CLUSTAL format seed alignment for MF_01302_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RS8_PROMA       --------MANHDPISDMLTRIRNASQKRHENTRIPASRMSRSIAKVLQNEGFISQVSEE
RS8_PROMT       --------MANHDPISDMLTRIRNASEKRHEKTKVPASRMSLSIAKVLQSEGFIAEINEE
RS8_PROMP       --------MSNHDPISDMLTRIRNASQKKHTSTAIPASKMSLSIAKVLQKEGFITDINEE
RS8_SYNP6       --------MAVNDPIADMLTRIRNASEARHATTVVPASRLARSIAEVLKREGFIADFEES
RS8_THEEB       --------MAVNDTIGDMLTRIRNANLARHQTTTIPATRMTRSIAQVLKAEGFIRDFEEQ
RS8_TRIV2       --------MAANDTIADMLTRIRNANMARHQTTLVPATKMTRSIAKVLQEEGFIAEISEE
RS8_TRIEI       --------MAANDTISDMLTRIRNSCMAQHTTTKVPATKMTRSIAKVLKDEGFIGEFEQE
RS8_SYNJA       -------MAHTNDTIADMLTRIRNATMARHESVAVPATRMTRSIARVLHEEGFVSDWKEE
RS8_SYNY3       --------MASTDTISDMLTRIRNACAVRHSTTQVPTTKMTLSIAKVLKSEGFIEDYSET
RS8_GLOVI       --------MAVNDTLADMLTRIRNASIVKHDIVPVPSTRMTRSVAEVLKMEGLILEYQDQ
RR8_PYRYE       --------MVVNDTIADMLTRIRNANLARHQIVQVPATKMTCNMATVLKEEGFVQNFEQM
RR8_GRATL       ---------MINDTIADMLTRIRNANLAKHQIVQVCSTKMTRNIIKVLQEEGFIYKFEEI
RR8_CYAPA       ---------MVNDTIADMLTGIRNANLAKHKVARVKATKITRCLANVLKEEGLIQNFEEI
RR8_GUITH       ---------MTNDTVSDMLTRVRNANLAKHQVVQVPATKMTKSIAHVLLEEGFIESIEEV
RR8_EMIHU       ---------MVNDTIADMLTRIRNANLAKHQIVQIPLTKVTKSIAQVLLREELINSFEEL
RR8_TRICV       ---------MVTDTISDMLTRIRNANMIKHQIVQIPATKMSKAITNILKEEGFIEDYEIY
RR8_PHATC       ---------MVNDTISDMLTRIRNANMVKHQIVQIPASKMSLAIAEILKQEGFIGDFETY
RR8_THAPS       ---------MVTDNIADMLTRIRNANMVKHEIVEIPGTKMSKAIAEILKEEGFIENFETY
RR8_CYAM1       -----------MDTLSQMLTKIRNAQMARHRWVLVPASRMNWNVAQVLREEGLIAQVQP-
RS8_POLSJ       --------MSMSDPIADMLTRIRNAQMVEKAVVLVPSSKVKVAIAQVLKDEGYIDGFSVK
RS8_METPP       --------MSMSDPIADMLTRIRNAQMVEKAVVVMPSSKLKVAIAQVLKDEGYIDAYAVK
RS8_RHOFT       --------MSMSDPIADLLTRIRNAQMVAKTTVSVPSSKVKVAIAQVLTEEGYIDSFKVN
RS8_BORA1       --------MSMSDPIADMLTRIRNAQQVDKTTVNMPSSKLKVAIATVLKDEGYIDSFEVK
RS8_PARXL       --------MSMSDPIADMLTRIRNAQMVEKVSVTMPSSKVKVAIAQVLKDEGYIDDFAVK
RS8_RALSO       --------MSMSDPIADMLTRIRNAQAVEKASVVMPSSKLKVAIAKVLKDEGYIDDFAVT
RS8_AZOSB       --------MSMSDPIADMLTRIRNGQQAQKASVTMPSSKVKVAIAKVLQDEGYIEGFSVR
RS8_AROAE       --------MSMSDPIADMLTRIRNGQQAQKVSVSMPCSKLKVAIAKVLQDEGYIDGYSIR
RS8_DECAR       --------MAMSDPIADMLTRIRNAQLAEKASVSMPSSKVKVAIAAVLKDEGYVEDFAVR
RS8_NITMU       --------MSMSDPIADMLTRIRNAQLSEKTSVVMPASKLKAAIAQVLKDEGYVEDFIVH
RS8_THIDA       --------MSMSDPIADMLTRIRNAQQVEKMAVSMPSSKVKVAIAKVLKDEGYIEDFAVR
RS8_METFK       --------MSMSDPIADMLTRIRNAQSTNKVSVSMPSSKLKRAIAAVLKDEGYIDDFSVQ
RS8_NEIMF       --------MSMHDPISDMLTRIRNAQRANKAAVAMPSSKLKCAIAKVLKEEGYIEDFAVS
RS8_CHRVO       --------MSMHDPISDMLTRIRNGQHASKVKVSMPSSKLKIALAQVLKEEGYIEDFAIA
RS8_ALKEH       --------MSMTDPIADMLTRVRNAQRAEKAEVSMPSSKIKQAIANVLKEEGYIESFEVG
RS8_HALHL       --------MSMTDPIADMLTRVRNAHHAEKADVRMPSSKLKRAIAAVLQEEGYIEGYREV
RS8_NITOC       --------MSMTDPISDMLTRVRNGQNAGKVEVSMPSSKLKVSIARVLKEEGYIEDCKVI
RS8_HAES1       --------MSMQDPIADMLTRIRNGQAANKVAISMPSSKLKVAIANVLAEEGYIANVKVS
RS8_HAEDU       --------MSMQDPIADMLTRIRNGQAANKVAISMPSSKLKVAIANVLAKEGYVESFRII
RS8_ECOLI       --------MSMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVE
RS8_AERHH       --------MSMQDPIADMLTRIRNGQAASKVAVSMPSSKLKVAIAKVLKEEGYITGYSVA
RS8_SHELP       --------MSMQDPIADMLTRIRNGQAANKVSVSMPSAKLKVAIAQTLKEEGYITDYTVA
RS8_SHEAM       --------MSMQDPIADMLTRIRNGQAANKVSVKMPSAKLKVAIAKLLKDEGYITDYAVA
RS8_PSEA6       --------MSMQDPIADMFTRVRNGQMASKVSVSMPSSKLRVAIAAVLKEEGYVSDFAVS
RS8_PSEHT       --------MSLQDPIADLFTRIRNGQSAKKVSVTMPNSKLKVAVAKVLKNEGYIADFAIN
RS8_ALIF1       --------MSMQDPISDMLTRVRNGQAANKVAVKMPSSKLKVAIAALLKAEGYIADFAVE
RS8_PHOPR       --------MSMQDPISDMLTRLRNGQTAKKVAVKMPSSKQKVAIAALLKEEGFVAEFTVT
RS8_IDILO       --------MSMQDPIADMFTRIRNAQGANKVTVKMPSSKQKVAIAQVLKEEGFITGYSAE
RS8_PSYIN       --------MSMQDPISDMLTRIRNGQAASKVSVKMPSSKQKVAIAAVLKAEGYVTEFVVA
RS8_COLP3       ---------MMTDPIADMFTRIRNGQSAAKVAVQMPSSKVKVAIATLLKEEGYISEFSVS
RS8_SACD2       --------MSMQDPIADMLTRIRNAQQVGKTSVTMPSSKLKKSIAGVLKEEGYVGEFSVN
RS8_HYDCU       --------MSMSDPIADMLTRIRNGQIAGHSNVVMPSSKVKVAVAKVLTGEGYVSSYSVS
RS8_CHRSD       --------MSMQDTLADMFTRIRNAQMATKETVTMPSSNLKTEVARVLKQEGYINDFTVT
RS8_MARHV       --------MSMQDTLADMFTRIRNAQMASKADVTMPSSKMKVSVAQVLKDEGYVADFSVS
RS8_HAHCH       --------MSMQDTLADMFTRIRNAQMAEKETVRMPSSKMKVAVANVLKEEGFITDYKAS
RS8_PSESM       --------MSMQDPLADMLTRIRNAQMAEKPVVSMPSSTLKVAVAKVLKDEGYIAGYQIS
RS8_ALCBS       --------MSMQDTLADMFTRIRNAQMAKKVQVEIPASKAKEAVAKVLKDEGYIAGYEVT
RS8_PSYA2       --------MSMQDTVGDMLTRIRNAQMANKVSVAMPSSKLRKSIADLLVNEGYVASAVVT
RS8_ACIAD       --------MSMQDTVADMLTRVRNAQMAKKQTVSMPSSKLKVAIANVLQQEGYISNVEVA
RS8_XANC5       --------MSMTDPIADLLVRIKNAAAVGKQTVKLPSSKIKVAIAQVLKDEGYITDLRVT
RS8_XYLFT       --------MSMTDPIADMLVRIKNAASVGKPNVRFPFSKVKLAIALVLKNEGYIFDAKVI
RS8_BAUCH       --------MSMQDPIADMLTRIRNGQTAHKTILFMPSSKLKVAIARLLQEEGFIKDYKVE
RS8_WIGBR       --------MSMQDPISDMITRIRNGQSAKKELISMPYSNLKKSIANLLKEEGFILDYKVE
RS8_BUCAI       --------MSMQDPVADMLTRIRNGQLANKYSVKMPSSKLKKSIIQLLKEEGYIKDYNVT
RS8_BUCAP       --------MSMQDPVADMLTRIRNGQSANKYSVKMPCSKLKYSIIELLKKEGYIKNFNIQ
RS8_BUCBP       --------MSMQDPIADMLTRIRNGQFASKISVIMPSSKLKVKISILLKEEGYIKDFSVN
RS8_BUCCC       --------MSMQDPIADMITCIRNGQFSNKIFVIVPFSRLKENIVKVLKFEGYIINYKIK
RS8_BLOFL       --------MSMQDPIADMLTVIRNGQVAKKDKVYVPSSTIKIAITKVLVEEGFLKDYSVL
RS8_BLOPB       --------MSMQDSIADMLTTIRNGQISKKEKVCTPSSAMKVAIVHVLVEEGFIQKYNIK
RS8_FRATN       --------MSMQDPIADMFTRIRNGLSAEKEFVSVPFSKIKMEIANFLVNEGYIKSCSKG
RS8_LEGPA       --------MSMHDPIADMLTRIRNGQQAKHQQVTLVSSKLKEEIARVLKEEGYIQDFFTE
RS8_NITEC       --------MCMTDPIADMLTRIRNAQAAEKKEVKIPSSKLKKAILKILKDEGYIESYQEI
RS8_NITEU       --------MCMTDPIADMLTRIRNAQSAEQKEIKMPSSKLKKAILKILKEEGYIENFQED
RS8_METCA       --------MSMSDPLSDLLTRIRNGQAAGKAEIIVPASKLKRAVCQVLKEEGYIAGFSDV
RS8_COXBU       ---------MMQDPISDMLTRIRNAQAVRKKEVVMPRSKLKMSIANVLKEEGYIVDYREE
RS8_MAGMM       --------MSMNDPISDMLTRIRNAQMVGKDSVRMPASKMKKRIADILKEEGYIESISES
RS8_RUTMC       --------MSMSDPIADMLTRIRNAQMVEKKEVNVPASNLKSAIASVMQEEGYIKSFSVD
RS8_DESVH       ---------MLTDPIADMLTRIRNAHLALHKEVSVPRSKMKESLAAILKQEGYIEDVATE
RS8_DESAG       ---------MLTDPIADMLTRIRNAHLALHKEVSVPRSKMKEALAAILKEEGYITDFKME
RS8_LAWIP       ---------MMTDPISDMLTRIRNAQLALHKDVAIPYSKIKYSIANILKEEGYINELTLN
RS8_CHLAB       -------MGMTSDTIADLLTRIRNALKAEHLYVDLEHSKMREAIVKILKQHGFLAHYLIK
RS8_CHLPN       -------MGMTSDSIADLLTRIRNALMAEHLYVDVEHSKMREAIVKILKHKGFVAHYLVK
RS8_CHLMU       -------MGITSDSIANLLTRIRNALMAEHLYIDIEHSKMLEAIVRILKQHGFVAHFLVK
RS8_PARUW       --------MVVSDPVADFLTRIRNGTKAQHRYVDVNWSKMKQTLAEILKNQGFIENYLVK
RS8_DEHMC       ---------MISDPIADMLTRIRNGVMARHEVVIMPASRMKQYLAKVMKQEGFIAGYEVI
RS8_NEOSM       ---------MPNSLIADAVARIRNGQMARLREVTIYHSRVLVEIAALLKEEGYIVGYEVI
RS8_PELLD       --------MPVTDSIADYITRIRNAGRAKNKTTDIPYSKLRENISQLLQDKGYIKNFTVI
RS8_CHLPD       --------MPVTDSIADFITRIRNAGRARNKTTDIPYSKLRENMSQLLLEKGYIKNFTVI
RS8_CHLTE       --------MPVTDSIADFITRIRNAGSAKNKTTDIPYTRVRENLSKLLLEKGYIKNYTVI
RS8_CAMJR       ---------MINDIISDSLTRIRNAGMRKLETTKLLHSKVIEALVGIFQAKGYIESFNVI
RS8_CAMFF       ---------MINDLISDGLTRIRNASMRRLDTTKLLHSNVVEATLKILANKSYIESYNVV
RS8_SULDN       ---------MINDLVSDALTRIRNAGMRRLDVTTLVHSKSVEALANILVEKGYIESCNVV
RS8_HELHP       ---------MVNDIIADSLTRIRNASMRRLEVTTLYYAKIVVSIVEVFKTKGFIKDYKVN
RS8_WOLSU       ---------MVNDIIADSLTRIRNAAMRRLDYTTLYYAKIVVSILEVFLAKGFIESYKVI
RS8_HELAH       ---------MVNDIIADSLTRLRNASMRRLEFTQLYYAKIVVSILEIFKEKGFIKDFNIK
RS8_TREDE       --------MSVSDPIADMLTKIRNAASAGHESVDVPSSKMKWEIISILKSEGYIKNFKKM
RS8_TREPA       --------MGVSDPVADMLTKIRNAARAGHEKVDVPSSKLKVEVVKILKTEGYIRNFRKV
RS8_BORBU       --------MAITYSIGDMLTKLRNASRVGHGSVDLKMSNMNKSILNILKEEGYIKDFNFL
RS8_LEPIC       --------MSMSDPIGDMLTRIRNAGRAKHETCLVPGSKIKKSILDLMKEEGFIKDYESV
RS8_SYNAS       --------MGMTDPIADMLTRIRNANRVHFKSVDVVYSGVNVNIAKVLKKTGYIGGYDVK
RS8_ANAPZ       --------MSLSDPIADFLTRLRNGQAGMNKVVYVPCSKVVMAVLRILVEEGYIESFTEE
RS8_ANAMM       --------MSLSDPIADFLTRLRNGQAGMNKVVFVPHSKVVRSILDILLAEGYIEGFTEE
RS8_EHRRW       --------MSLSDPIANFLTSIRNGQLSMNKVVTVSYSYVIHAILQILLSEGYIDGFTEK
RS8_WOLTR       --------MALSDSIGDFLARIRNAQLAMHKTTRVLFSKVNSSILKILKDEGYILDYQKE
RS8_WOLPM       --------MALSDSIGDFLTRIRNAQLAMHRATRVLFSKMNSSILEILKEEGYILDYEKQ
RS8_PELUB       --------MSLSDPIGDMIARIKNAQVRNHKKVALPSSNFKVKIADILKSEGFIKDYKIE
RS8_BARQU       --------MSMSDPLGDMLTRIRNALARKKGKLVTPASKLRACVLDVLQSEGYIRGYNQV
RS8_BARBK       --------MSMSDPLGDMLTRIRNAISRKKSKVVTPASKLRARVLDVLKLEGYICGYNQI
RS8_CHESB       --------MSVNDPLGDMLTRIRNAIGRKKTTVSTPASRLRARVLDVMKAEGYIRDYTQV
RS8_RHILO       --------MSLSDPLGDMLTRIRNAYGRKKSSVSTPASRLRTRVLDVLKAEGYIRDYSQT
RS8_BRUME       --------MSVSDPLGDMLTRIRNAVGRKKTKVSTPASKLRARVLDVLQAEGYIRGYTQS
RS8_RHIME       --------MAMTDPLGDMLTRIRNGAARRKSSVSTPASKLRARVLDVLQAEGYIRGYSEV
RS8_RHOPB       --------MSTHDPISDLITRIRNAQMRAKSKVSTPGSKMRANVLEVLKNEGYIRGYASV
RS8_CAUVC       --------MSMNDPLSDMIARIKNAAQRKRSKVSTPASKLRARVLDVLADEGYIRGYSLV
RS8_MARMM       --------MSVNDPLGDMLTRIRNALMRNKRAVNTPASALRRRVLDVLKSEGYIRDYAEV
RS8_RUEST       ----------MNDPIGDMLTRIRNSQMRGKSTVMTPASKLRAWVLDVLQSEGYIRGYESA
RS8_RUEPO       ----------MNDPIGDMLTRIRNAQLRGKSTVSTPGSKLRAWVLDVLADEGYIRGYEKS
RS8_JANSC       ----------MNDPISDMLTRIRNSQMRGKSTVETPASKARARVLDVLADEGYIRGYEAK
RS8_RHOS4       --------MSVNDPLGDMLTRIRNAQLRGKSTVSTPASRLRAWVLDVLQAEGYIRGYEKK
RS8_PARDP       --------MSMNDPLGDMLTRIRNAQMRGKSTVRTPGSKLRAWVLDVLKAEGYIRGYEEV
RS8_HYPNA       --------MNISDPLGDMLTRIRNAQMRGMSKTTSPASKLRARVLDVLTDEGYIRGYAEI
RS8_NOVAD       --------MAMTDPLGDMLTRIRNGQQAKKDSVLSPASKLRAHVLEVLQREGYIRGFSED
RS8_SPHAL       --------MAMTDPLGDMLTRIRNGQQAKKDSVLTPASTLRVRVLDVLQREGYIRGYSEE
RS8_ZYMMO       --------MALSDPLGDLLTRIRNGQHARKDSVVSPASKLRVRVLDVLAREGYIRGYTEA
RS8_GRABC       --------MQLSDPLGDLLTRIRNAQRSRHATCVSPASKLRANVLEALKREGYIRGYTSE
RS8_GLUOX       --------MSLSDPLGDMLTRIRNAQRARHAVCVAPASKLRASVLEALKREGYIRGFAAE
RS8_MAGSA       --------MSMTDPLGDLLTRIRNGQRANKSTVVSPASSLRANVLEVLKREGYIRGYARS
RS8_RHORT       --------MALSDPIGDMLTRIRNGQRARKSSVMAPASTMRANVLDVLIREGYIRGYEKV
RS8_RICBR       --------MSMTDNVADMLTRIRNAYKSKLINVSFPSSKIKTSILEVLQKEGYIKNYTST
RS8_KORVE       -------MSLTTDPVADFLSRVRNAIKARHQKVDAPASKLKTELARILKEEGYIANYKAV
RS8_SOLUE       ---------MTSDPIADMLTRVRNAIQARHPKVDVPASKLKAEIARILKEEGYITNFKVA
RS8_BDEBA       -----------MDTISQFLTMIRNAGAAKHEKVDMPASKVRAGIAQILVNEGFIRSFKVA
RS8_SYNFM       --------MAVSDPIADFLNRIKNGQKARFDKVDIPASRMKASLSRILKEEGYIKNFKLI
RS8_GEOMG       --------MSMTDPIADMLTRIRNASMAKLQKVDIPSSNLKVSLANVLKAEGFIKNFKVI
RS8_GEOSL       --------MSMTDPIADMLTRIRNANMARLQKVDIPSSNLKVNLANVLKAEGFIKNYKVI
RS8_PELPD       --------MSMTDPIADMLTRIRNANMVKHQKVDIPSSTMKVNIASVLKQEGYIKNYKVI
RS8_PELCD       --------MAMTDPIADMLTRIRNAGLAKHQKCDMPASNVKLAIVNVLKELGYIKNFKQI
RS8_SALRD       -------MSGISDPVSNYMAQLRNAQEAEQTYVDIPASKLKRAMTQILLEKGYIKNFVNI
RS8_ANADE       --------MSFTDPIGDMLTRIRNASSARHEKCLVPASRLKVRIAEVLREEGFIKDFVLH
RS8_MYXXD       --------MPVNDPVGDMLTRLRNASRARHDKVVIPHSKLKLEIIKVLKDEGYIGEFVVH
RS8_ARTS2       --------MTMTDPVADMLTRLRNANSAYHDTVTMPYSKLKARVADILKAEGYIASWKEE
RS8_STRCO       --------MTMTDPIADMLTRLRNANSAYHDSVTMPASKIKSHIAEILQQEGFITGWKTE
RS8_LEIXX       --------MTMTDPVADMLTRLRNANSAHHDTVSMPHSKLKVHIAEILTTEGYISGWEVA
RS8_FRACC       --------MTMTDPIADMLTRVRNASRAYHDRVVMPHSKIKTHIAEILQQEGYISGWHVE
RS8_MYCLE       --------MTMTDPIADFLTRLRNANSAYHDEVTVPHSNIKANIAQILKNEGYIRDFRTE
RS8_NOCFA       --------MTMTDPIADFLTRLRNANSAYHDQVKAPHSKLKANIAEILKREGYIADYRTE
RS8_SACEN       --------MTMTDPIADMLTRLRNGNSAYHDEVVMPHSKLKANIAEILKREGYVSGYRTE
RS8_THEFY       --------MTMTDPIADMLTRLRNANAAYHETVAMPYSKIKAHIAEILQKEGYIQGWRVE
RS8_ACIC1       ---------MMTDPIADMLTRVRNANSAYHDTVVIPYSKIKANIAEILQREGYIAGYRVD
RS8_NOCSJ       --------MTMTDPIADMLTRLRNANQAYHDAVSMPYSKLKQGVADILKQEGYITSYDVT
RS8_CUTAK       --------MTMTDPIADMLTRLRNANQAYHDQTSMPHSKIKAGIAGILKSEGYIADYKVN
RS8_CORDI       --------MTMTDPIADMLSRVRNANNAHHDAVSMPSSKLKANIAEILKSEGYIADYKVE
RS8_CORJK       --------MTMTDPIADMLSRVRNASNAFHESVSMPSSKIKANIAEILKEEGYIADYTVN
RS8_BIFLO       --------MTMTDPIADMLTRLRNASAAKHETVDMPYSKFKANIAEILKREGYIKDFTAK
RS8_TROWT       --------MTMTDPLSDMFSRIRNANQVLHKKVTVPSSRLKVSIADLLKREGYILDYSVI
RS8_RUBXD       --------MAVNDPIADMLTRIRNAVMAKHERVEIPHSKMKVEIARILKEEGYVRDYAVR
RS8_LISMO       --------MVMTDPIADFLTRIRNANMVKHDKLELPASKIKKEIAEILKREGFIRDVEYI
RS8_BACSU       --------MVMTDPIADMLTRIRNANMVRHEKLEIPASKLKREIAEILKREGFIRDVEFV
RS8_GEOKA       --------MVMTDPIADMLTRIRNANMVRHEKLEVPASKIKREIAEILKREGFIRDYEYI
RS8_BACHD       --------MVMTDPISDMLTRIRNANTVRHEKLELPASKIKKEIAEILKREGFIRDYEYI
RS8_PEDPA       --------MSMTDPIADFLTRIRNANMVRHESLEVPASKIKKDMAEILKNEGFIKDVEYI
RS8_ENTFA       --------MVMTDPIADFLTRIRNANMVKHETLEVPASKIKRDIAEILKREGFIRDVEYI
RS8_LACP3       --------MVLTDPIADYLTRIRNANMVRHESLVVPASKMKKDISEILKREGFIRDYEVI
RS8_LACSS       --------MVMTDPIADYLTRIRNANMVRHESLEVPASRIKKDISEILKREGFIRDYEVI
RS8_STAS1       --------MTINDPIADMLTRVRNANMVRHDKLELPASNIKKEIAEILKSEGFIKNVEYV
RS8_OCEIH       --------MVMTDPIADMLTRIRNANMVKHEKLELPASNIKKEIADILKREGFVKDYELI
RS8_STRA5       --------MVMTDPIADFLTRIRNANQAKHEVLEVPASNIKKGIADILKREGFVKNVEVI
RS8_STRMU       --------MVMTDPIADFLTRIRNANQANHSVVEAPASNIKRGIAEILKCEGFVKDVEVI
RS8_LACLA       --------MVMTDPIADFLTRIRNGNMRKFDVVEAPASKIKRQIAEILKAEGYVKDVEYV
RS8_LACDB       --------MVLTDPIADFLTRIRNANMAKHDSVEIPASNIKKSLTEILKQEGFIRDYEVT
RS8_LACAC       --------MVMTDPIADYLTRIRNANMAKHDSVEIPASNIKKSISEILKREGFIRDYEVA
RS8_LEUMM       --------MSMTDPIADFLTRVRNANLARHEVVEAPASKIKKSIAEILKAEGFIRDFEYI
RS8_OENOB       --------MTMSDPIADFLTRIRNANMVRHETVETPASKIKINIAQILKDEGFITDYQVV
RS8_CLOD6       --------MTMTDPIADMLTRIRNANVVKHETVDVPASNMKKELARILLEEGFIRGYDVI
RS8_HUNT2       --------MQATDVIADMLTRIRNACSAKHETVDIPASNIKRAIANILLEEGYIKGIEEI
RS8_CLOPE       --------MVMTDPIADLLTRVRNANSVRHEVVEVPSSSVKKAIVNILLQEGYLKGVEEY
RS8_CLOAB       --------MVMTDPIADLLTRIRNANVVRHGVVELPSSKIKKAMANILLQEGYLKDIEEY
RS8_CLONN       --------MVMTDPIADMLTRIRNANIVRHEVVEVPSSNVKKSIANILVQEGYVKDIEEY
RS8_CLOTE       --------MVMTDPIADLLTRVRNANIARHEAVEIPASNIKKAIANIMLQEGYITDLEEY
RS8_CALS4       --------MVMTDPIADMLTRIRNANLARHETVEIPSSKMKKAIAMILLKEGFVKAVEEI
RS8_MOOTA       ----------MTDPIADFLTRIRNANMVYQEKVEVPASRVKRALAEILKNEGYIKNYEYI
RS8_CARHZ       --------MVMTDPIADFLTRIRNANMVYHEKVEVPSSKVKRAIAEILKEEGFIKDYEYI
RS8_SYNWW       --------MVMTDPVADFLTRIRNGNMVMHETVEVPGSRIKLSIARIMQEEGYIKDYEFV
RS8_DESHY       --------MAMSDPIADFLTRIRNAGMVYHDKVEVPASNVKKAIAEILKEEGFIKDVEYI
RS8_SYMTH       --------MVVSDPIADLLTRIRNANLAYHDRVDVPGSKMKKAIVQIMKDEGFIRDFEWI
RS8_DEIRA       ---------MLSDPIADMLTRIRNATRTHKETVDIPASKFKEELAKLLVREGYVQGVERT
RS8_THET8       ---------MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERV
RS8_THEMA       ---------MWSDPIADMLTRIRNANMVFKEYTDIPASNLKKKICEILKREGFIADYKYI
RS8_RHOBA       ---------MMTDPIADMLTRIRNAVRVERPFVDIPASRVKRGLADVLKREGFIWDWKEE
RS8_MYCMS       ---------MTTDVIADMLTRIRNANQRYLKTVSVPSSKVKLEIARILKEEGFISNFTVE
RS8_MESFL       ---------MTTDVIADMLTRIRNANQRMLKTVNIPSSKMKLEIANILKEEGFISSFTVE
RS8_ONYPE       --------MVMTDPIADMLTRIRNANQMSHLKVLVPASKLKLEILAVLKKEGFIKDFYLP
RS8_FUSNN       --------MYLTDPIADMLTRVRNANAVMHEKVDIPHSKMKERIAEILKEQGYISNFKIV
RS8_MYCMO       ------MSRVITDPIADMLVRIKNATARKHKNVLIPFSNKKSKILEIIKDQGYIFDFAIE
RS8_MYCPU       -------MSIITDPIADMLTRIKNATKRKHKSVNIPFSNKKLKIVEIIKKEGYISGYEIV
RS8_MYCHJ       -------MAFITDPIADMLTRIRNATIRKHKNVSFQHSKTKVKILEIIQKAGYIKDFQVE
RS8_MYCS5       --------MFLTDPISDLIVRIKNANQRKHKTVEIPHSNKKEAIVKLIKEEGYISSYSVE
RS8_MYCPN       MITTTKPIKAHFDPVADLLTKINNARKAKLMTVTTIASKLKIAILEILVKEGYLANFQVL
RS8_MYCGA       ---------MHFDPVADIITKINNANRAKIVELQTEASKLKVAILNILLNEGYIRGYEIY
RS8_MYCPE       ---------MYMDPISDLLLRIKTGTKTKRNSVVVKTSKLVTNILEILKNEGYIEGFKTE
RS8_UREPA       ---------MYLDPIAELITKINNGRKAHKAEVSFATSKLKTAILELLVKEGYIKSYDIR
RS8_CYTH3       -----------MDPIADYLTKIRNAIKAKHRVVEVPASNIKKEITKVLFDKGYIQSYKFE
RS8_GRAFK       ---------MNTDPIADYLTRIRNANAANHRVVEIPASNVKKEITKILFDQGYILSYKFE
RS8_BACTN       ----------MTDPIADYLTRLRNAIGAKHRVVEVPASNLKKEITKILFEKGYILNYKFV
RS8_PORGI       ----------MTDPIADYLTRLRNAIMAGHRVVSVPASNIKKEITKILFDKGYILNYKFE
RR8_HELSJ       ---------MPRDLFSDALTRLRNALRVNKQTVIIPFSNLNYSFSNILLEEHLLEKKTIL
RR8_BIGNA       ----------MTDNLGKMLNKIKNAILVKHEAVLIPYTLNNFLILRILEQEGFLDSINIV
RR8_CYACA       ---------MVNDSISDMLTRLRNAICAQHKVVQVPLTNINKNILKVLQKEGYIKNFEIL
RR8_DAUCA       ---------MGRDIIADIITSIRNADMDRKRAVRIASTNITENIVKILLREGFIENVRKH
RR8_LACSA       ---------MGSDTIADIITSIRNADMYRKSVVRVASTNISQSIVKILLREGFIENVRKH
RR8_CITSI       ---------MGKDTIADIITSIRNADMNRKGTVRIASTNITENVVKILLREGFIENARKL
RR8_SPIOL       ---------MGKDTIADIITCIRNADMNRKGTVRIVSTNITENIVKILLREGFIENARKH
RR8_COFAR       ---------MGRDTVAEIITSIRNADMDKKRVVRITSTNITENIVKILLREGFIENARKH
RR8_EPIVI       ---------MGRDTILEIINSIRNADRGRKRVVRITSTNITENFVKILFIEGFIENARKH
RR8_LEPVR       ---------MGKDTIADIITSIRNADMNRKGTVRIRSTNITESIVKILLREGFIENVRKH
RR8_LOTJA       ---------MGKDTIADIITSIRNADMNRKRTVQIPFTNITENTVKILLREGFIENVRKH
RR8_CUCSA       ---------MGKDTIANIITSIRNADMNRKGMVRIPATNITENIVKILLREGFIENVRKH
RR8_MORIN       ---------MSKDTIANILTSIRNADMNKKRTVRIPYTNITENILKILLREGFIENMRKH
RR8_PLAOC       ---------MGRDTIADIITSIRNADMDKKGRVRIGYTNIAENIIKILLREGFIENVRKH
RR8_DRIGR       ---------MSKDTIADIITSIRNADMDKKGTVRIASTNITENIIKILLREGFIENVRKH
RR8_AMBTC       ---------MGRDTIANIITCIRNADMDKKRMVRIASTNITENIVKIILQEGFIENVRKH
RR8_NYMAL       ---------MGRDTIADIITYIRNADMDKKGTVRIPSTNITENIVKILLREGFIENVRKH
RR8_ACOCL       ---------MGKDTIADIITSIRNAQMAKKGTVRIASTNLTENVVKILLREGFIENVRKH
RR8_PIPCE       ---------MGRDTIADIITSIRNAHMDKKGTVRIASTNMTENIVRILLREGFIENVRKH
RR8_OENEH       ---------MGRDTIADIITSIRNVDMNRKGTVRIESTNMAEKIVKILLREGFIENVRKH
RR8_PHAAO       ---------MGRDIIANIITSIRNADIDQKGRVKIVSTNITKNIVKILLREGFIENVRKH
RR8_SACHY       ---------MGKDTIADLLTSIRNADMNKKGTVRVVSTNITENIVKILLREGFIESVRKH
RR8_PELHO       ---------MGKDTLSEIVTSIRNADMAKKETVRITFTNIAQNIVTILLREGFIKNAREH
RR8_JASNU       ---------MCRDTIAEILTSIRNAYMDRKRVVRIASTNITENIVKILFREGFIENVRKH
RR8_ADICA       ---------MNNDAISTTVTSIRNANTKRKAMTRIPVTKMTRGIVQILLEEGFLKSVTEH
RR8_MARPO       ---------MGNDTIANMITSIRNANLGKIKTVQVPATNITRNIAKILFQEGFIDNFIDN
RR8_PHYPA       ---------MGNDTIANMITSIRNANLEKTKTVQVPATNITKNIGKILLQEGFIENFREH
RR8_ANTAG       ---------MGNDIIANMITAIRNANLGRAETVEVPATNLTRNIAKILLREGFIESFSEH
RR8_HUPLU       ---------MGNDTIANMITSVRNANLGKEETVRVPATNINRSIGKILLQEGFVKNLGEL
RR8_PINTH       ---------MGNDTITNLITSIRNADMVEKGTVRVTATNITKNIGRILLREGFIEDVREH
RR8_CHAGL       ---------MTSDVIANMITSIRNANLRKIKVIELPATKITKSIGKILLQEGFIDNLRER
RR8_CHAVU       ---------MSKDTISNMITSIRNGNLSKAKIVQIPATQTARSIAKILLDEGFIENFREV
RR8_STAPU       ---------MGNDTLANMITCIRNANLRKTKTVEILATNTNRSIAKILLEEGFIDELRER
RR8_ZYGCR       ---------MGNDTIGSMITCIRNGNLSKAKTVEVPATQITRSIANILLQEGYIANVRER
RR8_PSINU       ---------MSHDTIADMISLVRNANMRKAVKVRVPATGITQNIVKILLQEGFIKDYMKQ
RR8_SELUN       ---------MGNDAIDDVTTAPRNASSRGAETVRVSSTDITISIGRVLVEEGFSGNPREH
RR8_CHLAT       ---------MVNDTVADMITRIRNANLVRQTNVQVIASNTTNSIASILKDEGFVEKIQTI
RR8_MESVI       ---------MVNDTIADMITRIRNANLITQKQVAVIASNTNKGIAQCLLKEGFIESIEYN
RR8_CHLVU       ---------MVNDTISDMLTRIRNANLAKKTSVSLPKTKVHEKMCQILEQEGFIKTFSFS
RR8_OLTVI       ---------MVNDCISDLLTRIRNANLVKKEKLIIPNTRVSRNICALLEKEGFID--SCQ
RR8_TETOB       ---------MVNDTISDMLTRIRNASMVKKSTVLIPFTKMNQKIAQILEKEGFIQS-FFL
RR8_TUPAK       ---------MIYDTISDMLTRIRNAYLVKHETVYVLNTKINRKISEILKKEGYIESVNLS
RR8_NEPOL       ---------MIQDTIADMLTRIRNANAMRIYTVCMPMTSVAREIAVILETEGWIDSWKEA
RR8_OSTTA       ---------MVNDTISDMLTRLRNAYLADKEQTSLKATRVVKDIAQVLVQEGFLGPIEQE
RR8_EUGLO       --------MTTIDTISDVITRIRNANILKLDRVELINTKVAIGICHILKDRGFINSFGEF
RR8_EUGGR       --------MTNIDVISDMLTRIRNSLLIKARKVNVINTKLTVNIAEILKKEGFIDSFE--
                              .       ..             :         :            

RS8_PROMA       GEG---------VKTQLVLELKYSG----KHR------HPTIRSMKRVSKPGLRIYKNNR
RS8_PROMT       GEG---------FRKQLILGLKYTG----KHR------SPIIRSMQRVSKPGLRIYKNTR
RS8_PROMP       GEG---------YKSQIVLGLKYSG----KNK------FPTIRSMQRVSKPGLRVYKNTK
RS8_SYNP6       GEG---------VQRHLVLSLKYKG----KNQ------QPIIKALKRVSKPGLRVYSNRR
RS8_THEEB       GDG---------VKRHLVVSLKYRG----KQR------QPIITALKRVSKPGLRVYANSR
RS8_TRIV2       GDE---------VKRNLVIALKYKG----KNR------QPLITALKRVSKPGLRVYSNRK
RS8_TRIEI       GEG---------IKKYLVIFLKYKG----KNR------QPIIRYLKRVSKPGLRVYKNRK
RS8_SYNJA       GEG---------IHAQLVLRLKYKG----KGR------KPIINGLKRVSRPGLRVYCNHK
RS8_SYNY3       GEG---------INKMLVLTLKYKG----KTR------QPLINTLQRVSKPGLRVYSPSK
RS8_GLOVI       GEG---------KDRQLLLTLKYAG----RQR------RPLITNLKRVSRPGLRVYANRK
RR8_PYRYE       GEG---------IETHLMISLKYNG----KNR------QPVITALKRISKPGLRVYANHK
RR8_GRATL       GED---------NNKYLLISLKYKG----KRK------KPVITSLKRISKPGLRVYANYK
RR8_CYAPA       ENN---------LQNELLISLKYKG----KKR------QPIITALKRISKPGLRGYANHK
RR8_GUITH       GLD---------INRQLLLSLKYKG----RER------EPVINALKRISRPGLRVYANRK
RR8_EMIHU       RNG---------TQSSLLLSLKYTG----KTR------TPSIQKIQRISKPGLRIYSGAK
RR8_TRICV       MEN---------SYQFLLISLKYKG----KSR------EPVICKMVRVSKPGLRVYSKSK
RR8_PHATC       SEN---------EKKYLLISLKYVG----KLR------KPVICKIERVSKPGLRVYSNSK
RR8_THAPS       TEN---------SNQYLLLSLKYEG----QSR------ERIINKIERVSKPGLRVYANSK
RR8_CYAM1       ------------ADLHLRIQLKPKR----------------IQRIWRVSKPGLRIYSSYK
RS8_POLSJ       TDDG---------KSQLEIALKYYA-----G-------RPVIERIERVSRPGLRVYKGHG
RS8_METPP       GEAE---------KPQLEIGLKYYA-----G-------RPVIERIERVSRPGLRVYKGRH
RS8_RHOFT       ANDG---------KPELEIVLKYYA-----G-------RPVIERIERVSRPGLRVYRGSD
RS8_BORA1       GSQA---------KPELEITLKYYA-----G-------RPVIERIERVSRPGLRIYKGRS
RS8_PARXL       SEGA---------KSELNIVLKYYA-----G-------RPVIERIERVSKPGLRVYRGRN
RS8_RALSO       EQGG---------KASLTIGLKYYA-----G-------RPVIERLERVSKPGLRVYKGRN
RS8_AZOSB       EGEG---------KAVLDVALKYYA-----G-------RPVIERIERVSRPGLRVYKGTD
RS8_AROAE       EAGG---------KPELDVALKYYA-----G-------RPVIERIERVSRPGLRVYKGSG
RS8_DECAR       QADG---------KANLEIALKYYA-----G-------RPVIERIERISKPGLRIYKGCD
RS8_NITMU       EAGG---------KSILDISLKYYA-----G-------RPVIERIERVSRPGLRIYKGSN
RS8_THIDA       GEAG---------KPELELQLKYYA-----G-------RPVIEHIERVSKPGLRIYKGAG
RS8_METFK       DVDG---------KPQLNISLKYYA-----G-------RPVIEKIERVSRPGLRIYRGNQ
RS8_NEIMF       SDVK----------SILEIQLKYYA-----G-------RPVIEQIKRVSRPGLRIYKASS
RS8_CHRVO       GEEK---------KPVLDIQLKYYA-----G-------RPVIERIERVSRPGLRVYKGST
RS8_ALKEH       GDEK---------KPELKISLRYYQ-----G-------EPVIRELERASSPGLRLFKDKG
RS8_HALHL       GEEK---------KPVLEVTLRYHE-----G-------QPAIREIQRYSRPGLRVYRGRD
RS8_NITOC       ADAK----------PTLVIRLKYYG-----G-------KPVIEDIHRASRPGLRMYKSRD
RS8_HAES1       EGV----------KPELEITLKYFQ-----G-------KPVVESIQRVSRPGLRIYKRKN
RS8_HAEDU       EDS----------KPELEITLKYFQ-----N-------KPVVESIQRISRPGIRIYKRKD
RS8_ECOLI       GDT----------KPELELTLKYFQ-----G-------KAVVESIQRVSRPGLRIYKRKD
RS8_AERHH       GDV----------KPELEIELKYFQ-----G-------KPVVELIQRVSRPGLRIYKRTT
RS8_SHELP       GEA----------KPVLEITLKYFQ-----G-------QPVVETIQRVSRPGLRIYKGKN
RS8_SHEAM       SEGN---------KAELEVTLKYFQ-----G-------RPVVETIQRVSRPGLRIYKGKD
RS8_PSEA6       GDV----------KPVLEVTLKYFE-----G-------KKVIESIERVSRPGLRIYKKKD
RS8_PSEHT       GDV----------KPELSIELKYFE-----G-------KAVIENIQRVSRPGLRIYKRRD
RS8_ALIF1       GDI----------KPELEITLKYFQ-----A-------KPVIEQIQRVSRPGLRVYKKND
RS8_PHOPR       GDV----------KPELEVTLKYFE-----A-------NPVIEQIQRVSRPGLRIYKKKD
RS8_IDILO       STV----------KPELEVELKYFE-----G-------KPVIETIERVSRPGLRIYKKRN
RS8_PSYIN       GDT----------KPELEVTLKYFE-----G-------KKVIDTIKRVSRPGLRIYKGAN
RS8_COLP3       GEV----------KPELAVTLKYFE-----G-------KEVIEKIKRVSRPGLRIYKSCD
RS8_SACD2       DAA----------KAELTVELKYFE-----G-------KPVIAELDRVSRPGLRSYVGKD
RS8_HYDCU       DKNG---------KSELSVDLKYFE-----G-------QPVIEMLKRVSRPGLRVYKNKD
RS8_CHRSD       EGAK----------PQLAVTLKYFE-----G-------KPVIEHIQRFSKPSLRSYKGKD
RS8_MARHV       ADAK----------PELTITLKYFG-----G-------KPVIEEIQRVSRPSLRQYKGAG
RS8_HAHCH       EEAK----------PVLEITLKYYQ-----G-------APVIENISRASRPGLRQYKAAN
RS8_PSESM       SEVK----------SSLSIELKYFE-----G-------RPVIEEVKRVSRPGLRQYKSSD
RS8_ALCBS       GDKK----------PVMTVELKYYE-----G-------SPVIEKIARVSRPGLRVYKSAG
RS8_PSYA2       EENNN--------KATLTIVLKYFE-----G-------KAVIETIQRFSRPGLRQHRGKD
RS8_ACIAD       QEEA---------KATLTLTLKYFE-----G-------KPVIETVKRVSRPGLRQYRGKD
RS8_XANC5       QTENN--------KAELEIVLKYFE-----G-------RPVIETLKRFSRSGLRQYRGKT
RS8_XYLFT       QSDNS--------KSDIEVVLKYFE-----G-------RPVIRILKRVSRSGLRKYCGKA
RS8_BAUCH       GNIKK--------KPVLKIFLKYFQ-----G-------KPVIENIQRISRPSLRIYRKKT
RS8_WIGBR       DN--K--------KPTLKLNLKYFK-----N-------NPVIEKIKRISRPGLRIYKKRK
RS8_BUCAI       GD--T--------KLELEVFLKYFQ-----G-------KSVVDMIQRISRPSLRIYKNKN
RS8_BUCAP       GN--N--------KLKIEVILKYFK-----G-------KSVIETIQRVSRPSLRIYKKKN
RS8_BUCBP       ST--N--------KPILEIFLKYFR-----S-------KPVIENITRVSSPSLRIYARNN
RS8_BUCCC       KN--N--------NKVLKIFLKYFN-----G-------KSVIENIKRISRPSLRRYCNKR
RS8_BLOFL       GN--I--------KFILEISLKYYQ----CN-------KPVIDHIQRISRPSLRVYKNKD
RS8_BLOPB       DS--I--------KPTLEVFLKYYQ----KR-------KPVIDIIKRISRPGLRIYKKRK
RS8_FRATN       TTSMG--------HPSIEIELKYHA-----G-------VPVIEMIKRVSRPSLRIYKSHA
RS8_LEGPA       TLPNG--------LKSITLKLKYYH-----G-------RPVIEFIKRISRPGLRVYKSYK
RS8_NITEC       VSDG---------KLSVDICLKYFN-----G-------GPVISSLTRISKPGLRRYSSRN
RS8_NITEU       PNHK---------KPSISVILKYFN-----G-------EPVITSISRVSKPGLRSYKSKN
RS8_METCA       TEQG---------KHNIRVELKYHN-----G-------APVIDKIQRVSKPGCRRYRGRD
RS8_COXBU       GDLT---------KAQLVITLKYHE-----G-------ESVISEIRRVSSPALQVYKSKD
RS8_MAGMM       VDEAN--------HTTLELTLKYYQ-----N-------KPVIEEIKRISTPGRRTYVGKA
RS8_RUTMC       -GIAA--------SKTLNIKLKYYD-----N-------KSVIEKLKRISKPSLRVYVSSS
RS8_DESVH       EG-------------SIKLTLKYFK-----G-------KPVISGLKRVSKPGRRVYVGMH
RS8_DESAG       ES-------------SIVIELKYFK-----G-------KPVISGLKRISKSGRRVYVGST
RS8_LAWIP       NG-------------TITLYFKYYK-----G-------KAAIEGLRRISKSGRRVYVSTH
RS8_CHLAB       EEHRK--------R-TMRIFLQYTN----DR-------KPVIRQLKRVSKPSRRVYVPAA
RS8_CHLPN       EENRK--------R-AMRVFLQYSD----DR-------KPVIHQLKRVSKPSRRVYVSAA
RS8_CHLMU       EENRK--------R-LMRVFLRYGE----DR-------RPVIHALKRVSKPSRRVYVSAA
RS8_PARUW       VDEGQ--------RGTIRIFLKYTN----GR-------RPVIQGLKRISKPGLRKYVGHQ
RS8_DEHMC       GAKPK--------R-QLKIVLRYDE----GG-------ASFVSGLERISKPGLRVYVQRG
RS8_NEOSM       EIRPS--------VKRIIIRLKYYC----G--------QPVISKLKLFSRPGKRIYSRAC
RS8_PELLD       T-TE--------KFPFIRIELKYTA----SG-------EPSIKEITRVSRPGRRTYEGKD
RS8_CHLPD       T-TE--------KFPIIRVDLKYGA----TG-------ESAIKEITRVSKPGRRVYDGKD
RS8_CHLTE       T-SE--------QFPFIRVELKYMQ----DG-------QHAIKEISRVSKPGRRVYQGKD
RS8_CAMJR       E-ED--------KKKFINVVLKYDE----KG-------KSVINELKRISKPGRRVYKGKD
RS8_CAMFF       E-EG--------NKKFINVVLKYDE----RG-------RSVINELKRVSKPGRRVYQGRD
RS8_SULDN       E-DG--------VKKTINVVLKYSD----NG-------KSVINEMKRISKPGRRVYKGKD
RS8_HELHP       D-KD--------GKRSIMVQLAYDE----QG-------KSAINEIKRISKPGRRVYKARS
RS8_WOLSU       D-KD--------GKQSINVVLKYDE----KG-------RSVISEIKRISKSGRRVYKGRD
RS8_HELAH       D-KD--------KKQSVYVQLAYDE----KG-------YSKISEVKRLSKPGRRVYKQKN
RS8_TREDE       T-QE--------GAGNIRVFLKYDD----KE-------SSVIHGIERVSTPGRRVYLGYK
RS8_TREPA       E-ED--------GSGCIRVFLKYDD----NE-------TSVIHGIERISTPGRRVYSGYK
RS8_BORBU       E-KK--------GIAFIRVLLKYDN----KR-------NPVINKIDAISTPGRKIYSSYR
RS8_LEPIC       KVNE--------TFEDYKVFLKYDH----TK-------RPIIRELVRVSTPGRRVYIKSA
RS8_SYNAS       KDEK--------GHDVLKVYLKYPD----SK-------RTIINDIQRVSKPGRRVYVKGD
RS8_ANAPZ       VRGD-------SGIKVLKVFLKYF-----NS-------AAAIRKIVRVSRPGKRVYSSAD
RS8_ANAMM       SK-S-------SGIKYLKVCLKYY-----NC-------APVIKKIVRVSRPGKRVYSSAD
RS8_EHRRW       LR-S-------TNIKFFEVKLKYY-----NG-------VPVINRICRVSKPGKRCYCSAK
RS8_WOLTR       VV---------GNIPSFVVKLKYY-----ER-------SPVISDIVRVSKPGCRCYSKYK
RS8_WOLPM       VV---------DNLPSFIVKLKYY-----EK-------SPVISDIVRVSKPGCRRYSKYK
RS8_PELUB       TE---------NNKPTLSVDLKYY-----SG-------NPVISTFERVSKPGRRIFSSAD
RS8_BARQU       DLGD--------GKSEIEIELKYF-----EG-------LAAIRELSRVSKPGRRVYVSAK
RS8_BARBK       DSGN--------GKFEFEIELKYF-----EN-------SSVIRTISRISKPGRRVYVSTK
RS8_CHESB       DYDN--------GKSELEIQLKYL-----EG-------APVIREIARVSKPGRRVYVSVK
RS8_RHILO       DFDN--------GKSEIEIELKYF-----DG-------APVVREIARVSKPGRRVYVSAK
RS8_BRUME       EFEN--------GKAEIEIELKYY-----EG-------VPVIREITRVSKPGRRVYVSVK
RS8_RHIME       EFGN--------GKAELNIELKYY-----EG-------ASVIREIARVSKPGRRVYVSVK
RS8_RHOPB       DHAS--------GRSELEIELKYF-----DG-------EPVIREIERVSKPGRRVYASVK
RS8_CAUVC       EKPG--------AFPEFEIELKYF-----DG-------EPVIAEISRVSKPGRRVYSSIK
RS8_MARMM       EHAS--------GLKEFEIELKYF-----EG-------DSVISEIKRISKPGRRVYSGVK
RS8_RUEST       TDER--------GHPALEISLKYY-----EG-------EPVIRELKRVSKPGRRVYMGVN
RS8_RUEPO       TDVN--------GHPTLNIELKYY-----EG-------EPVIRELKRVSKPGRRVYMGVK
RS8_JANSC       TGKD--------GHPAFEISLKYY-----EG-------TPVIRELKRVSKPGRRVYMSVG
RS8_RHOS4       ETEN--------GQGELVISLKYF-----EG-------TPVIRELKRVSKPGRRVYMATK
RS8_PARDP       TTEA--------GHKELEISLKYY-----EG-------TPVIRELARVSKPGRRVYAGAK
RS8_HYPNA       E-KS--------GHKTLEIELKYY-----EG-------QPVISEIKRVSKPGRRVYSSVS
RS8_NOVAD       TTGV---------HPQLRIELKYF-----EG-------QPAIKHVARVSKPGRRVYSGSK
RS8_SPHAL       ALGAK------GQHKGIRIELKYF-----EG-------QPAIRHVARVSKPGRRVYSGSK
RS8_ZYMMO       KLGN---------HDALRIELKYF-----EG-------QPAIHHLARVSKPGRRIYSGSR
RS8_GRABC       ELRP--------GISQLRVELKYN-----DG-------EPVIKEITRVSKPGRRVYSKIK
RS8_GLUOX       ELRK--------GVAQLRIELKYV-----EG-------QPVIKEIHRVSKPGRRVYSKIK
RS8_MAGSA       ELRP--------GVAQLSIELKYH-----EG-------QPVIREISRVSTPGRRVYSKIA
RS8_RHORT       DVRK--------GIAELRVELKYH-----EG-------EPVIREIARVSTPGRRVYSKIK
RS8_RICBR       PKDN---------ISYTEVTLKYSA----NG-------DASICEIHRVSKPGKRVYSAIK
RS8_KORVE       EEE---GKK------LIRVYLKYGS----DN-------VSPISNVTRISRPGCRVYVGSK
RS8_SOLUE       EEG---AKK------TIKIYLKYAN----NN-------SPVISAIERVSRPGCRVYVGQT
RS8_BDEBA       KDS---KQG------IMRVYLKYDE----AG-------GHAINNIDRVSRPGRRVYVKSD
RS8_SYNFM       KDD---KQG------IIRVQIKYGE----HR-------EGAITGIKRVSRPGCRVYVGHD
RS8_GEOMG       ADN---KQG------VLRVYLRFID----EK-------EPVIREIKRVSKPGSRVYVGSD
RS8_GEOSL       ADS---RQG------VLRVYLKYID----EK-------DPVINEIKRVSKPGSRVYVGSD
RS8_PELPD       SDN---LQG------ILRVYLKYID----DK-------DGVINEIKRISKPGGRVYVKAD
RS8_PELCD       SDD---KQG------ILRIYLKFDN----EN-------KHIIHAIDRVSTPGCRVYVGKD
RS8_SALRD       DDE---KQG------LLRVYLKYDE----YD-------QPAIRMLERVSRPGRREYADSD
RS8_ANADE       EDG---VQG------AITIVLKYSA----DR-------EPAISDIKRVSKPGLRRYVATD
RS8_MYXXD       EQT---VQNKRTVFPEISVQLKYGP----DR-------APAITGIRRVSKPGLRRYAAAR
RS8_ARTS2       DAE----VG-----KKLTLELKFGP----NR-------ERSIAGVRRISKPGLRVYAKST
RS8_STRCO       DAE----VG-----KNLTLELKFGP----NR-------ERSIAGIKRISKPGLRVYAKST
RS8_LEIXX       DAR----VG-----QTLTLSLKFGP----NR-------ERSIAGIKRVSKPGLRVYAKST
RS8_FRACC       DATSAGGVG-----HTLVIDLKYGP----NR-------ERSIAGIKRISKPGLRVYAKAT
RS8_MYCLE       DAR----VG-----KSLIIQLKYGP----SR-------ERSIAGLRRVSKPGLRVYAKSI
RS8_NOCFA       DAQ----VG-----KTLVVDLKYGP----SR-------ERSLAGVRRVSKPGLRVYAKST
RS8_SACEN       QGE----KG-----QNLVVELKYGP----NR-------ERSIAGLRRVSKPGLRVYAKST
RS8_THEFY       DAR----VG-----KNLVVTLKYGP----TR-------ERAIAGLRRVSKPGLRVYAKKD
RS8_ACIC1       PVPGHA-TA-----KNLVITLKYGP----NR-------ERSISGVRRVSKPGLRVYAKAE
RS8_NOCSJ       EPAEGE-VG-----KTLTITLKYGR----NR-------ERSIAGVRRISKPGLRVYAKHT
RS8_CUTAK       EPKEGE-VG-----KTLTLTLKYGE----NR-------ERSIAGVRRISKPGLRVYAKST
RS8_CORDI       DAK----VG-----KTLTLDLKYGP----NR-------QRSIEGVRRVSKPGLRVYAKST
RS8_CORJK       DAK----VG-----KTLDIELKYGP----SR-------ERSISGLRRVSKPGLRVYAKSN
RS8_BIFLO       EAK----VG-----QTLEVTLKYGP----NG-------ERSIQGIKRISKPGLRRYAKSD
RS8_TROWT       DEH----PG-----QLLVIELKYGP----DK-------SRALVGLKRVSKPGLRVYAKSS
RS8_RUBXD       GSG----PQ-----QRIVIELKYGP----DG-------ERAITGLRRMSRPGRRVYRKQK
RS8_LISMO       ED----DNA-----GTIRVFLKYGA----TG-------ERVITGLKRISKPGLRVYAKST
RS8_BACSU       ED----SKQ-----GIIRVFLKYGQ----NN-------ERVITGLKRISKPGLRVYAKSN
RS8_GEOKA       ED----NKQ-----GILRIFLKYGP----NN-------ERVITGLKRISKPGLRVYVKAH
RS8_BACHD       ED----SKQ-----GVIRIFLKYGS----SN-------ERVITGLKRISKPGLRVYAKAG
RS8_PEDPA       ED----DKQ-----GIIRVFLKYGK----NN-------ERVISGLKRISKPGLRSYVKSD
RS8_ENTFA       ED----DKQ-----GVIRVFLKYGK----NE-------ERVITNLKRISKPGLRAYVKAD
RS8_LACP3       DD----DKQ-----GVIRIFLKYGK----NN-------ERVISGLKRISKPGLRSYVKSD
RS8_LACSS       ED----DKQ-----GIIRVFLKYGK----NN-------ERVISGLKRISKPGLRNYVKAN
RS8_STAS1       ED----DKQ-----GVIRLFLKYGQ----NN-------ERVITGLKRISKPGLRVYAKAN
RS8_OCEIH       ED----NKQ-----GVLRIFLKYSA----NE-------DKVISGIKRISKPGLRVYAKAD
RS8_STRA5       ED----DKQ-----GIIRVFLKYGQ----NG-------ERVITNLKRISKPGLRVYTKHE
RS8_STRMU       ED----DKQ-----GIIRIFLKYGQ----NG-------ERVITGLKRISKPGLRVYTKRE
RS8_LACLA       ED----NKQ-----GVIRVFLKYGK----NG-------EKVITNLKRISKPGLRVYVKSD
RS8_LACDB       ED----GKQ-----GVIKITLKYGP----NG-------ERVISGLKRISKPGLRNYVSAD
RS8_LACAC       DD----NKQ-----GVIKVFLKYGP----NG-------ERVISGLKRISKPGLRNYVSAE
RS8_LEUMM       DD----NKQ-----GVIRVFLKYGE----DR-------NRVITGIQRISKPGLRKYAKAE
RS8_OENOB       DTP---NKQ-----GLISLSLKYGP----NR-------ERIITGLKRISKPGLRSYVQAD
RS8_CLOD6       ED----GKQ-----GIIRIQLKYGQ----EG-------ERVITGLKKISKPGMRVYAANH
RS8_HUNT2       DD----GKQ-----GVLRLKLKYTA----NK-------QNVISGLKRISKPGLRVYAGKS
RS8_CLOPE       ND----GVV-----PMMRLTLKYGA----NN-------ERVITGLKRISKPGLRVYCKKD
RS8_CLOAB       ND----GVV-----PMLRLSMKYGK----GK-------ERIVTGLKRISKPGLRVYCRKE
RS8_CLONN       AD----GAV-----PMIRLSLKYN-----GK-------ERIITGLKRISKPGLRVYCKKD
RS8_CLOTE       ND----GAV-----PMLKITMKYGQ----NK-------ERVITGLKRISKPGLRVYCRKD
RS8_CALS4       DD----GKG-----GILKITLKYGP----NK-------ERVISGLKRISKPGLRVYAKHD
RS8_MOOTA       ED----NKQ-----GILRLYLKYGP----NK-------EKVITGLKRISCPGLRVYAKKG
RS8_CARHZ       ED----GKQ-----GILRIFLKYGP----NK-------ERVISGLKRISKPGLRVYAKKD
RS8_SYNWW       ED----GKQ-----GIIRIYLKYGP----DK-------KKVITGIKRISKPGLRVYVKKD
RS8_DESHY       SD----NKQ-----GVIRCYLKYGQ----NR-------ERVITGLKRISRPGLRVYAKKD
RS8_SYMTH       DN----GHQ-----GVIRIYLKYGP----NK-------TRVISGLRRISKPGLRVYAKRD
RS8_DEIRA       RP--EGQKF-----DVLRVTLKYGE----KR-------EQVIKHIERVSRPGRRAYVSAE
RS8_THET8       DV--DGK-------PYLRVYLKYGP----RRQGPDPRPEQVIHHIRRISKPGRRVYVGVK
RS8_THEMA       E---DGKQ------GILRVYLKYKG----GRKNR----ERVIHGIVRVSHAGRRIYVDKD
RS8_RHOBA       KL--EEEPV-----GYLRLELKYGP----NG-------ERVIQSIRRISKPGRRLYSRSK
RS8_MYCMS       G----------DVKKTINIELKYQ-----GKT-------RVIQGLKKISKPGLRVYAQAN
RS8_MESFL       G----------EVKKTITIELKYQ-----GKQ-------RVISGLKKISKPGLRVYAPAN
RS8_ONYPE       -----------QSSREIIISLKYAP----NKE-------RVIKGLKRVSKPGLRVYASAE
RS8_FUSNN       TDE--------GNKKNIRVYLKYA-----GKE-------RVIKGLKRISKPGRRVYSSVD
RS8_MYCMO       GDS---------VKKNLNVTLKYK-----NNI-------SVITGVKRISKPGLKVYSSVE
RS8_MYCPU       GQG---------IEKKILITLKYK-----GNT-------SAIFDLKRISKPGLRVYTTAS
RS8_MYCHJ       GD----------LKKNITVELKYK-----GNL-------SSISGLKRISKPSLRVYTSAS
RS8_MYCS5       GSK--------KTDKRLLVTLKYK-----GKQ-------SAIVGIKRVSKPGLRVYVKSE
RS8_MYCPN       ENKS-------KTKRIVTFNLKYTQ----RRI-------PSINGVKQISKPGLRIYRPFE
RS8_MYCGA       DNKE-------KTKSILKIKLKFDE----NRV-------SSLNGIKQISKPGLRIYVSAE
RS8_MYCPE       SIG--------KNKNQTVVNLKYRN----NV--------SSITGLKQISKPGLRIYSEAQ
RS8_UREPA       PTE--------NNKSETVVKLKYKN----QTT-------SSINGFKQISKPGLRIYSTHL
RS8_CYTH3       ESAV---------QGSIKIALKYHP----LTK------ESAIVKIERISKPGLRKYTHAE
RS8_GRAFK       DTTA---------QGTIKIALKYDK----LTK------EPVIKKIQRISKPGLRKYAGST
RS8_BACTN       EDGP---------QGTIKVALKYDS----VNK------VNAIKKLERVSSPGMRKYTGYK
RS8_PORGI       ENDS---------QGIIKVALKYDL----AHK------VNAIKKLKRVSRPGLRKYVGYR
RR8_HELSJ       SKKYIK-------LEGLKFYNKKSD----HTL------FNFFKNCQRLSKPSNRLYIKAG
RR8_BIGNA       CKKKKRE------YKYIKVYLKYNE----QTS------KSFIRNICRLSKPSLRVYTNSK
RR8_CYACA       FERK---------SGYLLVSLKYNS----LNQ-----DKPCLSVLKKISRPGLRMYVRTK
RR8_DAUCA       KE--TKK-------DFLVLTLRHRR--NRKR------SYRNFLNLKRISRPGLRIYSNYQ
RR8_LACSA       RE--NNK-------SFLVLTLRHRR--NRKR------TYRNLLNLKRISRPGLRIYSNYQ
RR8_CITSI       VENKNKK-------EFLVLTLRHRR--NRKG------PYRPILNLKRISRPGLRIYFNYR
RR8_SPIOL       QE-RNK--------YFLVLTLRHRR--NKKG------PYLNTFHLKRVSRPGLRIYSNYQ
RR8_COFAR       RE--NNK-------YFLVLTLRHRR--NRKG------PHRNIFNLKRISRPGLRIYANSQ
RR8_EPIVI       RE--KNK-------YYFTLTLRHRR--NSKR------PYINILNLKRISRPGLRIYSNSQ
RR8_LEPVR       RE--NNQ-------YFLILTLRHKR--NKKE------SYKTILNLKRISRPGLRIYSNSQ
RR8_LOTJA       RE--SDK-------SFLVLTLRYRR--NTKG------SYKTFLNLKRISTPGLRIYYNYQ
RR8_CUCSA       RE--SNK-------DFWVLTLRHRR--NRKG------PYKTILNLKRISRPGLRIYSNYQ
RR8_MORIN       QE--SNN-------LFFVLTLRHRRKRNRKG------PDKTVLNLKRISRPGLRIYSNYQ
RR8_PLAOC       RE--SNK-------YFLVSTLRHRR--NRKR------PYKTI--LKRISRPGLRIYSNYQ
RR8_DRIGR       RE--NNK-------YLLILTLRHRR--NRKG------TYRNI--LKCISRPGLRIYSNYK
RR8_AMBTC       RE--NNK-------NFLVLTLRHKR--NRKG------TYRKT--LKRISRSGLRIYSNYQ
RR8_NYMAL       RE--NNK-------DFLVLTLRHRR--NRKR------AYRNI--LKRISRPGLRIYSNSQ
RR8_ACOCL       RE--SNK-------DFLVLTLRHRR--TRKG------IYRTI--LKRISRPGLRIYSNYQ
RR8_PIPCE       RE--NQK-------NFLVSTLRHRR--NRKG---TSRTILNL---KRISRPGLRIYSNYQ
RR8_OENEH       QE--NKK-------SFLVLTLRHRR--NRKGPS-PSRTFLNLN-LKRISRPGLRVYSNYQ
RR8_PHAAO       QE--SQK-------NFLVSTLRHRK--TRKG---------NKINLKRISRPGLRIYSNYQ
RR8_SACHY       QE--SNR-------YFLVLTLRHQRRKTRKG------IYRTRTFLKRISRPGLRIYANYQ
RR8_PELHO       RE--SKK-------SFLVLTLRHRR--NRKG------PSRTLFNLKRVSRPGLRIYSNYQ
RR8_JASNU       RE--KNK-------SFLILNLQWNR--KRLH------KNLFSFKLKRISRPSLRIYSNSQ
RR8_ADICA       TE--GGK-------IFMDVKLRYFG--KEKK--------PYVATIRYISKPGLRIYCDHI
RR8_MARPO       KQNTKD---------ILILNLKYQG---KKK-------KSYITTLRRISKPGLRIYSNHK
RR8_PHYPA       EESKNC---------FLIFTLKYQG---KKK-------KPYITTLRRISKPGLRIYSNHK
RR8_ANTAG       QENKNS---------FLIFILKYRG---KKR-------KPYITTLRRISKPGLRIYSNYQ
RR8_HUPLU       REGTNH---------FMILTLKYRG---RKR-------EPYITTLRRISKPGLRLYYNYK
RR8_PINTH       QEGQKY---------FLISTSKYRR---RKK-------RTYMTTSKRTSKPGLRIYSNYR
RR8_CHAGL       EENNKN---------FLILTLRSQR---RKH-------KASITTIRRISKPGLRIYSNHQ
RR8_CHAVU       VISDKNY-------SLLTLTLKYQG---RTR-------EPYITTLRRISKPGLRSYSSYQ
RR8_STAPU       QEDTKR---------LLVITLRYQG---RKR-------KPYITTVKQISKAGLRVYSNHK
RR8_ZYGCR       QYNAIR---------MLVITLKYQT---KTR-------KPHITIIKYISKPGLRVYSNHQ
RR8_PSINU       EKRTRS---------FFILTLKYQG---RVR-------KPHITAFKRISKPSLRIYSNYQ
RR8_SELUN       RQGTNR---------FPVSTSKYQG---RTR-------KARITTRRRVSKPGLRIYPGYK
RR8_CHLAT       ET-DSGL-------SSLLITLKYQG---KRR-------KPYITALKRISKPGLRVYANSR
RR8_MESVI       TN-SSNN-------PELILSLKYQG---KKR-------KPYITALQRVSKSGLRVYTSYK
RR8_CHLVU       ET-NTN---------ELIVDLKYQD---FASFGNYGVGKPCITNLKRISKPGLRIYTNSR
RR8_OLTVI       VN-STE---------ELALQLKYKG---RER-------KPCITNLRRISKPGLRIYASYK
RR8_TETOB       EE-DSK---------MLVLKFKYRS---KKT-SNAKTKESCITNLKRISKPGLRIYTNSQ
RR8_TUPAK       TN-SLQ---------KLEITLKYLG---NQK-------KPGITNLKRLSWPGLRFYSNYK
RR8_NEPOL       SV------------NSLILRLKYRG---AKQ-------QPILTGLRRVSRSGCRVYVSAK
RR8_OSTTA       EN------------GFFTVNLKRGV----KQ-------------FERVSTPGVRVYANHK
RR8_EUGLO       LNSSDRMSNRRFIQKYIIVNLKYKG---ERR-------SPCIKELRRISKPGRRVYVGYK
RR8_EUGGR       LADATCLTENGVIKKYITIFLKYKG---PKQ-------VSYITKIKRVSKPGLRTYSSYK
                                                                * .. : .    

RS8_PROMA       GLPKVLGGLGVAIISTSKGVMSDRDARKQGVGGEVLCYVY--
RS8_PROMT       GLPKVLGGLGIAIISTSNGVMSDRDARKQGVGGEVLCYVC--
RS8_PROMP       GLPKVLGGLGVAIVSTSKGVMSDRDARKQGIGGEVLCYVY--
RS8_SYNP6       DLPRVLGGIGIAIISTSQGIMTDRDARRQGVGGEVLCYVW--
RS8_THEEB       ELPRVLGGIGIAIISTSNGIMTDREARKQGIGGEVLCYVW--
RS8_TRIV2       ELPRVLGGIGIAIISTSSGIMTDREARRQNLGGEVLCYVW--
RS8_TRIEI       ELPRVLGGIGIAIISTSSGIMTDREARKRGIGGEVLCYVW--
RS8_SYNJA       ELPRVLGGIGIAIISTSNGIMTDRDARKQGIGGEVLCYVY--
RS8_SYNY3       KIPRVLGGIGIAIVSTSHGIMTDREARRQGIGGEILCYIW--
RS8_GLOVI       ELPRVLGGIGIAIISTSQGVMTDRDARRAGVGGEVLCYVF--
RR8_PYRYE       ELPRVLGGLGIALISTSRGVMTDRQARHDGLGGEILCYIW--
RR8_GRATL       ELPKVLGGIGIAIISTSKGVMSDYHARHYGLGGEILCYIW--
RR8_CYAPA       ELPRVLGGLGIAILSTSSGIMTDQTARHKGCGGEVLCYIW--
RR8_GUITH       ELPRVLGGLGIAVISTSKGVLTDTKARTQGLGGEVLCYIW--
RR8_EMIHU       KMPRVLGGFGTAIISTSNGLMTDTEARQKNVGGEILCYIT--
RR8_TRICV       KLPKVLDNLGIAIISTSKGVMTNLKAKELGIGGEVLCYIW--
RR8_PHATC       KLPRILDNLGIAIISTSKGVMTNLKAKELGIGGEVLCYIW--
RR8_THAPS       TLPLVLNGLGIAIISTSKGVMTNRKAKSLGIGGEVLCYIW--
RR8_CYAM1       NMPKVL---GMLIISTSKGVMTHQKAKQMQVGGEILCGVY--
RS8_POLSJ       AIPQVMNGLGVAIVTTPQGVMTDRKARATGIGGEVLCYVA--
RS8_METPP       EIPQVMNGLGVAIVTTPKGVMTDRKARAAGIGGEVLCYVA--
RS8_RHOFT       AIPQVQNGLGVAIVTTPKGVMTDRKARATGVGGEVLCYVA--
RS8_BORA1       NIPQVMNGLGVAIVSTSRGVMTDRKARANGVGGEVLCYVA--
RS8_PARXL       DIPVVMNGLGVAIVSTPKGVMTDRKARATGVGGEVICYVA--
RS8_RALSO       EIPQVMNGLGVAIISTPQGLMTDRRARATGVGGEVICYVA--
RS8_AZOSB       DLPRVMNGLGVAIVSTPKGVMTDRAARASHVGGEVICLVA--
RS8_AROAE       DLPRVMNGLGVAIVSTPRGVMTDRAARAGRVGGEVICYVA--
RS8_DECAR       DIPRVMNGLGVAIVSTPKGVMTDRKARASKVGGEVLCIVA--
RS8_NITMU       KLPNVMNGLGVAIVSTSKGVMTERKARANGVGGEVLCIVA--
RS8_THIDA       DLPRVKNGLGVAIVSTSSGVMTDRHARAKGVGGEVLCFVA--
RS8_METFK       EIPVVMHGLGVTIVSTSKGVMTDRKARDAGVGGEVLCVVA--
RS8_NEIMF       EIPSVMNGLGIAIVSTSKGVMTDRKARSQGVGGELLCIVA--
RS8_CHRVO       EIPKVMNGLGVAILSTSKGVMTDRKARAAGIGGELLCVVA--
RS8_ALKEH       SLPRVRNGLGVAIVSTSKGVMTDRAAREAGHGGEVLCYVF--
RS8_HALHL       ELPRVRNGLGTAIISTSKGVMSDGQARAQGHGGEVLCWVF--
RS8_NITOC       KLPRIRGGLGIAIVSTSRGVMTDKTARSIGEGGEVLCYVA--
RS8_HAES1       ELPKVMGGLGVAVVSTSKGIMTDRKARQAGLGGEIICYVA--
RS8_HAEDU       ELPKVMGGLGIAIVSTSKGVMTDRAAREEGLGGEIICYVA--
RS8_ECOLI       ELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYVA--
RS8_AERHH       DLPKVMGGLGVAIVSTSKGVMTDRAARKASMGGEIICYVA--
RS8_SHELP       DLPKVMGGLGVAIVSTSKGLMTDRAARQQGMGGEVICYVA--
RS8_SHEAM       ELPKVMGGLGIAIVSTSKGLMTDRAARLAGMGGEVICYVA--
RS8_PSEA6       ELPKVLGGLGVAIVSTSKGVMTDRAARKAGMGGEIIGYVA--
RS8_PSEHT       ELPKVMGGLGIAIVSTSKGLMTDRAARSAGVGGEIIGFVA--
RS8_ALIF1       ALPSVMGGLGIAVVSTSKGLMSDRAARKAGLGGEIICYVA--
RS8_PHOPR       ALPSVMGGLGIAVVSTSKGLMTDRAARKAGLGGEIICYVA--
RS8_IDILO       ELPNVMGGLGIAVVSTSKGLMTDRAARQAGLGGEIIGYVA--
RS8_PSYIN       DLPKVMAGLGIAIISTSHGVMTDRAARKASIGGEIICYVS--
RS8_COLP3       ELPKVLAGMGIAIISTSKGLMTDRAARSAGIGGEVLGFVE--
RS8_SACD2       ELPSVRGGLGIAIVSTSKGVMTDRAARAAGVGGEILCTVF--
RS8_HYDCU       ELPKVIGGLGVAVVSTSKGIMSDRDARKAGIGGEIICYIA--
RS8_CHRSD       ALPKVADGLGIAIVTTSQGVMTDRAARQAGVGGEVICTVF--
RS8_MARHV       ELPKVAGGLGVAIVSTSRGVMTDRAARAAGVGGEVICTVF--
RS8_HAHCH       DLPTVNGGLGIAIVSTSKGVMTDRAARKAGVGGEVICTVF--
RS8_PSESM       DLPKVRGGLGVSIVSTSKGVMTDRAARAAGVGGEVLCTVF--
RS8_ALCBS       EIPKVKDGLGVMIVSTNQGIISDRAARKANIGGELICEVS--
RS8_PSYA2       AIPTVKQGMGVAIVSTSQGIMSDRAARAAGIGGEIVAFVA--
RS8_ACIAD       KIPSVKQGLGIAIVSTSKGIMTDRAARAAGIGGEVIAFVS--
RS8_XANC5       ELPKVLGGLGIAIISTSKGIMTDAQAREAGVGGEVLCFVA--
RS8_XYLFT       ELPEVLGGLGVSIISTSKGIMTDSKARESGVGGEVLCFVA--
RS8_BAUCH       ALPNIMGGMGIAIISTSKGIMTDYTARQAGLGGEIICHVA--
RS8_WIGBR       HLPNVMSGMGIAIVSTSRGIMTDKLARTYNLGGEIICYVE--
RS8_BUCAI       NLPKVMSGLGIAVISTSKGVMTDRMARQEGLGGEVICYVA--
RS8_BUCAP       NLPTVMAGLGIAIISTSQGIMTDRKARRLGLGGEVICYVA--
RS8_BUCBP       KLPQVMSGLGIVIISTSQGVLTDQVARKKGLGGEIICNVS--
RS8_BUCCC       NLPIVMNNLGIAIISTSRGVMTDRIAREKGLGGEIICYVD--
RS8_BLOFL       MLPKVLSGMGVVVVSTSKGVMTDKKARKLNVGGEIICYVS--
RS8_BLOPB       ELPQVMSGMGIIIISTSKGVITDNRARQLNVGGEIICYVS--
RS8_FRATN       DLPKVYGGYGVAIVSTSKGLVSDRKARDLGVGGEIIGYVA--
RS8_LEGPA       DLHSI-PGFGVAILSTSKGIMTHVSAKVKGVGGEVICEVA--
RS8_NITEC       NLPKVMHGLGIAIVSTSKGVMTERSARAGGVGGELLCIVA--
RS8_NITEU       DLPRVMNGLGVAIVSTSKGVMTERTARMAGVGGELLCVVT--
RS8_METCA       ELPKVMGGFGIAIVSTSKGVMSDRRARSVGEGGEVLCVVE--
RS8_COXBU       ELPKVKNGLGIAIISTSKGVMSDRQARRLGEGGEVLCYVS--
RS8_MAGMM       EIPSVYQGLGIAILSTSKGVISSRRALELGVGGELLCTVY--
RS8_RUTMC       QMPSVMNGLGIVIVSTPKGVMTGQTAYEQNIGGEVLCSVY--
RS8_DESVH       EIPKVQNGLGICILSTSRGVMDGNSAHESKVGGELLCEIW--
RS8_DESAG       DIPRVQNGLGICILSTSSGVLEGTNARSKNVGGELLCEIW--
RS8_LAWIP       DIPSVQNGLGICILSTSIGVIGCNKARCSKVGGELLCEVW--
RS8_CHLAB       KIPYVFGNMGISVLSTSQGVLDGSTARAKNIGGELLCLVW--
RS8_CHLPN       KIPYVFGNMGISVLSTSQGVMEGSLARSKNIGGELLCLVW--
RS8_CHLMU       KIPYVFGNMGIAVLSTPQGVLEGSEARAKNVGGELLCLVW--
RS8_PARUW       DIPRFYGNMGLSIVSTSQGVMAGNEATQRGIGGELLCLIW--
RS8_DEHMC       EIPRVYGGLGVAIVSTSKGVMTGSQAWRQGLGGELLCKVW--
RS8_NEOSM       EIPKFYGGLGISVLSTSKGILPSYKAVSSNCGGELLFGVY--
RS8_PELLD       -IKKYLGGLGLYILSSSKGVITDKEAREQGVGGEILFRIY--
RS8_CHLPD       -IKKYLGGLGLYILSSSKGIITDKEARAQGVGGEVLFRIY--
RS8_CHLTE       -IKRYLGGLGLFILSTSKGILTDKEAREQNVGGEVLFRIY--
RS8_CAMJR       EIKRFKNGYGTIVVSTSHGVLANDEAYKAGVGGEILCTIW--
RS8_CAMFF       EIKRFKNGYGTIIVSTSKGVLSNDEAHKAGVGGEVLCTVW--
RS8_SULDN       EIKRFKNGYGTIIVSTSHGVLPNDKAYALGVGGEVMCTVW--
RS8_HELHP       ELKRFKNGYGTIVVSTSKGVVANDEAYKANVGGEALCSIW--
RS8_WOLSU       ELKRFKNGYGTIVVSTSKGVIGNEEAYKANVGGEALCSIW--
RS8_HELAH       ELKRFKNGYGVIVVSTSKGVITNEEAYRQNVGGEVLCSIW--
RS8_TREDE       SLPRVFNGYGTLIVSTSKGIITGKAAGESQVGGELICKVW--
RS8_TREPA       TLRRVYNGYGTLIVSTSLGVTTGRHAREQRVGGELICKVW--
RS8_BORBU       NMPRIKNGYGILIISSSQGVITGKEAKDKKIGGELICSVW--
RS8_LEPIC       EIRPYKNNIGTLIVSTSKGIMTGKNARKLKLGGEVILKMS--
RS8_SYNAS       EIPKVLNGYGVAIISTSKGVITDKEAREKSVGGEVLCKVW--
RS8_ANAPZ       KMPRFYNALGIYIVSTSKGIMLDSHARNAGVGGEILCGVF--
RS8_ANAMM       RLPKFYNGLGVYIVSTSQGVMLDYRARKLGIGGEILCGVF--
RS8_EHRRW       GMPKFYNGLGLYIISTSKGIMSDYNARKSGVGGEILCGVF--
RS8_WOLTR       DISKAYNGLGIFIISTSKGVMTDYDAHKLKFGGEILCRVF--
RS8_WOLPM       DISKAYNGLGIFIISTPKGVMTDYNAHKLKVGGEVLCRVF--
RS8_PELUB       SLPKINGGLGIAIVSTPKGVMTDIEARKQKVGGEIICKVF--
RS8_BARQU       SLPQVANGLGVSILSTPKGIMADHEAREQNVGGELLCRVF--
RS8_BARBK       SILQVANGLGISILSTPKGVMTDHEAREQNVGGELLCRVF--
RS8_CHESB       SIPHVANGLGIAILSTPKGVMADHEAREKNVGGEFLCQIF--
RS8_RHILO       SIPHVANGLGIAILSTPKGVMADHEAREQNVGGEILCQIF--
RS8_BRUME       SIPQVVNGLGISILSTPKGVMADHEAREQNVGGELLCRIF--
RS8_RHIME       SIPQVANGLGITILSTPKGVMADHQAREQNVGGEVLCSIF--
RS8_RHOPB       NLPRVNNGLGISVLSTPKGIMADHEARDANVGGEVLFTVF--
RS8_CAUVC       DLKPIKNGLGISILSTPKGVMSDTAARDANVGGEVLCRVY--
RS8_MARMM       DLPLVQNGLGIAILSTPKGVMSDSTARESNVGGEILCHVS--
RS8_RUEST       DIPSVRQGLGVSIVSTPKGVMSDANARAANVGGEVLCTVF--
RS8_RUEPO       DIPSVRQGLGVSIVSTPKGVMSDANARSNNVGGEVLCTVF--
RS8_JANSC       DIPQVRQGLGVSIVSTSKGVMSDANARSQNVGGEVLCTIF--
RS8_RHOS4       DLPSVRNGLGVSIISTPKGVMSDASARSANVGGEVLCTVF--
RS8_PARDP       ELPQVRNGLGVSIVSTPKGVMSDAAARSANVGGEVLCTVF--
RS8_HYPNA       DIPLVRNGLGISILSTSQGVMSDNAARAKNVGGEVLCRVF--
RS8_NOVAD       ELPVIRNGLGITIVSTPKGVLSDAEARAANVGGEVLAEVF--
RS8_SPHAL       ELPIVRNGLGITIVSTPRGVLSDAEAREQNVGGEVLAEVF--
RS8_ZYMMO       ELPRVRNGLGITIVSTPKGVLSDAEARDQNVGGEVLAEVF--
RS8_GRABC       ELPRVYAGLGVSILSTPRGVLSDNEARAANVGGEVLCRVF--
RS8_GLUOX       ELPRVYAGLGVSILSTPRGVLSDVEARAANVGGEVLCRVF--
RS8_MAGSA       DLRRVANGLGITILSTPRGVMSDTEARTQNVGGEVLCEVF--
RS8_RHORT       DLPKVYNGLGISILSTPRGVMSDHEARQANVGGEVLCRVF--
RS8_RICBR       DLKGYYNNMGIYILSTPYGVMSDREAHIKNVGGEVICKVF--
RS8_KORVE       EIPRVLGGLGISILTTPKGVMTGRQARKEGVGGEVLCEIY--
RS8_SOLUE       DIPRVLGGMGINILTTPRGVMTGRDAHKEHLGGEILCRVW--
RS8_BDEBA       KIPTVRSGMGMSIISTSKGIMSGKQATEQKLGGELLATLW--
RS8_SYNFM       EIPRVMNGMGIGIVSTSKGIMTDRQARKEGIGGELLCSIW--
RS8_GEOMG       EIPSVKSGMGVAILSTSKGILTDKVAREAGVGGEVICTVW--
RS8_GEOSL       KIPSVKNGMGVAILSTSKGLITDKSAREAGVGGEVLCTVW--
RS8_PELPD       EVPTVKSGLGVVILSTSKGIITDSAARKAGLGGEIICTVW--
RS8_PELCD       EIPVVKNGLGNAILSTSKGVMHDAAAREAQLGGEVLCSVW--
RS8_SALRD       NLPEVKNGLGIVILSTSRGVMSDKEARRFGVGGEVLAKVF--
RS8_ANADE       SIPRVLNGMGIAILSTSKGVMVDREARKQKVGGELICTVW--
RS8_MYXXD       EIPQVLGGLGISILSTSRGIMVDSEARKQKVGGELLCTVY--
RS8_ARTS2       NLPHVLGGLGVAILSTSSGLLTDKQAGKKGVGGEVLAYVW--
RS8_STRCO       NLPKVLGGLGVAIISTSHGLLTDKQAGKKGVGGEVLAYVW--
RS8_LEIXX       ELPKVLGGLGVAILSTSSGLLTDRQAEKKGVGGEVLAYVW--
RS8_FRACC       NLPKVLGGLGVAIISTSSGLLTDKQAGKRGVGGEVLAYIW--
RS8_MYCLE       NLPRVLGGLGVVIISTSSGLLTDRQAARQGVGGEVLAYVW--
RS8_NOCFA       NLPKVLGGLGVAIISTSQGLLTDKQAAKQGVGGEVLAYVW--
RS8_SACEN       NLPKVLGGLGIAIISTSGGLLTDRQAIKQGVGGEVLAYAW--
RS8_THEFY       NLPRVLGGLGVAIISTSSGLMTDKEAKKNGVGGEVLAYVW--
RS8_ACIC1       NLPRVLGGLGIAIISTSAGLLTDRQCAKRRIGGEVLAYVW--
RS8_NOCSJ       GLPKVLGGLGVAIISTSQGLLTDRQANQKGVGGEVLAYVW--
RS8_CUTAK       ALPKVLGGLGIAIISTSQGLLTDKQAHEKSVGGEVLAYVW--
RS8_CORDI       NLPQVLGGLGVAIISTSHGLLTDRQATEKGVGGEVLAYVW--
RS8_CORJK       ELPQVLGGLGVAIISTSHGLLTDREAQNKGVGGEVLAYVW--
RS8_BIFLO       SLPMPLGGLGIAIISTSSGLLTQKECLDRGIGGEIVAFVW--
RS8_TROWT       NLPEVFGGLGIAILSTSSGLLTCSQARKKGVGGEVLAYAW--
RS8_RUBXD       DIPRVLDGLGVAILSTSQGILTDHEARRKGVGGEVLCFVY--
RS8_LISMO       EVPKVLNGLGIAIVSTSQGVLTDKEARAKQVGGEVLAYVW--
RS8_BACSU       EVPRVLNGLGIAIISTSQGVLTDKEARAKQAGGEVLAYVW--
RS8_GEOKA       EVPRVLNGLGIAILSTSQGILTDKEARQKGTGGEVIAYVW--
RS8_BACHD       ELPRVLGGLGIAIVSTSKGVMTDKEARQQQVGGEVLAYVW--
RS8_PEDPA       EVPKVLNGLGIAIISTSEGVITDKEARAKKIGGEVLAYIW--
RS8_ENTFA       EVPKVLNGLGIAIISTSEGVITDKEARAKNIGGEVIAYVW--
RS8_LACP3       AVPKVLNGLGIAIISTSEGVITDKEARAKNVGGEVLAYVW--
RS8_LACSS       EVPKVLNGLGIAIISTSNGVVTDKEAREKAAGGEVLAYVW--
RS8_STAS1       EVPKVLNGLGIALVSTSEGVVTDKEARKRNIGGEILGYIW--
RS8_OCEIH       EVPRVLNGLGIAIVSTSNGLLSDKEARSQAVGGEVLAYVW--
RS8_STRA5       DMPKVLNGLGIAIVSTSEGLLTDKEARQKNIGGEVLAYIW--
RS8_STRMU       DVPKVLNGLGIAIISTSEGLLTDREARQKNIGGEVITYVW--
RS8_LACLA       DIPKVLNGLGTAIISTSTGVVTDKVARETNVGGEVIAYIW--
RS8_LACDB       NLPKVLNGLGIAIVSTSAGILTDKEAREKNVGGEVIAYVW--
RS8_LACAC       DLPKVLNGLGIAIVSTSAGVITDKEARQKNVGGEVVAYVW--
RS8_LEUMM       ELPKVLNGLGIAIISTSAGVITDKEARSKQVGGEVIAYVW--
RS8_OENOB       SVPKVLNGLGIAILSTSEGVMTDKAARAKMIGGEVIAYVW--
RS8_CLOD6       EIPKVLNGLGISVISTSKGILTDKQARKENVGGEVICYVW--
RS8_HUNT2       EIPKVLGGLGIAIISTSKGIMTDKKARAEGVGGEVLAFVW--
RS8_CLOPE       EVPRVLNGLGIALISTSKGLVVDREARKLGLGGEVICYVW--
RS8_CLOAB       EIPKVLNGLGIAIISTSKGIVTDKEARKLGLGGEVLCYVW--
RS8_CLONN       NIPKVLNGLGVAIISTSKGIVTDREARKLGLGGEVICYVW--
RS8_CLOTE       EVPKVLNGLGTAVISTSKGILPDKEARKLSIGGEVLCYIW--
RS8_CALS4       ELPRVLGGLGIAIISTSKGIMTDKEARKAGLGGEVICYVW--
RS8_MOOTA       EIPRVLGGLGVAVISTSKGILTDKEARRQGVGGEVICYIW--
RS8_CARHZ       ELPRVLGGLGIAIISTPKGIMTDKKARKEGLGGEVICYIW--
RS8_SYNWW       EIPRVLGGLGTAVISTSKGLMTDKNARKQGLGGEVICYIW--
RS8_DESHY       EVPKVLGGLGVAILSTSKGLMTDKRARQEGLGGEVLCYIW--
RS8_SYMTH       QIPRVLGGLGIAILSTSKGVMTDKQARQQGLGGEVLCYIW--
RS8_DEIRA       NLPRVQRGLGVAVVSTSRGLLPDREARQQGVGGEVVCVLW--
RS8_THET8       EIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW--
RS8_THEMA       HIPKVKNGLGIAILTTSKGVLTDKEARQLGVGGEVIAYVW--
RS8_RHOBA       ELKPVLGGLGIRIISTSKGVISDREARRDKIGGEVLCEVS--
RS8_MYCMS       EIPQVLNGLGISIVSTSQGIMTGKKARLANAGGEVLAFIW--
RS8_MESFL       EIPQVLNGLGIAIVSTSQGIMTGKQARLSNIGGEVLAFVW--
RS8_ONYPE       QIPKVLNGLGVALVSTSKGILTDAQARLSQVGGEVLAYIW--
RS8_FUSNN       DMPRVLSGLGIAIVSTSKGIVTDKVARAEKVGGEVLAFVW--
RS8_MYCMO       DLPMVLNGYGIAIISTSKGVLTDKQARKENVGGEIVAYIW--
RS8_MYCPU       NIPSVLSGYGIAIISTSKGILTDKEARKENVGGEVIAYIW--
RS8_MYCHJ       KIPFVQSGFGIAILSTSKGLLTDSQARKENVGGEIIAYIW--
RS8_MYCS5       EIPKVLSGYGTCIMSTSKGLMTDKEARKANVGGEIIAFIW--
RS8_MYCPN       KLPLVLNGLGIAIISTSDGVMTDKVARLKKIGGEILAYVW--
RS8_MYCGA       KLPKVLNGLGIAIVSTNEGLMTDKLARAKKIGGEVLAYVW--
RS8_MYCPE       KLPKVLNGLGIAIISTSMGLMTDKNAKKNNVGGEVIAYVW--
RS8_UREPA       NLPKVLNGLGIAIITTSKGVMSDKQARKENVGGEVIAYVW--
RS8_CYTH3       TMPRVLNGLGVAIVSTSKGIMSDKEAKNLNIGGEVLCFVY--
RS8_GRAFK       EIPRILNGLGIAVVSTSHGVMTGKQAKANKVGGEVLCYVY--
RS8_BACTN       DMPRVINGLGIAIISTSKGVMTNKEAAELKIGGEVLCYVY--
RS8_PORGI       DMPRVLNGLGIAIVSTPRGVMTDKEARELKVGGEVLCYVY--
RR8_HELSJ       DIPLIDNGLGFVILSTSYGLMTGKKARALNIGGELLCQFNFQ
RR8_BIGNA       KIPRILNGLGIIIVSTSKGVMTSKDAYSNNIGGELLFSIW--
RR8_CYACA       KIPKVLGGTGIAIISTSKGVMTGSIARNLGIGGEILCYIW--
RR8_DAUCA       RIPRILGGMGIVIISTSRGIMTDREARLERIGGEVLCYIW--
RR8_LACSA       RIPRILGGMGIVILSTSQGIMTDREARLERIGGEILCYIW--
RR8_CITSI       RIPRILDGMGIVILSTSRGIMTDRAARLERIGGEILCYIW--
RR8_SPIOL       RIPRILGGMGIAILSTSRGIMTDREARLEGIGGEILCYIW--
RR8_COFAR       RIPRILGGMGIVIFSTSRGIMTDREARLEGIGGEILCYIW--
RR8_EPIVI       QIPLILGGIGIVILYTSRGIMTDREARLKGIGGELLCYIW--
RR8_LEPVR       RIPRILGGIGIVILSTSQGIMTDREARRKSIGGEILCYIW--
RR8_LOTJA       KIPRILGGMGIVILSTSRGIMTDREARLEKIGGEVLCYIW--
RR8_CUCSA       KIPRILGGMGIVILSTSRGIMTDREARLQGIGGEILCYIW--
RR8_MORIN       RIPRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW--
RR8_PLAOC       RIPRILGGIGIVILSTSRGIMTDREARLEGIGGEILCYIW--
RR8_DRIGR       RIPRILGGIGIVILSTSRGIMTDREARLKGIGGEILCYIW--
RR8_AMBTC       RIPRISGGMGVVILSTSRGIMTDREARREGIGGEILCYIW--
RR8_NYMAL       RIPRISGGIGVVILSTSRGIMTDREARLERIGGEILFYIW--
RR8_ACOCL       GIPKILGGIGIVIVSTSRGIMTDREARLQGIGGEMLCYIC--
RR8_PIPCE       KIPRILGGMGIVILSTSRGVMTDREARLEGIGGEILCYIW--
RR8_OENEH       KIPRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW--
RR8_PHAAO       QIPKILGGMGIVILSTSRGIITDREARLEKIGGEILCYIW--
RR8_SACHY       GIPKVLGGMGIAILSTSRGIMTDREARLNRIGGEVLCYIW--
RR8_PELHO       KIPRILGGMGVAILSTSKGIMTDREARLKRIGGEILLYIW--
RR8_JASNU       RIPRIFGGMGIVILSTSRGIMTDREARLHGMGGEILCCIW--
RR8_ADICA       RIPKILGGMGIAILSTSYGLITDREARRRKTGGEILCHIW--
RR8_MARPO       EIPKVLGGMGIVILSTSRGIMTDREARQKKIGGELLCYVW--
RR8_PHYPA       EIPKVLGGMGIVILSTSEGIMTDREAREKKIGGEILCYVW--
RR8_ANTAG       EIPRVLGGTGIVILSTSRGIITDREARQKQVGGEILCYVW--
RR8_HUPLU       KIPKVLGGMGVVIPSTSCGTMTDREARQKQIGGEILCYVW--
RR8_PINTH       EIPKVLGGMGIVILSTSQGILTDREARQKKIGGEILCYVW--
RR8_CHAGL       EIPKVLGGIGIVILSTSQGIMSDRQARQNRIGGEILCYIW--
RR8_CHAVU       DIPKVMGGMGIVILSTSQGIITDRQARQRRIGGEVLCYIW--
RR8_STAPU       DIPRVLGGMGIVILSTSQGIIIDREARDKQIGGEILCYVW--
RR8_ZYGCR       DIPQFLGEMGIVILSTSKGIMMHREARAQKVGGEVLCYVW--
RR8_PSINU       KITRILGGMGIAIISTSSGIMTDREARQKRLGGEIICHVW--
RR8_SELUN       DIPEVSGGIGTATPPTPGGTTTDREARQKRIGGEAPRHVWR-
RR8_CHLAT       EIPRVLGGIGIAIISTSKGIMTDRRARHEKVGGEILCYVW--
RR8_MESVI       DIPKVLGGIGIAILSTSQGILTDKQARMQKIGGEILCYIW--
RR8_CHLVU       EIPKVLGGMGILILSTSKGLMTDRQARKLCLGGEILCSVW--
RR8_OLTVI       NIPKILNGMGVVFVSTSQGLMTDREARYRKLGGEIVCSVW--
RR8_TETOB       DIPRVLGGAGILILSTSVGILTDREARALGVGGEILCSIW--
RR8_TUPAK       DIPPVLNGMGVVILSTSKGIMTDREARANKVGGELLCSIW--
RR8_NEPOL       EVPKVLGGMGTAIISTSKGIMTDREARNHRLGGEVICLIW--
RR8_OSTTA       QLQPVLNGMGVAVISTSQGIMTDRKARALGIGGEVLCKIW--
RR8_EUGLO       NLHKTKGGIELFVLSTSKGLITDYTAREKGIGGELLFSIC--
RR8_EUGGR       RLQSVAGGVGLTVLSTSKGLMTDRLARSNKIGGEILFYIW--
                 :             :  *      .     ***