQELEAAGAAG
OADC_RHOPB       LAILGDPDIALITLTELAEQVRRMSRAAALPILVDADHGYGNALNVRRTVQELEGAGAAG
OADC_PSEAE       LQVLAAPDFALITLSEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAA
OADC_PSEAB       LQVLAAPDFALITLSEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAA
OADC_PSEA7       LQVLAAPDFALITLSEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAA
OADC_PSEMY       LQVLGAPDFALITLSEFVEQAARIGRVARLPVIADADHGYGNALNVMRTVVELERAGVAA
OADC_PSE14       LQVLAAPDFALITLSEFVEQATRIGRVAQLPVIADADHGYGNALNVMRTVVELERAGISA
OADC_PSEU2       LQVLAAPDFALITLSEFVEQATRIGRVAQLPVIADADHGYGNALNVMRTVVELERAGISA
OADC_PSESM       LQVLAAPDFALITLSEFVEQATRIGRVAQLPVIADADHGYGNALNVMRTVVELERAGISA
OADC_PSEF5       LQVLAAPDFALITLSEFAEQATRIGRVAQLPVIADADHGYGNALNVMRTVVELERAGIAA
OADC1_PSEPF      LQVLGAPDFALITLSEFAEQATRIGRVAQLPVIADADHGYGNALNVMRTIVELERAGVAA
OADC_PSEP1       LQVLAAPDFALITLSEFVEQATRIGRVAQLPVLADADHGYGNALNVMRTVIELERAGVAA
OADC_PSEPK       LQVLAAPDFALITLSEFVEQATRIGRVAQLPVLADADHGYGNALNVMRTVIELERAGVAA
OADC_PSEPG       LQVLAAPDFALITLSEFVEQATRIGRVAQLPVLADADHGYGNALNVMRTVIELERAGVAA
OADC1_PSEPW      LQVLAAPDFALITLSEFVEQATRIGRVAQLPVLADADHGYGNALNVMRTVIELERAGVAA
OADC_PSEE4       LQVLAAPDFALITLSEFVEQATRIGRVAQLPVLADADHGYGNALNVMRTVIELERAGVAG
OADC_PSEU5       LQVLAAPDFNLITLSEFVEQATRICRVAQLPVLADADHGYGNALNVMRTVSELERAGISA
OADC_CHRSD       LQVLAAPDFALITLSEFVEQATRIGRVTRLPVIADADHGYGNALNVMRTITELERAGVAA
OADC_MARMS       LQVLAAPDFALITLSEFTEQATRIGRVARLPIIADADHGYGNALNVMRTIVELERAGVAA
OADC2_PSEPF      LQVLGAPDIALLTLDEYVEQVSRVGRASQIPIIGDADHGFGNALNVMRTVTELQKAGVAA
OADC2_PSEPW      LQVLGAPDIALLTLDEYVEQVTRVGRASQIPVIADADHGFGNALNVMRTVSELQKAGVAA
OADC_PARXL       YAVLGAPDLIVLTLTELAEQVHRCTRVSDVPLVVDGDHGYGNALSVMRTVHELDRAGAAA
                   :*. **  ::** * .:*  *  *.: :*:: *.***:***:.* **: **: ** :.

OADC_BRASB       LTIEDTLLPQAFGAA-KPQLISLAEGIGKVKAALEGRGDPALVILGRTGAVSVTSLDDAI
OADC_BRASO       LTIEDTSLPQAYGAA-KPQLISLDEGVGKVKAALDGRGDSSLVILGRTGAVSITSLDDAI
OADC_BRADU       LTIEDTLLPAAFGEA-KTQLISLEEGVGKMKAALSGRSDPTLVIMGRTGAAAITSLDDTI
OADC_RHOP2       LTIEDTLLPQAYGEA-KPQLISSEEGLGKINAALDARLDPSLVIIGRTGACSISSLDDAI
OADC_RHOPS       LTIEDTLLPQAYGEA-SPQLISREEGLGKIKAALDARLDPSLVIVGRTGACAITSLDDAI
OADC_RHOPA       LTIEDTLLPQAYGEA-KPQLVSREEGLGKIKAALDARRDPNLVIIGRTGACSITSLDDAI
OADC_RHOPT       LTIEDTLLPQAYGEA-KPQLVSREEGLGKITAALDARRDPNLVIIGRTGACSITSLDDAI
OADC_RHOP5       LTIEDTLLPQAFGET-QPQLISLAEGQGKINAALDARGDPSLVIIGRTGALAITSLDDAI
OADC_RHOPB       LTIEDTALPQPFGEA-TPQLIAIEEGFGKIKAALDARGDPTLVIVGRTGALAITSLEDAI
OADC_PSEAE       LTIEDTLLPAQFGRK-STDLICVEEGVGKIRAALEARVDPALTIIARTNAELID-VDAVI
OADC_PSEAB       LTIEDTLLPAQFGRK-STDLICVEEGVGKIRAALEARVDPALTIIARTNAELID-VDAVI
OADC_PSEA7       LTIEDTLLPAQFGRK-STDLICVEEGVGKIRAALEARVDPALTIIARTNAELID-VDAVI
OADC_PSEMY       LTIEDTLLPAQFGRK-STDLISIEEGVGKILAALEARVDPELSIIARTHAGVLE-VDEVI
OADC_PSE14       LTIEDTLLPAQFGRK-STDLISTAEGVGKIRAALEARVDPEMSIFARTNAAIIP-VQEAI
OADC_PSEU2       LTIEDTLLPAQFGRK-STDLISTAEGVGKIRAALEARVDPEMSIFARTNAAIIP-VQEAI
OADC_PSESM       LTIEDTLLPAQFGRK-STDLISTAEGVGKIRAALEARVDPEMSIFARTNAAIIP-VQEAI
OADC_PSEF5       LTIEDTLLPAQFGRK-STDLISVAEGVGKIRAALEARVDPELAIIARTNAGILP-VQEII
OADC1_PSEPF      LTIEDTLLPAQFGRK-STDLITVAEGVGKIRAALEARVDSEMAIIARTNAGILP-NQEII
OADC_PSEP1       LTIEDTLLPAQFGRK-STDLIPVEEGVGKIRAALEARVDSSLSIIARTNAGVLS-TEEII
OADC_PSEPK       LTIEDTLLPAQFGRK-STDLIPVEEGVGKIRAALEARVDSSLSIIARTNAGVLS-TEEII
OADC_PSEPG       LTIEDTLLPAQFGRK-STDLIPVEEGVGKIRAALEARVDSSLSIIARTNAGVLS-TEEII
OADC1_PSEPW      LTIEDTLLPAQFGRK-STDLIPVEEGVGKIRAALEARVDSSLSIIARTNAGVLS-TEEII
OADC_PSEE4       LTIEDTLLPAQFGRK-STDLISVEEGVGKIRAALEARVDSALAIIARTNAGVLT-TEEII
OADC_PSEU5       LTIEDTLLPPKFGRR-STDLIGMFEAVGKIRAALEARVDPEMAIIGRTNAGVIG-FEEVI
OADC_CHRSD       LTIEDTLLPAQYGHK-STDLIPLDEGVGKMRAALEARIDPAMAIIARTNAGQLD-DEAAV
OADC_MARMS       LTIEDTLLPAKYGHK-STDLIPVEEAVGKLKAALEARIDPIMSIIARTNAGQLS-TEETI
OADC2_PSEPF      LTLEDTHLPAKYDEQ-SHVLIEREEAAAKIYAARFARSDDALSIIARTNVAVTT-LDDSI
OADC2_PSEPW      LTLEDTHLPARYEEQ-SPVLIGEEEAAAKIYAARFSRSDDSLSIIARTNVAATT-LEDSI
OADC_PARXL       VTIEDTLLPRPYGSSGKPALVSFDEAVARVEAAVAARGDSDLLVLGRTSAATLNGIEDAV
                 :*:*** **  :       *:   *. .:: **  .* *  : :..** .      :  :

OADC_BRASB       ARARAYEACGVDGLFFTGITARDQLDAIAAATTLPIVLGGA-PEHMSDLGYLAARRVRVA
OADC_BRASO       ARARVYETCGVDGLFFTGITTRDQLDAIAAATNLPIVLGGA-PEEMSDLGYLASRRVRIA
OADC_BRADU       RRAQAYEATGVDALFFTGIKSRAELEAVAAATHLPIVLGGA-PEELNAPDYLAGQRVRIA
OADC_RHOP2       ERAVAYEAAGVDALFFTGVKARDQLQAISAATRLPIVLGSP-PAELADWEYLAAQRVRIA
OADC_RHOPS       DRAVAYQAAGVDALFFTGVKTRPQLDAIAAATTLPIVLGSP-PAELTDWDYLAAQRVRIA
OADC_RHOPA       ERALAYQAAGVDALFFTGVKTRAQLEAISAATTLPIALGSP-PAELGDFDHLAERRVRIA
OADC_RHOPT       ERALAYQAAGVDALFFTGVKTRAQLEAISAATTLPIALGSP-PAELGDFDHLAERRVRIA
OADC_RHOP5       ERAQAYQAAGVDALFFTGVKTRPQLDAIAAATTLPIVLGGP-SEAITDWDYLAERRVRIA
OADC_RHOPB       ERAQAYEAAGVDALFFTAVKTRAQLEAIAAATTLPIVLGGP-SEEISDWDYLAAQRVRIA
OADC_PSEAE       QRTLAYQEAGADGICLVGVRDFAHLEAIAEHLHIPLMLVTYGNPQLRDDARLARLGVRVV
OADC_PSEAB       QRTLAYQEAGADGICLVGVRDFAHLEAIAEHLHIPLMLVTYGNPQLRDDARLARLGVRVV
OADC_PSEA7       QRTLAYQEAGADGICLVGVRDFAHLEAIAEHLHIPLMLVTYGNPQLRDDARLARLGVRIV
OADC_PSEMY       RRTRAYEAAGADGICLVGVKDFAHLEQIAAGLKVPLMLVTYGNPELRDNQRLARLGVRIV
OADC_PSE14       SRVQQYQAAGADGITIVGIRDFDHLAQISEGVTVPLMLVTYGNPELHDNARLAEMGVRVC
OADC_PSEU2       SRVQQYQAAGADGITIVGIRDFDHLAQISEGVTVPLMLVTYGNPELHDNARLAEMGVRVC
OADC_PSESM       SRVQQYQAAGADGITIVGIRDFDHLAQVSEGITVPLMLVTYGNPELHDNARLAEMGVRVC
OADC_PSEF5       SRTQQYERAGADAICMVGIRDFEQLEQISEHLSVPLMLVTYGNPALRDDARLAELGVKIA
OADC1_PSEPF      SRTKQYQAAGADGICMVGIQDFDQLEQIAEHLTVPLMLVTYGNPALRDDKRLAELGVRVT
OADC_PSEP1       VRTQSYQKAGADGICMVGVKDFEQLEQIAEHLTVPLMLVTYGNPNLRDDERLARLGVRIV
OADC_PSEPK       VRTQSYQKAGADGICMVGVKDFEQLEQIAEHLTVPLMLVTYGNPNLRDDERLARLGVRIV
OADC_PSEPG       VRTQSYQKAGADAICMVGVKDFEQLEQIAEHLTVPLMLVTYGNPNLRDDERLARLGVRIV
OADC1_PSEPW      VRTQSYQKAGADAICMVGVKDFEQLEQIAGHLSVPLMLVTYANPNLHDDERLARLGVRIV
OADC_PSEE4       VRTQSYQKAGADGICMVGVKDFDQLEQIAEHLSVPLMLVTYANPNLRDDERLARLGVRVV
OADC_PSEU5       ARAQAYEKAGADAICLVGIEDFDHLESIASQLSKPLMLVTYGNPNLRDNARLAALGVRIV
OADC_CHRSD       ERVCAYQAAGVDAICLVGVRDFDHLERLAAPLDIPLMLVTYGNPELRDRARLAALGVRVV
OADC_MARMS       SRVKAYQAVGVDGICMVGIRDFAHLEEISQHISIPIMLVAYDNPELRDRERLAANGVRIV
OADC2_PSEPF      ARTAAYQKAGADAICLVGVKDFQHLEALTAHLRVPIMLINYGNPALSNVEKLSAANVRIV
OADC2_PSEPW      ARTAAYEKAGADAICLVGVKDFHHLAALTEHLTTPIMLINYGNPALCDVEKLSAANVRIV
OADC_PARXL       ARFKAFEAAGVDAIFLPGPQQREQIDAISDAVKVPLLMAGA-PEALCDPAYLATRRVKAW
                  *   ::  *.*.: : .     .:  ::     *: :       :     *:   *:  

OADC_BRASB       LQGHAPIAAATQAVYETLKALRGGAAPKQLKGLPSAELTAQVMREAEVKRRLRVYLEPGS
OADC_BRASO       LQGHAPIAAATQAVYDTLKALRDGVSPKQLKGLPSAELTSRVMREADVKKRLRDFLGLGS
OADC_BRADU       LQGHAPIAAATQAVHDTLKALREGAPPKALKGLASAELTSRVMREAETKARGADVLGFKK
OADC_RHOP2       VQGHAPIAAATEAVFRTLSALRDGAAPQQLTGLATPELMDRVTRASLVDERGARFLGLAR
OADC_RHOPS       VQGHAPIAAATEAVSKALSALRDGAAPKQLTGLASAELIDRVTRASLVEERGAQFLGLKR
OADC_RHOPA       VQGHAPIAAATEAVFKTLSAIKDGAAPKALTGLASAELMDKVTRADVVAERGEHFLGVKR
OADC_RHOPT       VQGHAPIAAATEAVFKTLSAIKDGAAPKALTGLASAELMDKVTRADVVAERGEHFLGVKR
OADC_RHOP5       VQGHAPIAAATRAVFETLQAVRNGAAPKQLSGLAAAELMQRVTRGDVVDERCDHFLGLKR
OADC_RHOPB       VQGHAPIAAATQAVFDTLKAAAAGTPPMQLQGLASSELMDWVTRAALVKQRGANFLGLKK
OADC_PSEAE       VNGHAAYFAAIKATYDCLREERG----AVASDLTASELSKKYTFPEEYQAWARDYMEVKE
OADC_PSEAB       VNGHAAYFAAIKATYDCLREERG----AVASDLTASELSKKYTFPEEYQAWARDYMEVKE
OADC_PSEA7       VNGHAAYFAAIKATYDCLREERG----AVASDLTASELSKKYTFPEEYQAWARDYMEVKE
OADC_PSEMY       VNGHAAYFAAIKATYDCLREQRG----AQPCDLNATELTHKYTMPEDYILWAKEFMEVRE
OADC_PSE14       VHGHAAYFAAIKATYDCLREQRQIL--GSESNMSATELTHTYTQPEDYVEWARKFMNVNE
OADC_PSEU2       VHGHAAYFAAIKATYDCLREQRQIL--GNESNMSATELTHTYTQPEDYVEWARKFMNVNE
OADC_PSESM       VHGHAAYFAAIKATYDCLREQRQIL--GSESNMSATELTHTYTQPEDYVEWAKKFMNVNE
OADC_PSEF5       VDGHAAYFAAIKATYDCLREQRQIF--TQASDLSATELAHTYTQPEEYIVWAKEFMSVKE
OADC1_PSEPF      IDGHGAYFAAIKATYDSLREQRQIF--TQASDLSATELTHTYTQPEEYILWAKEYMSVKE
OADC_PSEP1       VDGHAAYFAAIKATYDCLRLQRGRQ--NKSENLSATELSHTYTQPEDYIRWAKEYMSVEE
OADC_PSEPK       VDGHAAYFAAIKATYDCLRLQRGRQ--NKSENLSATELSHTYTQPEDYIRWAKEYMSVEE
OADC_PSEPG       VDGHAAYFAAIKATYDCLRLQRGQQ--NKSENLSATELSHTYTQPEDYIRWAKEYMSVEE
OADC1_PSEPW      VDGHAAYFAAIKATYDCLRLQRGQQ--NKSENLTATELSHTYTQPEDYIRWAKEYMSVDE
OADC_PSEE4       VDGHAAYFAAIKATYDCLRLQRGLQ--HKSDSLNATELSHTYTQPEDYIRWAKEYMSVEE
OADC_PSEU5       VNGHAAYFAAIKATYDCLREQRQ----VDALDLNASQLSVKYSTADEYVVWAEEYMQVKE
OADC_CHRSD       VNGHAAYFAAIKATYDCLREQRD----IAASELNASQLATRYSTLDEYREWARDYMDVKE
OADC_MARMS       VNGHAAYFAAIKATYDCLREQRG----IAEGTLDASELSTRYSTLEENRVWANKYMDVQE
OADC2_PSEPF      VNGHAPYLSAIKATYEALREQSG----TEGSELSLPELLSKYTLSDSYREWAKTFLKSEH
OADC2_PSEPW      VNGHAPYFSAIKSIYQALREQSG----SQGPELSLPELISKYTRVESYREWTKTYLKVGH
OADC_PARXL       SAGHQTFSVALKALHDSMQLVRSGTLSLHLPGQASKQLLEQATGVPEYDEWTRQYLAGGA
                   ** .   * .:    :                  :*                 :    

OADC_BRASB       ---------------
OADC_BRASO       ---------------
OADC_BRADU       ---------------
OADC_RHOP2       E--------------
OADC_RHOPS       E--------------
OADC_RHOPA       ---------------
OADC_RHOPT       ---------------
OADC_RHOP5       S--------------
OADC_RHOPB       ---------------
OADC_PSEAE       ---------------
OADC_PSEAB       ---------------
OADC_PSEA7       ---------------
OADC_PSEMY       ---------------
OADC_PSE14       ---------------
OADC_PSEU2       ---------------
OADC_PSESM       ---------------
OADC_PSEF5       ---------------
OADC1_PSEPF      ---------------
OADC_PSEP1       ---------------
OADC_PSEPK       ---------------
OADC_PSEPG       ---------------
OADC1_PSEPW      ---------------
OADC_PSEE4       ---------------
OADC_PSEU5       ---------------
OADC_CHRSD       ---------------
OADC_MARMS       ---------------
OADC2_PSEPF      DSN------------
OADC2_PSEPW      DSPCGVTPRGPQLCN
OADC_PARXL       ---------------