CLUSTAL format seed alignment for MF_01300

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DCTA_DEIRA       -------------------MPKIFRSLYVQVIIAIVLGILVGALFPKFGEA--LKPLGDI
DCTA3_RALSO      ------------------MIRKTLGKLYVQVLIGVAAGIVQGVAAPNLGSD--LKPLGDV
DCTA_RHIME       --------MIIEHSAEVRGKTPLYRHLYVQVLAAIAAGILLGHFYPDIGTE--LKPLGDA
DCTA_SINFN       MHQVEEIILIVENLAEVRGKTPHYRHLYVQVLAAIAVGILLGYFYPDVGSK--MKPLGDA
DCTA_RHILE       -----MIAAPLDAVAGSKGKKPFYSHLYVQVLVAIAAGILLGHFYPELGTQ--LKPLGDA
DCTA_AGRFC       -------MIDSTAVAAGHAKQPFYKHLYFQVLVAIIAGIALGHFYPTFGEQ--LKPLGDG
DCTA1_RHILO      ------MLTPLAPSVKRAPRKTLFAKPYVQVLVAILLGVAVGHFYPQIGEN--LKPLGDA
DCTA2_RHILO      ------MHIADQSGAAAAQRKPLYAQLYVQVLVAITVGILLGHYYPSIGES--MKPLGDA
DCTA_RHIGA       --------MIANQAAETPRKVPFYRHLYVQVLTAIVAGIMVGNFYPDLGAS--LKPLGDA
DCTA_XYLFA       ----MHLSSRANAPAPHKPYNPFYLQLYFWVIIAIILGALLGHCYPVVGQQ--LKPLGDA
DCTA_CAUVC       -----------------------MKSIYVQVLIAIVLGVLVGAIWPQIGVA--LKPLGDG
DCTA1_BRADU      -------MTTMATAAPVRASQAWYKILYVQVLIAILIGAMVGCLWPSVATNDWVKALGDG
DCTA1_RALSO      ------------------MKKPFYKILYVQVLAAIVIGVLLGHFEPKLAVN--MKPLGDG
DCTA_ECOLI       ------------------MKTSLFKSLYFQVLTAIAIGILLGHFYPEIGEQ--MKPLGDG
DCTA_ECO57       ------------------MKTSLFKSLYFQVLTAIAIGILLGHFYPEIGEQ--MKPLGDG
DCTA_SALTI       ------------------MKTSLFKSLYFQVLTAIAIGILLGHYYPELGAQ--MKPLGDA
DCTA_SALTY       ------------------MKTSLFKSLYFQVLTAIAIGILLGHYYPELGAQ--MKPLGDA
DCTA_YERPE       ------------------MKVSIFKTLYFQVLTAITIGVLLGHFYPEIGAQ--MKPLGDG
DCTA2_PSEAE      -----------------MTKQPFYKSLYVQVLVAIAIGIALGHWYPETAVA--MKPFGDG
DCTA_BACSU       --------------------MKLFKNLTVQVITAVIIGVIVGLVWPDVGKE--MKPLGDT
DCTA1_PSEAE      ------------METPAMFIKRCSRSIFLQVVIGLVIGVICGVGIPDLAVQ--MKPLGDG
DCTA2_RALSO      -------------------MQRFTRPLFGQVLIALALGIALGIWAPDFAQH--LKPLGDG
                                               *: .:  *   *   *  .    :*.:** 

DCTA_DEIRA       FVKLIKMVIAPIIFATVVSGVAHMRDTRKVGRVGGKALIYFEVVSTLALIIGMVVMNVLR
DCTA3_RALSO      FIKLIKMVFAPIIFATVTLGIARMENMKELGRVGVRALVYFEVLSTFALALGLIVVNLVQ
DCTA_RHIME       FIRLVKMIIAPVIFLTVATGIAGMTDLAKVGRVAGKAMIYFLAFSTLALVVGLVVANVVQ
DCTA_SINFN       FIMLVKMIIAPVIFLTVATGIAGMTDLAKVGRVAGKAMIYFLTFSTLALLVGLVVANVVQ
DCTA_RHILE       FIKLVKMIIAPVIFLTVATGIAGMSDLQKVGRVAGKAMLYFLTFSTLALIIGLIVANVVQ
DCTA_AGRFC       FIRLVKMIIAPVIFLTVATGIAGMNDMKKVGRVAGKAMIYFLVFSTLALIVGLIVANTVQ
DCTA1_RHILO      FIKLVKMIIAPVIFLTVSTGIAGMSDLQKVGRVAGKAMVYFVTFSTLALIVGLIVGNVIQ
DCTA2_RHILO      FIKLVKMIIAPVIFLTVATGIAGMSDLQKVGRVAGKAMLYFLTFSTLALIIGLVVANVVQ
DCTA_RHIGA       FIKLVSMIIAPVIFLTVTTGIAGMADLKKVGRVAGKAILYFTVFSTLALAVGLLVANILR
DCTA_XYLFA       FIKLVKMIISPVIFLTIVTGIASVAHVGTVARVFGKAMVYFLFFSTLALLLGLVVAHVVH
DCTA_CAUVC       FIKLIKLVIAPVIFCTVAGGIARMGDMKAFGRVGVKALIYFEVVSTLALVIGLVVGRLIQ
DCTA1_BRADU      FIKLIKMVIAPIIFCTVTSGIAHIQDAKKVGCVGVKALFYFEIVSSFALLLGLAMGNLVR
DCTA1_RALSO      FIQLIKMVIGPIIFCTVVSGIAGMRDMKKVGRVGGKALLYFEVVSTFALVIGLVAGHIFN
DCTA_ECOLI       FVKLIKMIIAPVIFCTVVTGIAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQ
DCTA_ECO57       FVKLIKMIIAPVIFCTVVTGIAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQ
DCTA_SALTI       FVKLIKMIIAPVIFCTVVTGIAGMESMKAVGRTGAVALLYFEIVSTIALINGLIIVNVVQ
DCTA_SALTY       FVKLIKMIIAPVIFCTVVTGIAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQ
DCTA_YERPE       FVKLIKMIIAPVIFCTVVTGIAGMESMKAVGRTGAIALLYFEIVSTLALLIGLVVVNVAQ
DCTA2_PSEAE      FVKLIKMAIAPIIFCTVVTGIAGMQSMKSVGKTGGMALLYFEVVSTVALIIGLVVVNVVQ
DCTA_BACSU       FINAVKMVIAPIIFFTIVLGIAKMGDMKKVGKVGGKAFIYFEVVTTLALIIGLFVVNIMK
DCTA1_PSEAE      FIKLIKMLIALIVFCVVVNGISGAGDLKKVGRIGLKSVIYFEILTTIALVLGLVVAYSLG
DCTA2_RALSO      FLKLIKMLIAPIVFSVVVVGICGAGELKKVGRVGGKAVIYFEVVTTIALALGIALAYAFG
                 *:  :.: :. ::* .:  *:.       ..     :..**  .::.**  *:       

DCTA_DEIRA       PGAGMNVDPATLDTAGLTKYTEAAGE-M--TVWDHILKIIPDTLVSAFTGGELLPVLLVA
DCTA3_RALSO      PGQGMNVDAAHLDTKAIASYTHAAARPQ--TFVDFLLSLVPSSIIDALARNDILQILVFA
DCTA_RHIME       PGAGMHIDPASLDAKAVATYAEKA-HEQ--SITGFLMNIIPTTLVGAFAEGDILQVLFIS
DCTA_SINFN       PGAGMHIDPASLDAKAIATYAEKA-HEQ--SVTGFLMNIIPTTLVGAFAEGDILQVLFIS
DCTA_RHILE       PGAGMNIDPASLDPAAVATFAAKA-HEQ--SIVGFLTNIIPTTIVGAFADGDILQVLFFS
DCTA_AGRFC       PGAGMNIDPATLDAKAVATYADKA-HEQ--TITGFLMNIIPTTIVGAFASGDILQVLFFS
DCTA1_RHILO      PGAGLNIDLTSLDVQAVNGYASKA-HEQ--SVTGFLMNMIPTTIVGAFVEGDILQVLFFS
DCTA2_RHILO      PGAGFNIDPATLDASTVNTYAAKA-HDQ--SVTGFLMNIIPGTIVGAFADGDILQVLFFS
DCTA_RHIGA       PGAGMHINPATLDPKAVAAYATNA-HGT--TAVSFLMKIIPNTIVGAFADGNILQVLFIS
DCTA_XYLFA       PGVGMNINPADLHQGEIASYVEKS-HDL--TLVGFLMDIIPKTLLSPFVGDNILQVLFVA
DCTA_CAUVC       PGAGFNIDPATLDASIAAGYVEKAQHGE--GMVAYLLHLIPDTFIGAFADGNLLQVLVIA
DCTA1_BRADU      IGHGLAVKP---DAAAVANYVKQA-EAS--KTVDFILNIIPDSVVGAFARGDVLQVLLFA
DCTA1_RALSO      PGSGFNVDVNSIDAKAVAQYAAKA-QSS--STVDFLLNIIPSTVVDAFAKGDILQILLIA
DCTA_ECOLI       PGAGMNVDPATLDAKAVAVYADQA-KDQ--GIVAFIMDVIPASVIGAFASGNILQVLLFA
DCTA_ECO57       PGAGMNVDPATLDAKAVAVYADQA-KDQ--GIVAFIMDVIPASVIGAFASGNILQVLLFA
DCTA_SALTI       PGAGMNVDPATLDAQAVAVYAAQA-KEQ--GIIAFLMDVIPGSVIGAFASGNILQVLLFA
DCTA_SALTY       PGAGMNVDPATLDAQAVAVYAAQA-KEQ--GIIAFLMDVIPGSVIGAFASGNILQVLLFA
DCTA_YERPE       PGVGMNIDPATLDAKAVALYAEQA-SQQ--GIIPFLLDIIPGSVVGAFASGNILQVLLFA
DCTA2_PSEAE      PGAGMHVDPNTLDTSKIAAYAAAG-EKQ--STVDFLMNVIPGTVVGAFANGDILQVLFFS
DCTA_BACSU       PGAGLDYSK--LEKGDVSQYTQNGGQGI--DWIEFITHIVPSNMVDAFAKGDILQVLFFS
DCTA1_PSEAE      LGSGANIHLNELPAGDVALYTGRTQEIH--GPVAFLMGLIPTSVFSAFAENDILQVLLFS
DCTA2_RALSO      PGHGMNVDPKTLDASAMSSYMATAKQVESSGVAEFLLKLIPDTFVSGFMKGDILQVLLVS
                  * *               :              .:  ::* .... :  .::* :*..:

DCTA_DEIRA       LLFGFALMRLGKLGDQILYGIDALNQVVFVILGFIMRLAPIGAFGAMAFTVGKYGLKSLT
DCTA3_RALSO      TLFGIALSRMGTRARPVVDFLDVFTQGVFSIVGMIMRLAPIAAFGAMAFTVGKYGLGSIA
DCTA_RHIME       VLFGISLAIVGKKAEPVVDFLQALTLPIFRLVAILMKAAPIGAFGAMAFTIGKYGIASIA
DCTA_SINFN       VLFGISLAIVGKKAEAVVDFLHALTLPIFRLVAILMKAAPIGAFGAMAFTIGKYGVASIA
DCTA_RHILE       VLFGIALAMVGEKGEQVVNFLNSLTAPVFKLVAILMKAAPIGAFGAMAFTIGKYGVGSIA
DCTA_AGRFC       VLFGIALGIVGEKGKPVTDFMHAMMYPIFKLVAILMKAAPIGAFGAMAFTIGKYGISSVT
DCTA1_RHILO      VLFGIALAMVGESGKSVLSFLQDLTAPVFKLVGILMKAAPIGAFGAMAFTIGKYGIGSVA
DCTA2_RHILO      VLFGIALALVGDKGAPVLNFLQALMAPMFKLVSVLMKAAPIGAFGAMAFTIGKYGIGSVI
DCTA_RHIGA       ILFGISIAMVGDRGQPVVRFLDALTEPMFKLTAVLMKAAPIGAFGAMAFTNGKYGIASLI
DCTA_XYLFA       VLFGIALALAGERGKPVLNLLDALTLPVFKLVQMLMKMAPIGAFGAIAFTIGKYGVDSLV
DCTA_CAUVC       ILTGFACVRMGDFGEKVAHVLDETSKLFFGIIHIVVRLAPIGAFGAMGFTIGKYGVEALV
DCTA1_BRADU      ILFGFSLMALGKRGERLRGMIDDVAHAVFGVIAIVMKAAPIGAFGAMAFTVGKFGPAALG
DCTA1_RALSO      LLFGGALSAMGERAQMVTDFIDQIAHVFFRIVHVITRVAPIGAFGAMAFTIGKYGVVSLV
DCTA_ECOLI       VLFGFALHRLGSKGQLIFNVIESFSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLV
DCTA_ECO57       VLFGFALHRLGSKGQLIFNVIESFSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLV
DCTA_SALTI       VLFGFALHRLGSKGQLIFNVIESFSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLV
DCTA_SALTY       VLFGFALHRLGSKGQLIFNVIESFSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLV
DCTA_YERPE       VLFGFALHRLGEKGQLIFNVIESFSRVIFGVINMIMRLAPLGAFGAMAFTIGKYGVGSLV
DCTA2_PSEAE      VLFGYALHRLGSYGKPVFEFIERVSHVMFNIINVIMKVAPIGAFGAMAFTIGAYGVGSLV
DCTA_BACSU       ILFGVGLAALGEKGKSVIDFFDKVSHVFFKIIGYIMRAAPIGAFGAMAYTIGHFGLDSIK
DCTA1_PSEAE      VLFGSALNLVGEQASGVARLINEFSHIVFRIMGMIVRLAPLGVFGAVAFTTARYGVDSLS
DCTA2_RALSO      ILFGCALSLLGERTKPLVGLIDQLSHVLFRMMAVVIRLAPLGVLGAVAFTVGKYGAGSLK
                  * * .    *     :   :.     .* :   : : **:..:**:.:* . :*  :: 

DCTA_DEIRA       SLGYLMGSFYLTCLLFIFVVLGLIARAAGFSIFKLIRYIREELLIVLGTSSSESALPRLM
DCTA3_RALSO      ALGKLMATMYLTCVLFVAIVLGGVARLAGFSLWKFLRYIRDEIFTVLGTSSSESVVPQLM
DCTA_RHIME       NLAMLIGTFYLTSFLFVFIVLGAVARYNGFSILSLIRYIKEELLLVLGTSSSEAALPGLM
DCTA_SINFN       NLAMLIGTFYLTSFLFVFMVLGAVARYNGFSIVALIRYIKEELLLVLGTSSSEAALPGLM
DCTA_RHILE       NLAMLIGTFYITSLLFVFIVLGAVARYNGFSIVALLRYIKEELLLVLGTSSSEAALPGLM
DCTA_AGRFC       NLAMLIGTFYITSALFVFVVLGAVCRYNGFSIVALIRYIKEELLLVLGTSSSEAALPGLM
DCTA1_RHILO      NLAMLVGTFYLTAFLFVFGVLGAVCRYNGFSIFSLIRYIKEELLLVLGTSSSEAALPSLM
DCTA2_RHILO      NLAMLVGTFYATSLLFVFVVLGAVCRYNGFSILSLLRYIKEELLLVLGTSSSEAALPSLM
DCTA_RHIGA       NLVMLIGTFYLTSLLFVLVVLGAVARCNGFSVIALIAYIKEEILLVLGTSSSEAALPGLM
DCTA_XYLFA       NLGWLVGSFYLTSLLFVLVILGAVSWFSGFSILKLIRYLKSELLLVLGTSSSEAALPSLM
DCTA_CAUVC       QLGALVATFYVTSLLFVLVVLGGIAWVSGFSIFRFLAYIREELLIVLGTSSSESVLPQMM
DCTA1_BRADU      NLIGLIALFYVTAALFVVVVLGLIARLVGFSIFKFLIYIKDELLIVLGTSSSESALPQLM
DCTA1_RALSO      PLLKLIGTFYLTAIIFVVVVLGIIARLTGFSIFRFVAYIKEELLIVLGTSSSESALPHLM
DCTA_ECOLI       QLGQLIICFYITCILFVVLVLGSIAKATGFSIFKFIRYIREELLIVLGTSSSESALPRML
DCTA_ECO57       QLGQLIICFYITCILFVVLVLGSIAKATGFSIFKFIRYIREELLIVLGTSSSESALPRML
DCTA_SALTI       QLGQLIICFYITCILFVVVVLGTIARVTGFSIFKFIRYIREELLIVLGTSSSESALPRML
DCTA_SALTY       QLGQLIICFYITCILFVVVVLGTIARVTGFSIFKFIRYIREELLIVLGTSSSESALPRML
DCTA_YERPE       QLGQLILCFYLTCILFVVLVLGTIAKFNGFNIFKFIRYIKEELLIVLGTSSSESVLPRML
DCTA2_PSEAE      QLGQLMLCFYITCILFVLIVLGGIARAHGFSILRFIRYIREELLIVLGTSSSESALPRMI
DCTA_BACSU       PLASLMMSVYITMFLFVFVALNIICKLYGFSLWNYLRFIKDELLIVLGTSSSESVLPRMM
DCTA1_PSEAE      HLGALVLVFYATCLVFVMAVLGSVLRLSGVRMLPFLRYFREELLIVMGTASSDAVLPQVM
DCTA2_RALSO      QLGFLVLLFYAAVAVFVVVVLGGILRLAGFSIFKLIRFLRAELLVVLGTASSDAVLPSVM
                  *  *:  .* :  :*:   *. :    *. :   : ::: *:: *:**:**::.:* ::

DCTA_DEIRA       MKLEHAGAEKSVVGLVVPTGYSFNLDGTSIYLTMAALFIAQATNTPLGLGEQLSLLAVLL
DCTA3_RALSO      RKLESAGVSKPVVGLVVPSGLTFNPDGQCIYYTMAAIFVAQATNTPLTLTDQLVVLGVLL
DCTA_RHIME       NKMEKAGCKRSVVGLVIPTGYSFNLDGTNIYMTLAALFIAQATDTPLSYGDQILLLLVAM
DCTA_SINFN       NKMEKAGCKRSVVGLVIPTGYSFNLDGTNIYMTLAALFIAQATDTPISYGDQILLLLIAM
DCTA_RHILE       NKMEKAGCKRSVVGLVIPTGYSFNLDGTNIYMTLAALFIAQATGIHLSWGDQILLLLVAM
DCTA_AGRFC       SKMEKAGCKRSVVGLVIPTGYSFNLDGTNIYMTLAALFIAQATGIHLSFGEQILLLLVAM
DCTA1_RHILO      EKMEKAGAKRSVVGLVIPTGYSFNLDGTNIYMTLAALFIAQATNTDLSVGDQVLLLLVAM
DCTA2_RHILO      EKMEKAGAKRSVVGLVIPTGYSFNLDGTNIYMTLAALFIAQATNIHLSMGDQILLLLVAM
DCTA_RHIGA       AKMEQVGCKRSVVGLVVPTGYSFNLDGTNIYMTLASLFIAQATDTPLTLADQILLLLVAM
DCTA_XYLFA       EKMVQAGCKKSVVGLVVPTGYSFNLDGTNIYMTLAALFIAQATNTELTPAHQLALFLVAM
DCTA_CAUVC       EKLENAGARRSVVGLVIPTGYSFNLDGTNIYMTLATLFLAQATNTPLSLGQELALLGVAM
DCTA1_BRADU      EKLERLGCSKPVVGLVVPTGYSFNLDGTNIYMTLATLFIAQALGVDLSFGQQLTILLVAM
DCTA1_RALSO      EKMEKLGCSKSVVGLVVPTGYSFNLDGTNIYMTMAVIFISQALNIELTLTQQLTILAVAM
DCTA_ECOLI       DKMEKLGCRKSVVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATNSQMDIVHQITLLIVLL
DCTA_ECO57       DKMEKLGCRKSVVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATNSQMDIVHQITLLIVLL
DCTA_SALTI       DKMEKLGCRKSVVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLL
DCTA_SALTY       DKMEKLGCRKSVVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLL
DCTA_YERPE       DKMENAGCKKSVVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATNTHMDIMHQVTLLVVLL
DCTA2_PSEAE      DKMEKLGCNKSVVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATDTPMDITHQITLLLVLL
DCTA_BACSU       DKMERYGCSKSVVGLVIPTGYSFNLDGTSIYLSMATVFLAQVFGVDLSIGQQITIILVLM
DCTA1_PSEAE      RKLEHMGIRSSTVGLVIPTGYSFNLDGFSIYLTLAVVFIAHVTGTPLAMTDLITILLVSL
DCTA2_RALSO      NKLEKMGIKRSVVGLVIPTGYSFNLDAFSIYLTLAAVFIAQATNTPLALSDLLLILGVAL
                  *:   *   ..****:*:* :** *.  ** ::* :*:::. .  :   . : :: : :

DCTA_DEIRA       LTSKGAAGVTGSGFITLAATLGAVGHVPVAGMALILGIDRFMSEARALTNFIGNAVATLV
DCTA3_RALSO      LTSKGSAGVTGSGFITLAATLASLGKIPVAGMVLLLGIDRFMSEARAITNTIGNAVGTLA
DCTA_RHIME       LSSKGAAGITGAGFITLAATLSVVPSVPVAGMALILGIDRFMSECRALTNFVGNAVATIV
DCTA_SINFN       LSSKGAAGITGAGFITLAATLSAVPSVPVAGMALILGIDRFMSECRAITNIIGNAVATIV
DCTA_RHILE       LSSKGAAGITGAGFITLAATLSVVPSVPVAGMALILGIDRFMSECRALTNLVGNAVATIV
DCTA_AGRFC       LSSKGAAGITGAGFITLAATLSVVPSVPVAGMALILGIDRFMSECRALTNFVGNAVATIV
DCTA1_RHILO      LSSKGAAGVTGAGFVTLAATLSVVPAVPVAGMALILGVDRFMSECRALTNLVGNAVASLV
DCTA2_RHILO      LSSKGAAGITGAGFITLAATLSVVPSVPVAGMALILGVDRFMSECRALTNFIGNAVATLV
DCTA_RHIGA       LSSKGSAGITGAGFITLAATLSAVPSVPVAGMALILGIDRFMSESRAITNLIGNAIATLV
DCTA_XYLFA       LSSKGAAGVSGAGFITLAATLTVVPEVPIAGMALILGVDRFMSECRSLTNFIGNAVATLV
DCTA_CAUVC       LTSKGASGVTGAGFITLAATLAVVPDIPIAALAILVGVDRFMSECRALTNLVGNGVATLV
DCTA1_BRADU      LTSKGASGVTGAGFITLAATLSVVNPALVPGMAIVFSIDKFMSEVRALTNIIGNGIAAVF
DCTA1_RALSO      LTSKGASGITGAGFITLAATLAVVPTIPVAGMVLILGIDRFMSECRALTNITGNGVACVV
DCTA_ECOLI       LSSKGAAGVTGSGFIVLAATLSAVGHLPVAGLALILGIDRFMSEARALTNLVGNGVATIV
DCTA_ECO57       LSSKGAAGVTGSGFIVLAATLSAVGHLPVAGLALILGIDRFMSEARALTNLVGNGVATIV
DCTA_SALTI       LSSKGAAGVTGSGFIVLAATISAVGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVV
DCTA_SALTY       LSSKGAAGVTGSGFIVLAATISAVGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVV
DCTA_YERPE       LSSKGAAGVTGSGFIVLAATISAVGHLPLAGLALILGIDRFMSEARALTNLVGNGVATIV
DCTA2_PSEAE      IASKGAAGVTGSGFIVLAATLSAVGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVV
DCTA_BACSU       LTSKGAAGVTGSGFIVLASTLSALQVIPLEGLALLLGVDRFMSEGRAIVNLIGNGIATII
DCTA1_PSEAE      VTSKGAHGIPGSALVILAATLTAVPAIPVAGLVLVLSVDWFMGIGRALTNLIGNCVATVT
DCTA2_RALSO      ITSKGAHGIPGSAIVILAATLSVIPAIPAIGLVLVLSVDWFIGIARALGNLLGNCVATVV
                 ::***: *:.*:.:: **:*:  :      .:.::..:* *:.  *:: *  ** :. : 

DCTA_DEIRA       VARSENAVDMNRLTRALNGED----------LPTTEPDVASEERGEGREIDSSRPVT---
DCTA3_RALSO      IARWVGAVDRERLQAALDGVP----------EAAQTPPQAVHVHAPVAHVEAAHPPLAH-
DCTA_RHIME       VAKWEGELDQAQLSAALGGE------------ASVEAIPAVVQPAE--------------
DCTA_SINFN       VAKWEGELAPAQLATTLAGK------------APVETMSGLSSQRSDTVELGQKVLFGAT
DCTA_RHILE       VARWENELDTVQLAAALGGQ------------TGEDTSAAGLQPAE--------------
DCTA_AGRFC       VARWEGELDQEQLARVLSGKEEFTS------IADVDALPASVQPAE--------------
DCTA1_RHILO      VARWEGELDQAQLKAAFCGHQPAETSAGQPLITPAPSNSAASLPVESPGWSQTPDDRAAG
DCTA2_RHILO      VARWEGELDEAKLARALAG-------------TADDSLPADIVPAE--------------
DCTA_RHIGA       VANWEGDLDRGRMTVRWPGN------------QRWTKFNNKMFKLERGFRAPTVDVDCFG
DCTA_XYLFA       VSRWENALNHEQLKIALDGSE----------PAYQSLHAKDAEPSVSR------------
DCTA_CAUVC       VARWEGALDRQRLDRVLRG------------APATE------------------------
DCTA1_BRADU      VSWWESELDHVTLQTRLNKS-----------TASTTIDTTST------------------
DCTA1_RALSO      ISAWERELDRTKLARVMSGD-----------RGETVSATPAA------------------
DCTA_ECOLI       VAKWVKELDHKKLDDVLNNRA----------PDGKTHELSS-------------------
DCTA_ECO57       VAKWVKELDHKKLDDALNNRA----------PDGKTHELSS-------------------
DCTA_SALTI       VAKWVKELDHQKLDDVLNNRA----------PDGKTHEISS-------------------
DCTA_SALTY       VAKWVKELDHQKLDDVLNNRA----------PDGKTHEISS-------------------
DCTA_YERPE       VAKWCKQLDNDQLQAVLSNKV----------LPNVKSSVSVS------------------
DCTA2_PSEAE      VSKWCKQLDEGTLQRELAGEGN---------ASSPASDIPVGGREAV-------------
DCTA_BACSU       VAKSENEFDEAKSIEAVEG------------MKKMKTAV---------------------
DCTA1_PSEAE      IARWENDIDMPRAQAILDGRL----------EAPAKADGEPLKRSAVAGEGKLHG-----
DCTA2_RALSO      IAAWEKDIDRARANAVLDGKL----------DIIEEGEAAARGHGIQVPSASTLPHA---
                 ::     .                                                    

DCTA_DEIRA       ----------------------------------
DCTA3_RALSO      ----------------------------------
DCTA_RHIME       ----------------------------------
DCTA_SINFN       NSADRTLAGRPGGRDSRRIAPDHSAQVFGGPLSL
DCTA_RHILE       ----------------------------------
DCTA_AGRFC       ----------------------------------
DCTA1_RHILO      SKQTLAGR--------------------------
DCTA2_RHILO      ----------------------------------
DCTA_RHIGA       AGPAQP----------------------------
DCTA_XYLFA       ----------------------------------
DCTA_CAUVC       ----------------------------------
DCTA1_BRADU      ----------------------------------
DCTA1_RALSO      ----------------------------------
DCTA_ECOLI       ----------------------------------
DCTA_ECO57       ----------------------------------
DCTA_SALTI       ----------------------------------
DCTA_SALTY       ----------------------------------
DCTA_YERPE       ----------------------------------
DCTA2_PSEAE      ----------------------------------
DCTA_BACSU       ----------------------------------
DCTA1_PSEAE      ----------------------------------
DCTA2_RALSO      ----------------------------------