CLUSTAL format seed alignment for MF_01303

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSAC_PROMS      ------------MSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGC-KAGQIASSPRTED
PSAC_PROM5      ------------MSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGC-KAGQIASSPRTED
PSAC_PROM0      ------------MSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGC-KAGQIASSPRTED
PSAC_PROMP      ------------MSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGC-KAGQIASSPRTED
PSAC_SYNS3      ------------MSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGC-KAGQIASSPRTED
PSAC_PROM9      ------------MSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGC-KAAQIASSPRTED
PSAC_PROM3      ------------MSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGH-KSGQIAASPRTED
PSAC_PROMM      ------------MSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGH-KSGQIAASPRTED
PSAC_SYNSC      ------------MSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGC-KAGQIASSPRTED
PSAC_SYNPX      ------------MSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGC-KAGQIASSPRTED
PSAC_SYNS9      ------------MSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGC-KAGQIASSPRTED
PSAC_PROM1      ------------MSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGC-KASQIASSPRTED
PSAC_PROMT      ------------MSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGC-KASQIASSPRTED
PSAC_CYACA      ------------MVHVVKIYDTCIGCTQCVRACPCDVLEMVPWDGC-KASQIASSPRTED
PSAC_SYNE7      ------------MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGC-KAGQIAASPRTED
PSAC_SYNP6      ------------MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGC-KAGQIAASPRTED
PSAC_GLOVI      ------------MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGN-KAGTIASSPRTED
PSAC_SYNY3      ------------MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGC-KAAQIASSPRTED
PSAC_TRIEI      ------------MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGC-KAGQIASSPRTED
PSAC_PROMA      ------------MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGC-KAGQIASSPRTED
PSAC_TRICV      ------------MSHTVKIYDTCIGCTQCVRACPTDVLEMVPWDGC-KSGQIASSPRVED
PSAC_THAPS      ------------MSHTVKIYDTCIGCTQCVRACPTDVLEMVPWDGC-KSGQIASSPRVED
PSAC_PHATC      ------------MSHTVKIYDTCIGCTQCVRACPTDVLEMVPWDGC-KAGQIASSPRVED
PSAC_SYNJB      ------------MAHSVKIYDTCIGCTQCVRACPTDVLEMVPWKGNNKAGMIAAAPRTED
PSAC_SYNJA      ------------MAHTVKIYDTCIGCTQCVRACPTDVLEMVPWKGNNKAGMIAAAPRTED
PSAC_NOSS1      ------------MSHTVKIYDTCIGCTQCVRACPTDVLEMVPWDGC-KAAQVASSPRTED
PSAC_TRIV2      ------------MSHTVKIYDTCIGCTQCVRACPTDVLEMVPWDGC-KAAQVASSPRTED
PSAC_THEEB      ------------MAHTVKIYDTCIGCTQCVRACPTDVLEMVPWDGC-KAGQIASSPRTED
PSAC_CYAM1      ------------MAHTVKIYDNCIGCTQCVRACPLDVLEMVPWDGC-KAGQMASAPRTED
PSAC_GUITH      ------------MSHSVKVYDTCIGCTQCVRACPCDVLEMVAWDGC-KAGQIASAPRTED
PSAC_EMIHU      ------------MSHSVRVYDTCIGCTQCVRACPCDVLEMVPWDGC-KAGQIASAPRAED
PSAC_PORPU      ------------MAHSVKVYDTCIGCTQCVRACPCDVLEMVPWDGC-KAKQIASAPRTED
PSAC_PYRYE      ------------MAHSVKVYDTCIGCTQCVRACPCDVLEMVPWDGC-KAKQIASAPRTED
PSAC_GRATL      ------------MAHSVKVYDTCIGCTQCVRACPCDVLEMVPWDGC-KAGQIASAPRTED
PSAC_OSTTA      ------------MSHAVKIYDTCIGCTQCVRACPTDVLEMVPWDGC-KAGQIASAPRTED
PSAC_CHLRE      ------------MAHIVKIYDTCIGCTQCVRACPLDVLEMVPWDGC-KASQMASAPRTED
PSAC_TETOB      ------------MSHIVKIYDTCIGCTQCVRACPLDVLEMVPWNGC-KANQMASAPRTED
PSAC_STIHE      ------------MSHIVKIYDTCIGCTQCVRACPLDVLEMVPWDGC-KAEQMASAPRTED
PSAC_TUPAK      ------------MSHTVKIYDTCIGCTQCVRACPTDVLEMAPWDGC-KAGQVASAPRTED
PSAC_CHLVU      ------------MSHTVKIYDTCIGCTQCVRACPTDVLEMVPWDGC-KASQIASAPRTED
PSAC_OLTVI      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMVPWDGC-KASQIASAPRTED
PSAC_COFAR      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_LOTJA      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_CITSI      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_JASNU      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_GOSHI      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_GOSBA      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_SOYBN      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_EUCGG      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_OENEH      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_NYMAL      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_NICTO      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_TOBAC      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_NICSY      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_AETCO      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_CAPBU      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_AMBTC      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_AETGR      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_ARATH      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_BARVE      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_OLIPU      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_CRUWA      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_DRANE      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_LEPVR      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_LOBMA      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_NANDO      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_NASOF      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_PLAOC      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_POPTR      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_ATRBE      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_CALFG      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_HELAN      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_LACSA      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_PIPCE      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_POPAL      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_SOLBU      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_SOLLC      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_SOLTU      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_VITVI      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_MORIN      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_PELHO      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_PHAVU      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGC-KAKQIASAPRTED
PSAC_CUCSA      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGC-KAKQIASAPRTED
PSAC_PINKO      ------------MAHSVKIYDTCIGCTQCVRACPTDVLEMIPWEGC-KAKQIASAPRTED
PSAC_PINTH      ------------MAHSVKIYDTCIGCTQCVRACPTDVLEMIPWEGC-KAKQIASAPRTED
PSAC_PANGI      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_DAUCA      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_PHAAO      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_SPIOL      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_DRIGR      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIAPAPRTED
PSAC_LIRTU      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIAPAPRTED
PSAC_ARAHI      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_AGRST      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_SACHY      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_WHEAT      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_MAIZE      ------------MSHSVKIYDTCIGCTHCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_HORVU      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_SACOF      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_ORYNI      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_ORYSA      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_ORYSI      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_ORYSJ      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_SORBI      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_ACOCL      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KAKQIASAPRTED
PSAC_ANGEV      ------------MAHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KANQIASAPRTED
PSAC_ADICA      ------------MAHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KANQIASAPRTED
PSAC_CHLAT      ------------MAHSVKIYDTCIGCTQCVRACPTDVLEMVPWDGC-RANQIASAPRTED
PSAC_CYAPA      ------------MAHTVKIYDTCIGCTQCVRACPTDVLEMVPWDGC-RANQIASAPRTED
PSAC_PHYPA      ------------MAHSVKIYDTCIGCTQCVRACPTDVLEMVPWDGC-KASQIASAPRTED
PSAC_MESVI      ------------MAHSVKIYATCIGCTQCVRACPTDVLEMVPWDGC-KANQIASAPRTED
PSAC_MARPO      ------------MAHAVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KANQIASAPRTED
PSAC_ANTAG      ------------MAHSVKIYDTCIGCTQCVRACPTDVLEMISWDGC-KANQIASAPRTED
PSAC_HUPLU      ------------MAHSVRIYDTCIGCTQCVRACPTDVLEMIPWDGC-KANQIASAPRTED
PSAC_PSINU      ------------MAHSVKIYDTCIGCTQCVRACPTDVLEMIPWNGC-KANQIASAPRTED
PSAC_STAPU      ------------MAHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KASQIASAPRTED
PSAC_ZYGCR      ------------MAHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KASQIASAPRTED
PSAC_NEPOL      ------------MSHSVKIYDTCIGCTQCVRACPTDVLEMVPWGGC-KAAQIASAPRTED
PSAC_CHAVU      ------------MSHKIKIYDTCIGCTQCVRACPTDVLEMIPWQGC-KAKQIASAPRTED
PSAC_CHAGL      ------------MSHTVKIYDTCIGCTQCVRACPTDVLEMIPWDGC-KANQIASSPRTED
PSAC_EUGGR      ------------MSHSVKIYNTCIGCTQCVRACPTDVLEMVPWDGC-KAGQIASSPRTED
PSAC_BIGNA      MKFELLNQVNLKKDHEIRIYSTCIGCTQCVRACPTDVLEMVPSTTC-KAKQVVTVPRIED
                              * :::* .*****:****** ***** .     ::  :.. ** **

PSAC_PROMS      CVGCKRCETACPTDFLSIRVYLGD-ETSRSMGLAY
PSAC_PROM5      CVGCKRCETACPTDFLSIRVYLGD-ETSRSMGLAY
PSAC_PROM0      CVGCKRCETACPTDFLSIRVYLGD-ETSRSMGLAY
PSAC_PROMP      CVGCKRCETACPTDFLSIRVYLGD-ETSRSMGLAY
PSAC_SYNS3      CVGCKRCETACPTDFLSIRVYLGD-ETSRSMGLSY
PSAC_PROM9      CVGCKRCETACPTDFLSIRVYLGD-ETSRSMGLAY
PSAC_PROM3      CVGCKRCETACPTDFLSIRVYLGD-ETTRSMGLAY
PSAC_PROMM      CVGCKRCETACPTHFLSIRVYLGD-ETTRSMGLAY
PSAC_SYNSC      CVGCKRCETACPTDFLSIRVYLGD-ETTRSMGLAY
PSAC_SYNPX      CVGCKRCETACPTDFLSIRVYLGD-ETTRSMGLAY
PSAC_SYNS9      CVGCKRCETACPTDFLSIRVYLGD-ETTRSMGLAY
PSAC_PROM1      CVGCKRCETACPTDFLSIRVYLGD-ETTRSMGLAY
PSAC_PROMT      CVGCKRCETACPTDFLSIRVYLGD-ETTRSMGLAY
PSAC_CYACA      CIGCKRCETACPTDFLSIRVYLGA-ETSRSMGLTY
PSAC_SYNE7      CVGCKRCETACPTDFLSIRVYLGA-ETTRSMGLAY
PSAC_SYNP6      CVGCKRCETACPTDFLSIRVYLGA-ETTRSMGLAY
PSAC_GLOVI      CVGCKRCETACPTDFLSIRVYLGA-ETTRSMGLAY
PSAC_SYNY3      CVGCKRCETACPTDFLSIRVYLGA-ETTRSMGLAY
PSAC_TRIEI      CIGCKRCETACPTDFLSVRVYLGA-ETTRSMGLAY
PSAC_PROMA      CVGCKRCETACPTDFLSVRVYLGD-ETTRSMGLAY
PSAC_TRICV      CVGCKRCETACPTDFLSVRVYLGRLETTRSLGLAY
PSAC_THAPS      CVGCKRCETACPTDFLSVRVYLGA-ETTRSLGLAY
PSAC_PHATC      CVGCKRCETACPTDFLSVRVYLGA-ETTRSLGLAY
PSAC_SYNJB      CVGCKRCETACPTDFLSIRVYLGP-ETTRSMGLAY
PSAC_SYNJA      CVGCKRCETACPTDFLSIRVYLGP-ETTRSMGLAY
PSAC_NOSS1      CVGCKRCETACPTDFLSIRVYLGA-ETTRSMGLAY
PSAC_TRIV2      CVGCKRCETACPTDFLSIRVYLGA-ETTRSMGLAY
PSAC_THEEB      CVGCKRCETACPTDFLSIRVYLGA-ETTRSMGLAY
PSAC_CYAM1      CVGCKRCETACPTDFLSIRVYLGG-ETTRSMGLAY
PSAC_GUITH      CIGCKRCETACPTDFLSVRVYLGG-ETTRSMGLAY
PSAC_EMIHU      CIGCKRCETACPTDFLSVRVYLGS-ETTRSLGLTY
PSAC_PORPU      CIGCKRCETACPTDFLSVRVYLGA-ETTRSMGLAY
PSAC_PYRYE      CIGCKRCETACPTDFLSVRVYLGA-ETTRSMGLAY
PSAC_GRATL      CIGCKRCETACPTDFLSVRVYLGA-ETTRSMGLAY
PSAC_OSTTA      CVGCKRCEAACPTDFLSVRVYLGS-ETTRSMGLAY
PSAC_CHLRE      CVGCKRCETACPTDFLSVRVYLGS-ESTRSMGLSY
PSAC_TETOB      CVGCKRCETACPTDFLSIRVYLSS-ETTRSMGLSY
PSAC_STIHE      CVGCKRCESACPTDFLSVRVYTSS-ESTRSMGLAY
PSAC_TUPAK      CVGCKRCESACPTDFLSVRVYLGS-ETTRSMGLGY
PSAC_CHLVU      CVGCKRCESACPTDFLSVRVYLGS-ETTRSMGLAY
PSAC_OLTVI      CVGCKRCESACPTDFLSVRVYLGS-ETTRSMGLAY
PSAC_COFAR      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_LOTJA      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_CITSI      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_JASNU      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_GOSHI      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_GOSBA      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_SOYBN      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_EUCGG      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_OENEH      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_NYMAL      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_NICTO      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_TOBAC      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_NICSY      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_AETCO      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_CAPBU      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_AMBTC      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_AETGR      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_ARATH      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_BARVE      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_OLIPU      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_CRUWA      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_DRANE      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_LEPVR      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_LOBMA      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_NANDO      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_NASOF      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_PLAOC      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_POPTR      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_ATRBE      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_CALFG      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_HELAN      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGIAY
PSAC_LACSA      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGIAY
PSAC_PIPCE      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_POPAL      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_SOLBU      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_SOLLC      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_SOLTU      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_VITVI      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_MORIN      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_PELHO      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_PHAVU      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_CUCSA      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_PINKO      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_PINTH      CAGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_PANGI      CVGCKRCESACPTDFLSVRVSLWH-ETTRSMGLGY
PSAC_DAUCA      CVGCKRCESACPTDFLSVRVSLWN-ETTRSMGLAY
PSAC_PHAAO      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLSY
PSAC_SPIOL      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLGY
PSAC_DRIGR      CVGCKRCESACPTDFLSVRVYLCH-ETTRSMGLAY
PSAC_LIRTU      CVGCKRCESACPTDFLSVRVYLWH-ETTRSMGLAY
PSAC_ARAHI      CVGCKRCESACPTDFLSVRVYLSH-ETTRSMGLAY
PSAC_AGRST      CVGCKRCESACPTDFLSVRVYLGP-ETTRSMALSY
PSAC_SACHY      CVGCKRCESACPTDFLSVRVYLGP-ETTRSMALSY
PSAC_WHEAT      CVGCKRCESACPTDFLSVRVYLGP-ETTRSMALSY
PSAC_MAIZE      CVGCKRCESACPTDFLSVRVYLGP-ETTRSMALSY
PSAC_HORVU      CVGCKRCESACPTDFLSVRVYLGP-ETTRSMALSY
PSAC_SACOF      CVGCKRCESACPTDFLSVRVYLGP-ETTRSMALSY
PSAC_ORYNI      CVGCKRCESACPTDFLSVRVYLGP-ETTRSMALSY
PSAC_ORYSA      CVGCKRCESACPTDFLSVRVYLGP-ETTRSMALSY
PSAC_ORYSI      CVGCKRCESACPTDFLSVRVYLGP-ETTRSMALSY
PSAC_ORYSJ      CVGCKRCESACPTDFLSVRVYLGP-ETTRSMALSY
PSAC_SORBI      CVGCKRCESACPTDFLSVRVYLRS-ETTRSMALSY
PSAC_ACOCL      CVGCKRCESACPTDFLSVRVYLGN-ETTRSMGLPY
PSAC_ANGEV      CVGCKRCESACPTDFLSVRVYLGA-ETTRSMGLAY
PSAC_ADICA      CVGCKRCESACPTDFLSVRVYLGA-ETTRSMGLAY
PSAC_CHLAT      CVGCKRCESACPTDFLSVRVYLGA-ETTRSMGLAY
PSAC_CYAPA      CVGCKRCESACPTDFLSIRVYLGA-ETTRSMGLGY
PSAC_PHYPA      CVGCKRCESACPTDFLSVRVYLGA-ETTRSMGLAY
PSAC_MESVI      CVGCKRCESACPTDFLSVRVYLGN-ESTRSMGLAY
PSAC_MARPO      CVGCKRCESRCPTDFLSVRVYLGN-ETTRSMGLSY
PSAC_ANTAG      CVGCKRCESACPTDFLSVRVYLGS-ETTRSMGLAY
PSAC_HUPLU      CVGCKRCESACPTDFLSIRVYLGS-ETTRSMGLAY
PSAC_PSINU      CVGCKRCESACPTDFLSVRVYLGS-ETTRSMGLAY
PSAC_STAPU      CVGCKRCESACPTDFLSVRVYLGS-ETTRSMGLAY
PSAC_ZYGCR      CVGCKRCESACPTDFLSVRVYLGP-ETTRSMGLAY
PSAC_NEPOL      CVGCKRCESACPTDFLSVRVYLGA-ETTRSMGLAY
PSAC_CHAVU      CVGCKRCESACPTDFLSVRVYLGS-ETTRSMGLAY
PSAC_CHAGL      CVGCKRCESACPTDFLSVRVYLGS-ETTRSMGLAY
PSAC_EUGGR      CVGCKRCESACPTDFLSVRVYLGS-ETSRSMGLAY
PSAC_BIGNA      CVGCKRCESACPTDFLSIRVYLGG-ETLRSMGLAY
                * ******: ***.***:**     *: **:.: *