CLUSTAL format seed alignment for MF_01305

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSBJ_SYNS3      MSGKKSNLPDGRIPDRLPDGRPAVAWKSRWTEGTLPLWLVATAGGMAVIFVVGLFFYGSY
PSBJ_SYNSC      MSGKKSPYPDGRIPDRNPDGTPAVPWRSRWTEGVLPLWLVATAGGMAVLFVVGLFFYGSY
PSBJ_SYNPX      MSGNKSPFPDGRIPDRLPDGRPAVPWRSRWTEGVLPLWLVATAGGMAVLFVVGLFFYGSY
PSBJ_SYNS9      MSSKKSLYPDGRIPDRLPDGRPAVAWRSRWTEGVLPLWLVATAGGMAVFFVVGLFFFGAY
PSBJ_PROM3      -MSTKLKGPDGRIPDRLPDGTPAVSWERRWTEGSLPLWLVATVGGMAVLSVLGLFFFGSF
PSBJ_PROMM      -MSTKLKGPDGRIPDRLPDGSPAVSWERRWTEGSLPLWLVATVGGMAVLSVLGLFFFGSF
PSBJ_PROM1      --MSKLKGPDGRVGDRLPDGRPAISWQRRWTEGALPLWLVATAGGTAVIFVLGIFFYGSY
PSBJ_PROMT      --MSKLKGPDGRAGDRLPNGMPAVSWERRWTEGALPLWLVATAGGTAVIFVLGIFFYGSY
PSBJ_PROMA      -MSSKLKGPDGRLPDRLPDGRPAVSWERRWTEGQLPLWLVATAGGIAVIFVLGIFFYGSY
PSBJ_PROMS      --MSKLKGPDGRIPDRLPDGRPAVAWERRWTEGTLPLWLVATAGGIAVIFVLGIFFYGSY
PSBJ_PROM0      --MSKLKGPDGRIPDRLPDGRPAVAWERRWTEGTLPLWLVATAGGIAVIFVLGIFFYGSY
PSBJ_PROM9      --MSKLKGPDGRIPDRLPDGRPAVAWERRWTEGTLPLWLVATAGGIAVIFVLGIFFYGSY
PSBJ_PROM5      --MSKLKGPDGRIPDRLPDGRPAVAWERRWTEGTLPLWLVATAGGIAVIFVLGIFFYGSY
PSBJ_PROMP      --MSKLKGPDGRIPDRLPDGRPAVAWERRWTEGTLPLWLVATAGGIAVIFVLGIFFYGSY
PSBJ_GLOVI      --------MPQRI----------------------PLWMVGVMAGLGVIAILGLFFYGSY
PSBJ_EMIHU      ------MSDVGRV----------------------PLWMVATVGGLAAGGLLILFVFGSY
PSBJ_CYAPA      -----MANTGGRI----------------------PLWLVATVAGLAAIGVLGIFFYGGY
PSBJ_THAPS      ------MVNTGRV----------------------PLWLVGLVGGFAVITIVSLFIYGSY
PSBJ_TRICV      ------MSNTGRI----------------------PLWLVGLVGGLAVITMLSLFLYGAY
PSBJ_PHATC      ------MANTGRI----------------------PLWLVGLVGGLAVITMLGLFIYGSY
PSBJ_GUITH      ------MASTGRI----------------------PLWIIATFGGIAALTVVGLFIYGSY
PSBJ_GRATL      ------MAGTGRV----------------------PLWLVATVGGIAVITVLGIFIYGSY
PSBJ_PORPU      ------MAGTGRI----------------------PLWLVATVGGMAAITVLGIFIYGSY
PSBJ_PYRYE      ------MAGTGRI----------------------PLWLVATVGGIAAITVLGIFIYGSY
PSBJ_CYACA      ------MNSTGRI----------------------PLWLVVTFGGIVVLTVLGIFIYGSY
PSBJ_CYAM1      ------MASTGRI----------------------PLWLVATIGGIAVLTVLGLFFYGSY
PSBJ_ZYGCR      ---MSNVGTTGRI----------------------PLWFIGVIAGIAALSIVGLFFYGAY
PSBJ_BIGNA      -MKNSFIGTTGRI----------------------PLWIVGFVVGSLALGLLGILFYGSY
PSBJ_EUGGR      ---MSNSENTGRI----------------------PLWLVLTIIGLAAIALLALFFYGSY
PSBJ_NEPOL      ---MSNTGTTGRV----------------------PLWFVGMIVGLAALGLLGIFFYGSY
PSBJ_OSTTA      ----MSNTTTGRI----------------------PLWFVGMVGGLAALGLLAIFFYGSY
PSBJ_CHLAT      ---MSNTGTTGRI----------------------PLWLVATVAGLAVIALLGVFFYGSY
PSBJ_CHAGL      ---MSNVGTTGRI----------------------PLWIIGTLAGTLVIGLLAIFFYGSY
PSBJ_TETOB      ---MSNTGTTGRI----------------------PLWLIGTFVGTAALGILAIFFYGSY
PSBJ_OLTVI      ---MTNTGTTGRI----------------------PLWLVGTVVGTLALGLVALFFYGAY
PSBJ_TUPAK      ---MSNTGTTGRI----------------------PLWLVGTVVGIAALTLLSVFFYGSY
PSBJ_CHLVU      ---MSNTGTTGRI----------------------PLWLVGTVAGTAALTLVAVFFYGSY
PSBJ_STIHE      ---MANTGVTGRI----------------------PLWLIGTVVGSLAIGLLAIFFYGSY
PSBJ_CHLRE      ---MSNTGTTGRI----------------------PLWLVGTVVGTLAIGLLAVFFYGSY
PSBJ_MESVI      ---MSNTGTTGRI----------------------PLWLVGTVVGLLAIGLLALFFYGSY
PSBJ_ADICA      -----MTNTTGRV----------------------PLWLVGTVAGTLVIGLLGVFFYGAY
PSBJ_HUPLU      -----MANTTGRI----------------------PLWLIGTVVGTPVISLVGIFSYGSY
PSBJ_WHEAT      -----MSDTTGRI----------------------PLCLIGTVAGIAVIGLVGVFFYGSY
PSBJ_PHAAO      -----MTDTTGRI----------------------PLWLIGTLTGILVIGLIGIFFYGSY
PSBJ_NANDO      -----MADTTGRI----------------------PLWLIGTVAGILIIGLLGVFFYGSY
PSBJ_CUCSA      -----MAETTGRI----------------------PLWLIGTVTGIPVIGLVGIFFYGSY
PSBJ_AGRST      -----MADTTGRI----------------------PLWLIGTVTGIPVIGLVGVFFYGSY
PSBJ_ACOCL      -----MADTTGRI----------------------PLWLIGTVAGIPVIGSVGVFFYGSY
PSBJ_HORVU      -----MADTTGRI----------------------PLWLIGTVAGIPVIGLVGVFFYGSY
PSBJ_ORYNI      -----MADTTGRI----------------------PLWLIGTVTGIAVIGLIGVFFYGSY
PSBJ_ORYSA      -----MADTTGRI----------------------PLWLIGTVTGIAVIGLIGVFFYGSY
PSBJ_ORYSI      -----MADTTGRI----------------------PLWLIGTVTGIAVIGLIGVFFYGSY
PSBJ_ORYSJ      -----MADTTGRI----------------------PLWLIGTVTGIAVIGLIGVFFYGSY
PSBJ_MAIZE      -----MADTTGRI----------------------PLWLIGTVTGILVIGLIGFFFYGSY
PSBJ_NYMAL      -----MADTTGRI----------------------PLWLIGTVTGILVIGLIGVFFYGSY
PSBJ_SACHY      -----MADTTGRI----------------------PLWLIGTVTGILVIGLIGVFFYGSY
PSBJ_SACOF      -----MADTTGRI----------------------PLWLIGTVTGILVIGLIGVFFYGSY
PSBJ_SORBI      -----MADTTGRI----------------------PLWLIGTVTGILVIGLIGVFFYGSY
PSBJ_COFAR      -----MADTTGRI----------------------PLWIVGTVTGILVIGLIGVFFYGSY
PSBJ_PLAOC      -----MADTTGRI----------------------PLWLIGTVTGIPVIGSIGIFFYGSY
PSBJ_CALFG      -----MADTTGRI----------------------PLWLIGTVTGIPVIGSIGIFFYGSY
PSBJ_DRIGR      -----MADTTGRI----------------------PLWLIGTVTGIPVIGSIGIFFYGSY
PSBJ_AMBTC      -----MADTTGRI----------------------PLWLIGTVTGIPVIGSMGIFFYGSY
PSBJ_LIRTU      -----MADTTGRI----------------------PLWLIGTVTGIPVIGSMGIFFYGSY
PSBJ_PINKO      -----MADTTGRI----------------------PLWLIGTVTGIIVIGLLGIFFYGSY
PSBJ_PINTH      -----MADTTGRI----------------------PLWLIGTVTGIIVIGLLGVFFYGSY
PSBJ_HELAN      -----MADTTGRI----------------------PLWIIGTVAGILVIGLVGVFFYGSY
PSBJ_LACSA      -----MADTTGRI----------------------PLWIIGTVAGILVIGLVGVFFYGSY
PSBJ_SPIOL      -----MADTTGRI----------------------PLWIIGTVAGILVIGLVGIFFYGSY
PSBJ_VITVI      -----MADTTGRI----------------------PLWLIGTVTGIPVIGLIGIFFYGSY
PSBJ_PELHO      -----MADTTGRI----------------------PLWIIGTVAGIPVIGLIGIFFYGSY
PSBJ_POPTR      -----MADTTGRI----------------------PLWIIGTVTGIPVIGLIGIFFYGSY
PSBJ_CITSI      -----MADTTGRI----------------------PLWIIGTVTGIPVIGLIGIFFYGSY
PSBJ_GOSBA      -----MADTTGRI----------------------PLWIIGTVTGIPVIGLIGIFFYGSY
PSBJ_GOSHI      -----MADTTGRI----------------------PLWIIGTVTGIPVIGLIGIFFYGSY
PSBJ_POPAL      -----MADTTGRI----------------------PLWIIGTVTGIPVIGLIGIFFYGSY
PSBJ_PHAVU      -----MADTTGRI----------------------PLWIIGTVTGITVIGLIGIFFYGSY
PSBJ_SOYBN      -----MADTTGRI----------------------PLWIIGTVTGITVIGLIGIFFYGSY
PSBJ_LOTJA      -----MADTTGRI----------------------PLWIIGTVTGITVIGLIGIFFYGSY
PSBJ_ARAHI      -----MADTTGRI----------------------PLWVIGTVAGIPVIGLIGIFFYGSY
PSBJ_CAPBU      -----MADTTGRI----------------------PLWVIGTVAGIPVIGLIGIFFYGSY
PSBJ_CRUWA      -----MADTTGRI----------------------PLWVIGTVAGIPVIGLIGIFFYGSY
PSBJ_NASOF      -----MADTTGRI----------------------PLWVIGTVAGIPVIGLIGIFFYGSY
PSBJ_OLIPU      -----MADTTGRI----------------------PLWVIGTVAGIPVIGLIGIFFYGSY
PSBJ_PIPCE      -----MADTTGRI----------------------PLWLIGTVTGIIVIGLIGIFFYGSY
PSBJ_OENEH      -----MADTTGRI----------------------PLWIIGTVAGILVIGLIGIFFYGAY
PSBJ_MORIN      -----MADTTGRI----------------------PLWIIGTVTGIIVIGLIGIFFYGSY
PSBJ_JASNU      -----MADTTGRI----------------------PLWIIGTVTGILVIGLVGIFFYGSY
PSBJ_EUCGG      -----MADTTGRI----------------------PLWIIGTVTGILVIGLIGIFFYGSY
PSBJ_LOBMA      -----MADTTGRI----------------------PLWVIGTVAGILVIGIIGIFFYGSY
PSBJ_BARVE      -----MADTTGRI----------------------PLWVIGTVAGILVIGLIGIFFYGSY
PSBJ_DRANE      -----MADTTGRI----------------------PLWVIGTVAGILVIGLIGIFFYGSY
PSBJ_LEPVR      -----MADTTGRI----------------------PLWVIGTVAGILVIGLIGIFFYGSY
PSBJ_ARATH      -----MADTTGRI----------------------PLWVIGTVAGILVIGLIGIFFYGSY
PSBJ_AETGR      -----MADTTGRI----------------------PLWIIGTGAGILVIGLIGIFFYGSY
PSBJ_AETCO      -----MADTTGRI----------------------PLWIIGTVAGILVIGLIGIFFYGSY
PSBJ_ATRBE      -----MADTTGRI----------------------PLWIIGTVAGILVIGLIGIFFYGSY
PSBJ_DAUCA      -----MADTTGRI----------------------PLWIIGTVAGILVIGLIGIFFYGSY
PSBJ_NICSY      -----MADTTGRI----------------------PLWIIGTVAGILVIGLIGIFFYGSY
PSBJ_TOBAC      -----MADTTGRI----------------------PLWIIGTVAGILVIGLIGIFFYGSY
PSBJ_NICTO      -----MADTTGRI----------------------PLWIIGTVAGILVIGLIGIFFYGSY
PSBJ_PANGI      -----MADTTGRI----------------------PLWIIGTVAGILVIGLIGIFFYGSY
PSBJ_SOLBU      -----MADTTGRI----------------------PLWIIGTVAGILVIGLIGIFFYGSY
PSBJ_SOLLC      -----MADTTGRI----------------------PLWIIGTVAGILVIGLIGIFFYGSY
PSBJ_SOLTU      -----MADTTGRI----------------------PLWIIGTVAGILVIGLIGIFFYGSY
PSBJ_PSINU      -----MANTTGRI----------------------PLWLVGTVTGTLVIGLMGIFFYGAY
PSBJ_ANGEV      -----MANTTGRI----------------------PLWLIGTVTGILVIGLLGIFFYGAY
PSBJ_ANTAG      -----MANTTGRI----------------------PLWLIGTIAGILVIGLVGIFFYGSY
PSBJ_MARPO      -----MANTTGRV----------------------PLWLIGTVAGILVIGLVGIFFYGSY
PSBJ_PHYPA      -----MANTTGRI----------------------PLWLIGTVAGILVLGLLGIFFYGSY
PSBJ_CHAVU      ---MSNVGTTGRI----------------------PLWLIATVAGILVLTVVGIFFYGSY
PSBJ_STAPU      ---MSNVGTSGRI----------------------PLWLVGTVAGILVLGLVGLFFYGSY
PSBJ_SYNY3      ------MFAEGRI----------------------PLWVVGVVAGIGAIGVLGLFFYGAY
PSBJ_SYNJA      ------MTSQARI----------------------PLWIVAVVVGLGVVTVVGLFFYGSY
PSBJ_SYNJB      ------MTSQARI----------------------PLWIVAVVAGLGVITVVGLFFYGSY
PSBJ_TRIV2      -----MSAGSGRI----------------------PLWVVATIAGLGVITVVGIFFYGAY
PSBJ_NOSS1      -----MSAGSGRI----------------------PLWVVATIAGLGVITVVGIFFYGAY
PSBJ_TRIEI      -----MMSEPGRI----------------------PLWLVALVAGTGVLVVVGLFFYGSY
PSBJ_THEEB      -----MMSEGGRI----------------------PLWIVATVAGMGVIVIVGLFFYGAY
PSBJ_SYNP6      ------MAGGGRI----------------------PLWIVATVAGTGALVVVGLFFYGAY
PSBJ_SYNE7      ------MAGGGRI----------------------PLWIVATVAGTGVLVVVGLFFYGAY
                           *                       ** .:    *      : .: :*.:

PSBJ_SYNS3      VGVGSA-
PSBJ_SYNSC      TGVGSA-
PSBJ_SYNPX      TGVGSA-
PSBJ_SYNS9      TGVGSA-
PSBJ_PROM3      TGVGSA-
PSBJ_PROMM      TGVGSA-
PSBJ_PROM1      TGIGNAG
PSBJ_PROMT      TGIGNAG
PSBJ_PROMA      TGVGSA-
PSBJ_PROMS      QGVGAGG
PSBJ_PROM0      QGVGAGG
PSBJ_PROM9      QGVGAGG
PSBJ_PROM5      QGVGAG-
PSBJ_PROMP      QGVGAG-
PSBJ_GLOVI      AGLGAG-
PSBJ_EMIHU      SGLGSSL
PSBJ_CYAPA      SGLGSSI
PSBJ_THAPS      SGLGSSL
PSBJ_TRICV      SGLGSSL
PSBJ_PHATC      SGLGSSL
PSBJ_GUITH      SGIGSAL
PSBJ_GRATL      SGIGSSL
PSBJ_PORPU      SGVGSSL
PSBJ_PYRYE      SGVGSSL
PSBJ_CYACA      SGLGSSL
PSBJ_CYAM1      SGLGSSL
PSBJ_ZYGCR      SGLGSSL
PSBJ_BIGNA      TGLGSSL
PSBJ_EUGGR      SGLGSSL
PSBJ_NEPOL      TGLGSSL
PSBJ_OSTTA      VGLGSSL
PSBJ_CHLAT      SGLGSSL
PSBJ_CHAGL      VGLGSSL
PSBJ_TETOB      VGLGSSL
PSBJ_OLTVI      HGLGSSL
PSBJ_TUPAK      VGLGSSL
PSBJ_CHLVU      VGLGSSL
PSBJ_STIHE      VGLGSSL
PSBJ_CHLRE      VGLGSSL
PSBJ_MESVI      SGLGSSL
PSBJ_ADICA      SGLGSSL
PSBJ_HUPLU      SGLGSSL
PSBJ_WHEAT      SGLGSSL
PSBJ_PHAAO      SGLGSSL
PSBJ_NANDO      SGLGSSL
PSBJ_CUCSA      SGLGSSL
PSBJ_AGRST      SGLGSSL
PSBJ_ACOCL      SGLGSSL
PSBJ_HORVU      SGLGSSL
PSBJ_ORYNI      SGLGSSL
PSBJ_ORYSA      SGLGSSL
PSBJ_ORYSI      SGLGSSL
PSBJ_ORYSJ      SGLGSSL
PSBJ_MAIZE      SGLGSSL
PSBJ_NYMAL      SGLGSSL
PSBJ_SACHY      SGLGSSL
PSBJ_SACOF      SGLGSSL
PSBJ_SORBI      SGLGSSL
PSBJ_COFAR      SGLGSSL
PSBJ_PLAOC      SGLGSSL
PSBJ_CALFG      SGLGSSL
PSBJ_DRIGR      SGLGSSL
PSBJ_AMBTC      SGLGSSL
PSBJ_LIRTU      SGLGSSL
PSBJ_PINKO      SGLGSSL
PSBJ_PINTH      SGLGSSL
PSBJ_HELAN      SGLGSSL
PSBJ_LACSA      SGLGSSL
PSBJ_SPIOL      SGLGSSL
PSBJ_VITVI      SGLGSSL
PSBJ_PELHO      SGLGSSL
PSBJ_POPTR      SGLGSSL
PSBJ_CITSI      SGLGSSL
PSBJ_GOSBA      SGLGSSL
PSBJ_GOSHI      SGLGSSL
PSBJ_POPAL      SGLGSSL
PSBJ_PHAVU      SGLGSSL
PSBJ_SOYBN      SGLGSSL
PSBJ_LOTJA      SGLGSSL
PSBJ_ARAHI      SGLGSSL
PSBJ_CAPBU      SGLGSSL
PSBJ_CRUWA      SGLGSSL
PSBJ_NASOF      SGLGSSL
PSBJ_OLIPU      SGLGSSL
PSBJ_PIPCE      SGLGSSL
PSBJ_OENEH      SGLGSSL
PSBJ_MORIN      SGLGSSL
PSBJ_JASNU      SGLGSSL
PSBJ_EUCGG      SGLGSSL
PSBJ_LOBMA      SGLGSSL
PSBJ_BARVE      SGLGSSL
PSBJ_DRANE      SGLGSSL
PSBJ_LEPVR      SGLGSSL
PSBJ_ARATH      SGLGSSL
PSBJ_AETGR      SGLGSSL
PSBJ_AETCO      SGLGSSL
PSBJ_ATRBE      SGLGSSL
PSBJ_DAUCA      SGLGSSL
PSBJ_NICSY      SGLGSSL
PSBJ_TOBAC      SGLGSSL
PSBJ_NICTO      SGLGSSL
PSBJ_PANGI      SGLGSSL
PSBJ_SOLBU      SGLGSSL
PSBJ_SOLLC      SGLGSSL
PSBJ_SOLTU      SGLGSSL
PSBJ_PSINU      SGLGSSL
PSBJ_ANGEV      SGLGSSL
PSBJ_ANTAG      SGLGSSL
PSBJ_MARPO      SGLGSSL
PSBJ_PHYPA      SGLGSSL
PSBJ_CHAVU      SGLGSSL
PSBJ_STAPU      VGLGSSL
PSBJ_SYNY3      AGLGSSM
PSBJ_SYNJA      TGLGAPV
PSBJ_SYNJB      VGLGSSL
PSBJ_TRIV2      AGLGSSI
PSBJ_NOSS1      AGIGSSI
PSBJ_TRIEI      VGVGSSL
PSBJ_THEEB      AGLGSSL
PSBJ_SYNP6      AGLGSSL
PSBJ_SYNE7      AGLGSSL
                 *:*