CLUSTAL format seed alignment for MF_01306_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RS4_ARTS2       MANNTRARRTARLSRALGIALTPK-------AAKYMERRPYGPG--------EHGR----
RS4_LEIXX       --MSSRSRSKTRESRALGIALTPK-------AARYMEKRPYAPG--------EHGR----
RS4_TROWT       --MSSCSR--TRLSRALGVPLTPK-------AARLMEVRPYPPG--------QHGR----
RS4_BIFAA       MTNVQRSRRQVRLSRALGIALTPK-------AQRIFEKRPYAPG--------EHGR----
RS4_STRCO       --MANQPRPKVKKSRALGIALTPK-------AVKYFEARPYPPG--------EHGR----
RS4_THEFY       ---MRYTGPKVRLSRRAGVPLTRK-------AVKYFEKRPYPPG--------EHGR----
RS4_RHIME       --MSKRESSKYKIDRRMGENIWGR------PKSPVNR-REYGPG--------QHGQ----
RS4_AGRFC       --MSKRESAKYKIDRRMGENIWGR------PKSPVNR-REYGPG--------QHGQ----
RS4_CHESB       --MSKRQSAKYKLDRRMGENIWGR------PKSPVNR-REYGPG--------QHGQ----
RS4_BRUSU       --MSKRESAKYKIDRRLGENIWGR------PKSPVNR-REYGPG--------QHGQ----
RS4_RHILO       --MSKRESAKYKIDRRLGENIWGR------PKSPVNK-REYGPG--------QHGQ----
RS4_BARBK       --MSKRESAKYKIDRRIGENIWGR------PKSPVNR-REYGPG--------QHGQ----
RS4_RHOS1       --MTKRTSAKYKIDRRMGENIWGR------PKSPVNK-REYGPG--------QHGQ----
RS4_PARDP       --MTKRTAAKYKIDRRMGENIWGR------AKSPLNR-REYGPG--------QHGQ----
RS4_JANSC       --MTKRTSAKYKIDRRMGENIWGR------PKSPVNR-REYGPG--------QHGQ----
RS4_ROSDO       --MTKRTSAKHKIDRRMGENIWGR------PKSPVNR-REYGPG--------QHGQ----
RS4_RHOPB       --MTKRSEAKYKIDRRMGQNIWGR------PKSPVNR-REYGPG--------QHGQ----
RS4_BRADU       --MTKRSEAKYKIDRRMGQNIWGR------PKSPVNR-REYGPG--------QHGQ----
RS4_CAUVC       --MSKRHSAKYKIDRRMGENLWGR------PKSPVNS-RSYGPG--------QHGQ----
RS4_MARMM       --MSKRHSQKYKIDRRMGENLWGR------PKSPVNS-RSYGPG--------QHGQ----
RS4_HYPNA       --MSRRHSAKYKIDRRVGENIWGR------AKSPFNK-RNYKPG--------QHGQ----
RS4_ERYLH       --MSKRKSAKYKLDRRMGENIWGR------PNSPVNK-RSYGPG--------QHGQ----
RS4_NOVAD       --MSKRKASKYKIDRRLGENIWGR------PKSSVNR-RSYGPG--------QHGQ----
RS4_SPHAL       --MSKRQSAKYKLDRRMGENIWGR------PKSPVNR-REYGPG--------QHGQ----
RS4_ZYMMO       --MSKRHSSKYKIDRRMGENIWGR------PKSPVNR-REYGPG--------QHGQ----
RS4_GLUOX       --MSKRLESKYKINRRLGVNLWGR------AKSPVNR-REYGPG--------QHGQ----
RS4_GRABC       --MTKRAESKFKINRRLGVNLWGR------AKSPLNK-RDYAPG--------QHGQ----
RS4_MAGSA       --MSKRIEAKYKINRRLGANLWGR------SKSPLNRGKENPPG--------QHGQ----
RS4_RHORT       --MGKRLNSKHKIDRRLGVNLWGR------PKSPINK-REYGPG--------EHGQ----
RS4_PELUB       --MTKRISAKHKIDRRLKINLWGR------PKSPFNK-RDYGPG--------QHGQ----
RS4_RICTY       --MTKIVRSKYKASRRLGVSLWGD------SKDAFNT-RNYRPG--------QHGQ----
RS4_RICBR       --MTKIVRSKYKASRRLGVSLWGD------GKDAFNT-RNYRPG--------QHGR----
RS4_ANAMM       --MVAVVERKYRASRRLGVNLWGR------SKDPVAT-RNYPSG--------QHGS----
RS4_ANAPZ       --MVAVVNRKYRASRRLGVNLWGR------SKDPFNT-RNYPPG--------QHGA----
RS4_EHRCR       ----MVIQRKYRASRRLGVNLWGR------SKDPFNT-RNYPPG--------QHGG----
RS4_EHRRW       ----MVIQRKYRASRRLGVSLWGR------SKDPFNT-RNYPPG--------QHGN----
RS4_WOLTR       --MTTVINRKYRISRRLGINLWGR------AKDPVNR-RKYPPG--------QRGI----
RS4_CHLAB       --MARYCGPKNRIARRFGANIFGR------SRNPLFK-KPHPPG--------QHGM----
RS4_CHLPN       --MARYCGPKNRVARRFGANIFGR------SRNPLLK-KPHPPG--------QHGM----
RS4_CHLMU       --MARYCGPKNRIARRFGANIFGR------GRNPLLR-KPNPPG--------QHGM----
RS4_PARUW       --MARYTGSKNRIARRYGVNIFGR------ARNPLLH-KPNPPG--------VHGA----
RS4_AQUAE       --MGRYIGPWVKLDRRFGVVVSGKKSAPKILARRNYPPG--QHG--------RKYG----
RS4_LEPBL       --MARYRGPVVKIMRREGVDLF-LKSSYTFNKDKFHRKG--PPG--------MPTK----
RS4_ACIBT       --MARYIGPKCKLSRREGTDLQLKSGVKPFDVKTKKANK--APG--------QHGQ----
RS4_PSYCK       --MARYIGPKLKLSRREGTDLGLKSGVKPYDVKTKKSAR--PPG--------QHGV----
RS4_ECOLI       --MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQ---APG--------QHGA----
RS4_HAES1       --MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIDT---APG--------QHGA----
RS4_SHELP       --MARYLGPKLKLTRREGTDLFLKSGVRAIDSKCKLEA---APG--------QHGA----
RS4_AERS4       --MARYIGPKLKLSRREGTDLFLKSGVRAIDSKCKIDT---APG--------QHGA----
RS4_PSEA6       --MARYLGPKLKLSRREGTDLFLKSGVRAIESKCKIDN---APG--------QHGA----
RS4_VIBCH       --MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIDN---APG--------VHGA----
RS4B_PSYIN      --MARYLGPKLKLSRREGTDLFLKSGVRAIESKCKIDN---APG--------VHGA----
RS4_COLP3       --MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIET---IPG--------QHGA----
RS4_PSET1       --MARYLGPKLKLSRREGTDLFLKSGVRAIDSKCKLET---APG--------QHGA----
RS4_PSEAB       --MARYIGPKCKLSRREGTDLFLKSGARALDSKCKAEN---VPG--------QHGQ----
RS4_PSEE4       --MARYIGPKCKLSRREGTDLFLKSGVRALESKCNIEA---APG--------IHGQ----
RS4_SACD2       --MARYIGPTCKLSRREGTDLFLKSGVRPLESKCKAEA---APG--------QHGQ----
RS4_HAHCH       --MARYIGPKCKLSRREGTDLFLKSGARALDSKCNMET---APG--------QHGQ----
RS4_MARHV       --MARYIGPKCKLSRREGTDLFLKSGVRALDSKCNIET---PPG--------MHGA----
RS4_ALCBS       --MARYIGPKCKLSRREGTDLFLKSGIRPLESKCKADQ---APG----QAAGASGR----
RS4_CHRSD       --MARYIGPKCKLSRREGTDLFLKSGVTPFEKKCKSEQ---IPG--------VHGQ----
RS4_HYDCU       --MARYIGPKCKLSRREGTDLFLKSGVRSIESKCKIDQ---LPG--------QHGA----
RS4_ALKEH       --MARYIGPTCKLARREGTDLFLKSGVRPLDSKCKLDQ---PPG--------PKLQ----
RS4_HALHL       --MAKYIGPKCKLARREKTDLFLKSGVRSIDTKCKLEQ---PPG--------QHGQ----
RS4_NITOC       --MAKYTGPKLKQARREGTDLFLKSGVRPIDSKCKIEQ---VPG--------QHGAG---
RS4_FRATO       --MARYLGPKCKLSRREGTDLFLKSGVKANDEKCKMNT---APG--------QHGA----
RS4_PARXL       --MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDS---KPG--------QHGR----
RS4_RALSO       --MARYTGPKAKLSRREGTDLFLKSARRSLADKCKLDS---KPG--------QHGR----
RS4_BORA1       --MARYTGPKCKLSRREGTDLFLKSARRSLDSKCKLDS---KPG--------QHGR----
RS4_POLSJ       --MARYLGPKAKLSRREGTDLFLKSARRAISDKAKFDS---KPG--------QHGR----
RS4_RHOFT       --MARYLGPKAKLSRREGTDLFLKSARRSIGDKAKFDS---KPG--------QHGR----
RS4_VEREI       --MARYLGPKAKLSRREGTDLFLKSARRSIADKSKFDS---KPG--------QHGR----
RS4_METPP       --MARYLGPKAKLARREGTDLFLKSARRAIGDKSKFET---KPG--------QHGR----
RS4_NEIMF       --MARYIGPKCKLARREGTDLFLKSARRSLDSKCKIDS---APG--------QHGA----
RS4_CHRVO       --MARYIGPKCKLARREGTDLFLKSARRALDSKCKLDA---APG--------QHGA----
RS4_METCA       --MARYLGPKCKLSRREGTDLFLKSRGKSLESKCKLDQ---PPG--------QHGQ----
RS4_BUCAI       --MAKYLGPKLKLSRREGTDLFLKSGLRSIESKCKLEQ---PPG--------QHGI----
RS4_BUCAP       --MARYLGPKLKLSRREGTDLFLKSGFRSIDSKCKLEH---PPG--------QHGV----
RS4_BAUCH       --MARYLGPKLKMSRRENIDLFLKSGVRAIDSKCKIEQ---PPG--------QHGA----
RS4_BLOFL       --MAKYVGPKLKLSRRENTDLFLKSGIRSIDSKCQFDH---APG--------QHSI----
RS4_BLOPB       --MAKYLGPKLKLSRREGTDLFLKSGIRAIDSKCKLDQ---PPG--------QHNM----
RS4_BUCBP       --MAKYLGPKLKLCRRENTDLFFKSGIRAIDSKCKFDQ---FPG--------QHGS----
RS4_WIGBR       --MAKYLGPKLKLSRREGTDLFLKSGVRAIESKCKIDH---LPG--------QHGS----
RS4_BUCCC       --MAKYLGPKLKLCRRENSDLFLKSGVRTIESKCNIDQ---APG--------QHGS----
RS4_RUTMC       --MARYTGPTCKLARREGTDLFLKSGIRSLDSKCNVTQ---LPG--------MHGAN---
RS4_LEGPA       --MARYLGPKCKLSRREGCDLLLKSGVRDHKSKCKSEK---LPG--------QHGD----
RS4_COXBU       --MARYLGPKCRLSRREKTDLQLKSGIRAIDSKCNIER---IPG--------MHWQ----
RS4_XANOM       --MARYIGPTCKLARREGADLSLKSPARALDSKCKLEQ---KPG--------QHGA----
RS4_XYLFT       --MARYIGPSCKLARREGADLSLKSPSRALDSKCKLEQ---RPG--------QHGA----
RS4_AROAE       --MARNLDPKCRQCRREGEKLFLK-AEKCFTDKCAIERRAYAPG--------QHGQ----
RS4_AZOSB       --MARNLDPKCRQCRREGEKLFLK-GEKCFTDKCAIERRAYAPG--------QHGQ----
RS4_DECAR       --MARNLDPKCRQCRREGEKLFLK-GEKCFTDKCAIERRSYAPG--------QHGQ----
RS4_THIDA       --MARNLDPKCRQCRREGEKLFLK-GEKCFTDKCAIERRAYAPG--------QHGQ----
RS4_NITMU       --MARNLDPKCRQCRREGEKLFLK-GEKCFTDKCAIERRNYAPG--------QHGQ----
RS4_NITEC       --MARNINPKCRQCRREGEKLFLK-GDKCFSDKCPIERRNYPPG--------QHGQ----
RS4_MAGMM       --MARYLGSKCRLCRREATKLFLK-GEKCYSDKCAMERRNYVPG--------QHGQ----
RS4_DESVV       --MAKYTDAKCRQCRREGTKLFLK-GDRCFTDKCAFDRRPYAPG--------QHGR----
RS4_DESAG       --MAKYNDSKCRICRREGGKLFLK-GDRCYTDKCAFDRRPYAPG--------QHGR----
RS4_LAWIP       --MAKYNDAKCRLCRREGTKLFLK-GDRCFTDKCAYDRRPYAPG--------QHGR----
RS4_GEOSL       --MARYTGPSCRLCRRENMELFLK-GERCYTDKCAIKRRNYPPG--------QHGQ----
RS4_PELPD       --MARYTGPSCRLCRRENMELFLK-GDRCYTDKCAIKRRNYPPG--------QHGQ----
RS4_PELCD       --MARYTGPVCRLCRRETMKLFLK-GDRCYTDKCALERRNYAPG--------QHGQ----
RS4_SYNFM       --MARYTDSSCRICRRETMKLYLK-GDRCYSDKCAVERRNYPPG--------QHGQ----
RS4_ANADE       --MARYSESVCRLCRRENLKMYLK-GDRCYTDKCAIERRPYPPG--------QHGQ----
RS4A_MYXXD      --MARYTASACRICRRENLKMYLK-GDRCYTDKCAIERRPYPPG--------QHGQ----
RS4_SYNAS       --MARYKESACRLCRREGLKLFLK-GDRCYGEKCAFERRGYAPG--------EHGQ----
RS4_DESPS       --MARNIGAVCRRCRRENLKLFLK-GDRCYSDKCSFERRAFAPG--------QHGQ----
RS4A_BDEBA      --MSCINESVCKLCRRENVKLFLK-GDRCYTDKCSFERRPYPPG--------QHGQ----
RS4_CARHZ       --MARYTGPVCKLCRREGIKLFLK-GDRCYTDKCAIARRNYAPG--------QHGH----
RS4_ACET2       --MARYTGASCRLCRREGEKLYLK-GERCTTNKCAIARRGYAPG--------QHGQ----
RS4_DESHY       --MARYTGPVCRLCRREGMKLFLK-GDRCYTGKCAIDRRAYAPG--------QHGQ----
RS4_MOOTA       --MARYKDSTCRLCRREGTKLFLK-GDRCYSDKCAVARRSYPPG--------QHGQ----
RS4_SYNWW       --MGRYTDSVCRQCRREGEKLFLK-GDRCYSEKCSVSRRAYPPG--------AHGQ----
RS4A_CLOAB      --MARYTGAVCRLCRREGLKLFLK-GDRCYTDKCAFTRRGYAPG--------VHGQ----
RS4_CLOTE       --MARYTEANCRLCRREGLKLYLK-GDRCYTDKCAFSRRGYAPG--------QHGQ----
RS4A_CLOPS      --MARYTGATCKLCRREGMKLFLK-GDRCYTDKCAFVRRSYAPG--------QHGA----
RS4A_CLONN      --MARYIGATCRLCRREGMKLFLK-GDRCYTDKCAFARRSYAPG--------QHGQ----
RS4_CLOD6       --MARYTGASCRQCRREGMKLFLK-GDRCYTDKCAIVKRNYAPG--------QHGQ----
RS4_CALS4       --MGRYLGPSCRLCRREGIKLYLK-GEKCYTDKCPLAKRGYAPG--------QHGQ----
RS4_GLOVI       --MARYTGPVCKLCRAVGMKLYLK-GIRCSSPKCAIERRNFRPG--------VHGQ----
RS4A_SYMTH      --MARYTGPVCRLCRREGVKLYLK-GEKCYSDKCPIVKRATPPG--------QHGA----
RS4_SOLUE       --MARYIGPVCRQCRREGMKLYLK-GERCHSEKCAIEKRNFIPG--------QHGK----
RS4_DEHMC       --MSRETGAVCRMCRRSGDKLFLK-GDKCVT-KCVFEKRPKPPG--------PQ-L----
RS4_THEMA       --MARYTGPLCKLCRREGMKLYLK-GERCYTDKCAFDRRPYAPG--------QHGQ----
RS4_DEIGD       --MGRFRGSITKLSRREGINLAET-EK----VQKYLDRRPYAPG--------QHGQR---
RS4_THET8       --MGRYIGPVCRLCRREGVKLYLK-GERCYSPKCAMERRPYPPG--------QHGQK---
RS4_CAMFF       --MARYRGPVEKLERRLGVSLALK-GERRLAGKSALDKRPYAPG--------QHGQ----
RS4_HELHP       --MARYRGPVEKLERRFGISLALK-GERRLAGKCALDKRPYGPG--------QHGQ----
RS4_SULDN       --MARYRGPVEKIERRFGVSLNLK-GERRLAGKSALEKRPYAPG--------QHGQ----
RS4_WOLSU       --MARYRGPVEKIERRFGVSLNLK-GERRLAGKSSLEKRPYAPG--------QHGQ----
RS4_HELPY       --MARYRGAVERLERRFGVSLALK-GERRLSGKSALDKRAYGPG--------QHGQ----
RS4_CHLCH       --MARFRGSITKVSRRLGIALAPK-AEKYLE------RRPFPPG--------QHGQG---
RS4_CHLL3       --MARFRGSITKVSRRLGVALSPK-AEKYLE------RRPFAPG--------QHGQG---
RS4_CHLPD       --MARFRGSITKVSRRLGIALSPK-AEKYLE------RRPFAPG--------QHGQS---
RS4_CHLTE       --MARFRGSITKVSRRLGIALSPK-AEKYLE------RRPYAPG--------QHGQS---
RS4_CORGL       --MARYTGPATRKSRRLRVDLVG--GDMA------FERRPYPPG--------QAGR----
RS4_CORJK       --MARYTGPVTRKSRRLRVDLVG--GDNS------FERRPYPPG--------QAGR----
RS4_MYCUA       --MARYTGPVTRKSRRLGTDLVG--GDQS------FEKRPYPPG--------QHGR----
RS4_MYCVP       --MARYTGPVTRKSRRLGVDLVG--GDQS------FEKRPYPPG--------QHGR----
RS4_NOCFA       --MARYTGPITRKSRRLRVDLVG--GDQA------FERRPYPPG--------QHGR----
RS4_RHOJR       --MARYTGPITRKSRRLRVDLVG--GDQA------FERRPYPPG--------QHGR----
RS4_SACEN       --MARYTGPATRKSRRLKVDLVG--GDQA------FERRPYPPG--------QHGR----
RS4_NOCSJ       --MARYTGPMTKKSRRLGVDLVG--GDSA------YERRPYPPG--------QHGR----
RS4_CUTAK       --MARYTGPLTKKSRRLGTDLVG--NDKS------FERRPYPPG--------VHGR----
RS4_FRACC       --MARYTGADCKRCRREKTKLFLK-GSKCDTPKCPIEIRPYPPG--------EHGR----
RS4_ACIC1       --MARYLGADCKLCRREKMKLFLK-GSKCESPKCPIEERPYPPG--------EHGR----
RS4_RUBXD       --MARYTGPRGRRDRRAGVMLSSM-RKNP------LEKKPYPPG--------EHGR----
RS4_FUSNN       --MARNRQPVLKKCRALGIDPVIL-GVKK------SSNRQIRPN--------AN------
RS4_BACTN       --MARYTGPKSRIARKFGEGIFGA--------DKVLSKKNYPPG--------QHGNS---
RS4_PORGI       --MARYTGPKSKIARKFGDPIFGA--------DKVLSKKNYPPG--------QHGNN---
RS4_CYTH3       --MARYTGPRSRISRRFGEPVMGD--------SKALQKKNYAPG--------MHGRN---
RS4_GRAFK       --MARYTGPKTKIARKFGEAIFGD--------DKSFEKRNYPPG--------QHGNN---
RS4_SALRD       --MARYRGPKQKIARRFKEPIFGP--------SKALERKPYPPG--------QHGQS---
RS4_TREDE       --MAIKQ-PKGKTVRRLGVNIYGN-----PKYDKLLDRKPNGPG--------KERGA---
RS4_TREPA       --MAVKR-ARGKIVRRLGINIFGN-----PKYTRLLGKKPAPPG--------KEHGV---
RS4_BORAP       --MNRKQIAKGKLVRRFGINIFEQ-----PKYDKILKKKPHPPG--------M-HGK---
RS4_RHOBA       --MARYTGPKARINRRLGTMLYET-----AGAARAMDRRPQPPG--------MHTRG---
RS4_BACCR       --MARYTGPAWKLSRRLGISLSGT---GKELEK---RP--YAPG--------PHG-P---
RS4_BACSU       --MARYTGPSWKLSRRLGISLSGT---GKELEK---RP--YAPG--------PHG-P---
RS4_BACSK       --MSRYTGPSWKLSRRLGVSLSGT---GKELAK---RP--YAPG--------QHG-P---
RS4_ALKHC       --MARYTGPTWKISRRLGISLSGT---GKELQK---RP--YAPG--------QHG-P---
RS4_GEOKA       --MARYTGPMWKISRRLGISLSGT---GKELQK---RP--YPPG--------QHG-P---
RS4_OCEIH       --MARYTGSVWKKSRRLGISLTGT---GKELDK---RP--YAPG--------QHG-P---
RS4_STAHJ       --MARFRGSNWKKSRRLGISLSGT---GKELEK---RP--YAPG--------QHG-P---
RS4_STAS1       --MARFRGSNWKKSRRLGISLSGT---GKELEK---RP--YAPG--------QHG-P---
RS4_LISMO       --MARYTGPSWKVSRRLGISLSGT---GKELER---RP--YAPG--------QHG-P---
RS4_LACDB       --MSRYTGPSWKRSRRLGISLSGT---GKELAR---RS--YIPG--------QHG-P---
RS4_LACAC       --MSRYTGPSWKRSRRLGISLSGT---GKELAR---RN--YAPG--------QHG-P---
RS4_LACGA       --MSRYTGPSWKRSRRLGISLSGT---GKEISR---RN--YAPG--------DHG-P---
RS4_LACP3       --MSRYTGPRWKQSRRLGLSLSGT---GKELAR---RP--YAPG--------DHG-A---
RS4_ENTFA       --MSRYTGPSWKVSRRLGISLSGT---GKELAR---RP--YKPG--------QHG-P---
RS4_LACSS       --MSRYTGPKWKLSRRLGISLSGT---GKELAR---RP--YAPG--------QHG-N---
RS4_LACPL       --MSRYTGPSWKISRRLGMSLSGT---GKELAR---RP--YAPG--------DHG-Q---
RS4_PEDPA       --MSRYTGPSWKVSRRLGISLTGT---GKELAR---RP--YAPG--------DHG-Q---
RS4_LEVBA       --MSRYTGPSWRISRRLGVSLSGT---GKELNR---RP--YAPG--------DHG-Q---
RS4_LACS1       --MSRYTGPSWKVSRRLGFSLSGT---GKELSR---RP--YAPG--------QHG-Q---
RS4_LEUMM       --MSRYTGPKWRISRRLGVSLSGT---GKELSR---RA--YAPG--------DHG-A---
RS4_OENOB       --MSRYTGPKWRLSRRLGISLSGS---GKELAR---RP--YAPG--------DHGNT---
RS4_LACLA       --MSRYTGPSWKQSRRYGISLSGS---GKEIAR---RN--YVPG--------QHG-P---
RS4_STRMU       --MSRYTGPSWKKSRRLGLSLTGT---GKELAR---RN--YVPG--------QHG-P---
RS4_ONYPE       --MSRYTGSLWKVSRRLNYSVSET---GKELRK---RA--YGPG--------QHG-----
RS4_MYCMS       --MSRFIGSTFKKSRRFGFSILET---GKEFSKGKKRI--TTPG--------QHGKE---
RS4_MESFL       --MSRYTGSTFKKARRYGFSILEN---GKEFSKGKKRV--TTPG--------QHGKD---
RS4_MYCGE       ---MKYTGSIFKRSRRLGFSLLEN---NKEFSKGKKRK--SIPG--------QHGNR---
RS4_MYCPN       ---MKYTGSIFKRSRRLGFSLLEN---NKEFSKGKKRK--TIPG--------QHGNR---
RS4_MYCGA       --MSRYTGSIYRKARRLNFSILES---GKEFTNNKSKKGVKVPG--------QHGSL---
RS4_MYCPE       --MSRYLGSITKKSRRYGFSLLET---EREFIKGKKRT--YAPG--------QHGN----
RS4_UREPA       --MSRYTGSIYKKSRRLGFSLLEN---NKEFNSGKKRT--YGPG--------QHGN----
RS4_MYCHJ       --MSRYTGSIFRKSRRLGFSILET---GKEFAKGKQRR--YAPG--------LHGL----
RS4_MYCMO       --MSRYVGPVFKRSRRFGFSILET---GKEFVKGKQRQ--YAPG--------QHGQ----
RS4_MYCPU       --MSRDRSSLFKKSRRLGFSVLEN---EKEFNKGKKRN--YAPG--------QHGQ----
RS4_MYCS5       --MSRYTGPLFKKSRRFGYSILET---NKEFSKGRKRT--YAPG--------QHGN----
RS4_TRIV2       --MSRYRGPRLRIVRRLG--DLPGLTRKSAR------------------RAYPPGQH---
RS4_TRIEI       --MSRYRGPRLRIVRRLG--DLPGLTRKSAR------------------RAYPPGQH---
RS4_SYNY3       --MSRYRGPRLRIVRRLG--ELPGLSRKSPR------------------RAYPPGQH---
RS4_THEEB       --MARYRGPRLRIVRRLG--ELAGLTRKVPK------------------RSYPPGQH---
RS4_PROMA       --MSRYRGPRLRITRRLG--DLPGLTRKAAK------------------RSNPPGQH---
RS4_PROM5       --MSRYRGPRLRVTRRLG--ELPGLTRKASK------------------KSNPPGQH---
RS4_SYNS9       --MSRYRGPRLRITRRLG--DLPGLTRKAAK------------------RSYPPGQH---
RS4_SYNE7       --MSRYRGPRLRIVRRLG--DLPGLTRKAAR------------------RSYPPGQH---
RR4_CYAPA       --MSRYKGPSLRIIRRLG--ELPGLTRKVVKK-----------------RKYPPGQH---
RR4_PYRYE       --MSRYRGPRVRISRRLG--DLPGLSRKAIK------------------RSYPPGEH---
RR4_GRATL       --MSRYRGPRLRISRRLG--DLPGLTRKISK------------------KLSPAGEH---
RR4_EMIHU       --MARYRGAKLRITRRLG--DLPGLTSKIAK------------------RTSRPGQH---
RR4_NEPOL       --MSRYRGPRLKIVRRLG--ELPGLTRKMAK------------------RKSPPGQH---
RR4_NYMAL       --MSRYRGPRFKKIRRLG--ALPGLTSKKP----------------RS-ASDLRNQS---
RR4_ACOCL       --MSRYRGPRLKKIRRLG--ALPGLTSKGT----------------RP-GSDLRNQF---
RR4_PIPCE       --MSRYRGPRFKKIRRLG--ALPGLTSKRP----------------RS-ESSLRSQP---
RR4_PHAAO       --MSRYRGPRFKKIRRLG--VLPGLTSKRP----------------RS-RSDLQTQL---
RR4_CUCSA       --MSRYRRPRFKKIRRLG--ALPGLTSKRP----------------KT-GNDLKNQS---
RR4_LOTJA       --MSRYRGPRFKKIRRLG--ALPGLTSKRP----------------TV-GSELRNQS---
RR4_PHAVU       --MSRYRGPCFKKIRRLG--YLPGLTSKKP----------------TV-KNELRNQL---
RR4_VITVI       --MSRYRGPRFKKIRRLG--ALPGLTSKRP----------------RA-GSDLRNQS---
RR4_OENEH       --MSRYRGPRFKKIRRLG--ALPGLTSKRP----------------RA-GSDPRNQE---
RR4_SPIOL       --MSRYRGPRFKKIRRLG--ALPGLTNKRP----------------RA-GSDLRNQS---
RR4_JASNU       --MPRYLGPRFKKIRRLG--ALPGLTNKSP----------------KA-GSDLRKQP---
RR4_SORBI       --MSRYRGPRLKKIRRLG--ALPGLTRKTP----------------KS-GSNQKKKF---
RR4_EPIVI       --MSRYRGPSLKKIRRLG--ALPGLTNKRS----------------KA-ENDFIKKL---
RR4_PELHO       --MSRYRGPRVKKIKRLG--SLPGLTTKKPP---------------IV-VRDPRKLS---
RR4_PSINU       --MESDQS------KVES--DQSKMESDQS----------------KV-ESDQ-SIS---
RR4_ANGEV       --MSRYRGPRLRLIRRLK--DLPGLTNKTL----------------KS-KKAQIAID---
RR4_MARPO       --MSRYRGPRVKIIRRLG--ALPGLTNKTLKL-------------KSG---YINQ-----
RR4_PHYPA       --MSRYRGPRVRIIRRLG--VLPGLTNKTPQL-------------KSS---SANQ-----
RR4_ANTAG       --MSRYRGPRVRIIRRLG--TLPGLTSKTPES-------------KPS---YINQ-----
RR4_HUPLU       --MSRYRGPRLKIIRRLG--ELPGLTRKTPKL-------------KPD---YINK-----
RR4_PINKO       --MSRYRGPRLKIIRRLK--TLPGLTSKRPKN-------------RKD-SMNMNR-----
RR4_PINTH       --MSRYRGPRLKIIRRLK--TLPGLTSKRPKN-------------RKD---SMNR-----
RR4_CHAGL       --MSRYRGPRIKIIRRLG--ILPGLTRKIPKK-------------SMK-LRSLSLQ----
RR4_STAPU       --MSRYRGPRLKIIRRLNT-PLPGLTSSPIVN-------------STV-----NTK----
RR4_ZYGCR       --MSRYRGPRVKIVRRLG--PLPGLTTKRRKL-------------TEQ-----NKL----
RR4_CHAVU       --MSRYRGPRLKIVRRLG--PLPGFTQKLYKS-------------KSQ-YLGSSTTS---
RR4_MESVI       --MSRYRGPRLKIVRKLG--DLPGLTSKINKN-------------LQL-AEQNKGK----
RR4_CHLAT       --MSRYRGPRLKIVRRLG--DLPGFTNKIQKR--------------QA-STQNKGK----
RR4_OLTVI       --MSRYRGPRLRIIRRLG--ELPGFTSKTTTR-------------TSS-PGQHGGSN---
RR4_TUPAK       --MSKYRGPRLRLVRKLG--KLPGLTSKISKK-------------TNT-PGEHGQPQ---
RR4_CHLVU       --MARYRGPKLRIVRRLG--ELPGLTQKNCTR-------------DFP-PGQHGPKKKGG
RR4_TRICV       --MSRYRGPKLRITRRLG--ALPGLTQKQSKK-------------KGR-PGQHGKSN--E
RR4_THAPS       --MSRYRGPKLRITRRLG--DLPGLTQKKSKK-------------TTR-PGQHGK-N--L
RR4_PHATC       --MSRYRGPKLKISRRLG--TLPGLTTKKSNK-------------LNR-PGKDGN-----
RR4_EUGLO       --MVRYLGPHVKVIRKLG--SLRAFTKKKIK------------------RYFKLDTKKRK
RR4_EUGGR       --MSRYRGPRLRIVRRIG--KLPSLTNKTSK------------------KRKSPGQPATS
RR4A_CYACA      --MSRYTGPKIRIIRRLG--ELPALTTKKVK------------------NNYPPG---RE
RR4_BIGNA       --MARYRGSRVKVIRRLG--LLPGFTSKSSN------------------KPQNNN-----
RR4_CHLRE       --MSRYLGPRLRVIRRIG--KLRGFTRKKPFRRVFKGFGGFKGKVIPP-GQHGLTKLLKT
RR4_TETOB       --MSRYIGPRLRIIRRIG--KLRGFTRKKPFRRSFRGRGALQGKVIPP-GQHGLTKLFKS
RR4_CYAM1       --MSRYLGPRVRIIRRLG--ILPAFTNKSPNKRTGV-----------P-GEHA----HKT
RS4_SYNJA       --MSRYTGPRLKIIRRFGGLDLPGLTRKRPK------------------NTNPPGMHG-A
RR4_OSTTA       --MARYRGPRVKIVRRLG--ELPGLTTKIPN------------------RNYPAGQHG-P
RS4B_NITEU      --MSRFTGPRLKIMRALGV-DLPGLSRKTIAS-----------------RPTPPGQHG-A
RS4_METFK       --MSRFTGPRLKVMRALGI-DLPGLSRKTIEA-----------------RPTPPGQHG-A
                              :                                             

RS4_ARTS2       -ARKKQDSDYAVRLREKQRLRAQYGIR-EAQMTRAFEEARRTK-GLTGENLIELLEMRLD
RS4_LEIXX       -TKRKADSDYAVRLREKQRLRAQYGIL-EKQLRIAFEEARRTQ-GLTGENLVEILEMRLD
RS4_TROWT       -FRRKGDSDYAVRLREKQRLRGQYGLR-EKQLASVYHEARRVK-GLAGENLVEMLEMRLD
RS4_BIFAA       -TRRRTESDYAVRLREKQRLRAQYGIS-EKQLRAAYEKGTHTA-GQTGNAMLTDLETRLD
RS4_STRCO       -GR-KQNSDYKVRLLEKQRLRAQYDLS-ERQLVRAYERASKTN-MKTGEALVIELERRLD
RS4_THEFY       -RVRRSTSDYAVRQAEKQKLRWYYDLS-EKQLARVYENAKKRP-GRTGEEMIAELELRLA
RS4_RHIME       -RRKSKLSDFGVQLRAKQKLKGYYGDIREKQFRAIFAEASRRK-GDTPENLVGLLESRLD
RS4_AGRFC       -RRKGKMSDFGTQLRAKQKLKGYYGELREKQFRATFDEANRRK-GDTSENLISLLESRLD
RS4_CHESB       -RRKGKLSDFGQQLRAKQKLKGYYGDLSEKQFRRIYDEANRRK-GETTENLIGLLESRLD
RS4_BRUSU       -RRKGKLSDFGVQLRAKQKLKGFYGDISEKQFRKTYEEAARRK-GDTGENLIGLLESRLD
RS4_RHILO       -RRKGKLSDFGLQLRAKQKLKGHYGDVSEKQFRKVYEEADRRK-GDTSENLIGLLESRLD
RS4_BARBK       -RRKGKLSDYGVQLCAKQKLKGFYGDISEKQFRKIYQEAVRRR-GDTGENLIGLLESRLD
RS4_RHOS1       -RRKNKLSDFGTQLRAKQKLKGYYGDLTEKQFRKIFAEAERVK-GDTGEMLVGLLERRLD
RS4_PARDP       -RRKGKLSDFGTQLRAKQKLKGYYGDLTEKQFRRIYAEAERVK-GDTGENLIGLLERRLD
RS4_JANSC       -RRKGKLSDFGLQLRAKQKLKGYYGDLTEKQFRRIYAEAERLR-GDTGEFLIGLLERRLD
RS4_ROSDO       -RRKGKISDFGIQLRAKQKLKGYYGDLTEKQFRRIYAEAERVK-GDTGENLIGLLERRLD
RS4_RHOPB       -RRKGKLSDFGVQLRAKQKLKGYYANISERQFHSIYVEATRLK-GDSGENLIGLLERRLD
RS4_BRADU       -RRKGKLSDFGVQLRAKQKLKGYYANISERQFHGIYVEASRLK-GDTGENLIGLLERRLD
RS4_CAUVC       -RRKSKVSDFGLQLRAKQKLKGYYGNLTEKQFSRTYEEAARRK-GNTSENLIALLESRLD
RS4_MARMM       -RRKTKMSDFGLQLMAKQKLKGYYGNITEKQFRRTYDEASRRK-GNTAELLIGLLESRLD
RS4_HYPNA       -NRRNKVSDFGMQLMAKQKLKAYYGDITEKQFAKTYVEAARMK-GNSAENLIGLLESRLD
RS4_ERYLH       -RRKGKTSDFGLQLRAKQKLKGYYGDVTEKQFRRTYAEASRMK-GDTGQNLIGLLEQRLD
RS4_NOVAD       -RRKSKVSDFGIQLRAKQKLKGYYGDVTEKQFKRTYQEASKMK-GDTGQNLIGLLEQRLD
RS4_SPHAL       -RRKGKMSDFGIQLRAKQKLKGYYGDITEKQFKKNYIEASRMK-GDTGQNLIGLLERRLD
RS4_ZYMMO       -RRRSKISDYGLQLKAKQKLKGYYGDVTEKQFRRSYDDASKLK-GDTSQNLIGILERRLD
RS4_GLUOX       -RRKQKPSDFSIQLMAKQKLKGYYGNISEKQFRKYYDEAVRRK-GDTSENLIGLLERRLD
RS4_GRABC       -RRKGKPSDFGIQLMAKQKLKGYYGNISEKQFRKYYEEAVRRK-GDTSENLIELLERRLD
RS4_MAGSA       -RRK-KPSDFGTQLMAKQKLKGYYGNISEKQFRRLYDEAVRRR-GDTSENLIGLLECRLD
RS4_RHORT       -RRR-KPSDFGIQLMAKQKLKGYYGNISEKAFRKYYEEASSRR-GDTSENLISILETRLD
RS4_PELUB       -GRKGKPSDYGIQLQAKQKLKGYYGNINERQFRNIYKKATMLK-GDTGENLIGLLERRLD
RS4_RICTY       -NTMIKTSDYGLHLKAKQRLKCYYGRVTEKQFRNTFALAQRMQ-GNTGENFIGLLESRLD
RS4_RICBR       -NTMVKTSDYGLHLKAKQRIKCHYGRITEKQFRNIFGFAQKMK-GNTGENFIGLLESRLD
RS4_ANAMM       -MGYKKLSSFGRQFAAHQKFKCYYA-MSSKQLTNTFLRAYNRK-GDTGDNLVGALESRLA
RS4_ANAPZ       -MGYKKLSSFGRQFVAHQKFKCYYV-VSSRQLRNVFLKAYRKK-GDTGDNLVGALESRLA
RS4_EHRCR       -MGYKKPSDFGKQFAAHKKFKFYYA-INSKQMRNIFLKAYKKR-GDTGDNFVGLLESRLS
RS4_EHRRW       -MGYKKPSDFGKQFGAHKKFKFYYA-ISSKQMRNMFLKAYKKK-GDTGDNFVGLLESMLS
RS4_WOLTR       -LGFKRLSDFGKQFAAHKKFKFYYA-ISSKQLRRIFLDAYNRK-GYTADNFIGILESRLS
RS4_CHLAB       -QRK-KKSDYGLQLEEKQKLKACYGMILEKQLVKAFKEVVNKQ-GSVTKMFLERFECRLD
RS4_CHLPN       -QRK-KKSDYGLQLEEKQKLKACYGMIMEKQLVKAFKEVIHKQ-GNVAQMFLERFECRLD
RS4_CHLMU       -QRK-KKSDYGLQLEEKQKLKACYGMILEKQLVKAYKEVVHKQ-GNVAQMFLEKFECRLD
RS4_PARUW       -RRR-KKSDFGLQLEEKQKLKAIYGMLSEKQLVAYYKKALRLE-GNTASHFAEMLECRLD
RS4_AQUAE       --RRKKLTEYGLRLMEKQKLKFLYGGLREKQFKKYFDMASKSK-ENTGEMLLQYLERRLD
RS4_LEPBL       --RKGKVSEYGTQLREKQKLKRAYGLL-EKQFRNYYEEASHSH-GVTGEILLQLLERRLD
RS4_ACIBT       -ARGGKQSEYSLQLREKQKVRRIYGVL-ERQFSNYYKEAARVK-GATGENLLKLLESRLD
RS4_PSYCK       -SRN-KSSEYSLQLREKQKVKRIYGVL-ERQFANYYKEAARKR-GATGENLLAMLESRLD
RS4_ECOLI       -RKP-RLSDYGVQLREKQKVRRIYGVL-ERQFRNYYKEAARLK-GNTGENLLALLEGRLD
RS4_HAES1       -RKP-RLSDYGSQLREKQKVRRIYGIL-ERQFRNYYKEANRLK-GNTGENLLVLLEGRLD
RS4_SHELP       -RKA-RLSEYGVQLREKQKVRRTYGVL-EKQFRNYYKDAARLK-GNTGENLLTLLETRLD
RS4_AERS4       -RKA-RLSDYGVQLREKQKVRRIYGVL-EKQFRNYYRDAARQK-GNTGENLLQLLEGRLD
RS4_PSEA6       -RRG-RLSDYGVQLREKQKVRRMYGVL-EKQFRNYYKEAARLK-GNTGENLLQLLEQRLD
RS4_VIBCH       -RRG-RLSEYGVQLREKQKVRRIYGVL-EKQFRNYYKEAARLK-GNTGENLLQLLEGRLD
RS4B_PSYIN      -RKP-RLSDYGLQLREKQKVRRMYGVL-EKQFRNYYKESARLQ-GNTGENLLQLLEGRLD
RS4_COLP3       -RRG-RLSDYGVQLREKQKVRRIFGVL-EKQFSNYYKEAARQK-GNTGENLLQLLETRLD
RS4_PSET1       -RKG-RLSDYGLQLREKQKVRRIYGVL-EKQFRNYYKEAARLK-GNTGENLLQLLEQRLD
RS4_PSEAB       -RRG-RLSDYGLQLREKQKVRRIYGVL-ERQFRGYYQEASRRK-GSTGENLLQLLECRLD
RS4_PSEE4       -RRG-RQSDYGTQLREKQKVRRIYGVL-ERQFRGYYQAAASKK-GATGENLLQMLECRLD
RS4_SACD2       -RRG-RLSDYGVQLREKQKVRRIYGVL-EKQFRNYYKDAARIK-GATGENLLKLLEGRLD
RS4_HAHCH       -RRG-RLSDYGLQLREKQKVRRMYGVL-EKQFRNYYKEAARIK-GATGENLLQLLERRLD
RS4_MARHV       -RRG-RLSEYGVQLREKQKVRRIYGVL-EKQFRNYYKEAARGK-GATGENLLQLLEGRLD
RS4_ALCBS       -RPA-RLSDYGVQLREKQKVRRTYGVL-EKQFRSYYKKAAASK-GATGEVLLQLLEGRLD
RS4_CHRSD       -RRQ-RLSDYGLQLREKQKVRRMYGVL-EKQFRNYYKEAARLK-GATGELLLQLLESRLD
RS4_HYDCU       -GRK-RVTEYGLQLREKQKVRRIYGVL-EKKFRLYYKEADRRK-GSTGVNLLQLLESRLD
RS4_ALKEH       -RRT-RMSDYGLQLREKQKVRRMYGVL-ERQFRNYYKEAARQK-GATGTVLLQLLESRLD
RS4_HALHL       -RRGGRMSDYGLQLREKQKVRRMYGIM-ERQFRNYYKEAARRK-AATGTALLQLLESRLD
RS4_NITOC       -ARRARMSDYALQLREKQKLRRMYGVL-ERQFRRYYKEAARRK-GSTGENLLKLLESRLD
RS4_FRATO       --RRARLSDYGLQLREKQKVRRMYGIL-EGQFKKYYVEASRRK-GNTGATLLELLESRLD
RS4_PARXL       -TSGARTSDYGTQLREKQKVKRIYGVL-ERQFRRYFAEADRLK-GNTGENLLQLLESRLD
RS4_RALSO       -TSGARTSDYGNQLREKQKVKRIYGVL-ERQFRRYFAEADRRK-GNTGENLLQLLESRLD
RS4_BORA1       -TSGARTSDYGLQLREKQKLKRMYGVL-EKQFRKYFAEAERRR-GNTGETLIQLLESRLD
RS4_POLSJ       -TSGTRTSDFGLQLREKQKVKRMYGVL-EKQFRRYFEEADRRK-GNTGANLLFILESRLD
RS4_RHOFT       -TSGARTSDFGLQLREKQKVKRMYGVL-EKQFRRYFEEADRRK-GNTGANLLSLLESRLD
RS4_VEREI       -TSGARTSDYGLQLREKQKVKRMYGVL-EKQFRRYFEAAESRK-GNTGANLLFLLESRLD
RS4_METPP       -TSGSRTSDFGLQLREKQKVKRMYGVL-ERQFRRYFAEAERRK-GNTGANLLLLLESRLD
RS4_NEIMF       -KK-PRLSDYGLQLREKQKIRRIYGVL-ERQFRRYFAEADRRK-GSTGELLLQLLESRLD
RS4_CHRVO       -RR-GRLSDYGVQLREKQKIRRIYGVL-ERQFRNYFAEAVRRK-GSTGENLLKLLESRLD
RS4_METCA       -KR-PRLSDYAAQLREKQKLRRIYGIM-ERQFRNYYAEASRRK-GSTGENLLTLLESRLD
RS4_BUCAI       --RKPRLSDYAIQLREKQKVRRLYGVL-ERQFKIYYKLAASLK-GNTGANLLQLLESRLD
RS4_BUCAP       --RKPRLSDYAIQLREKQKVRRLYGVL-ERQFRIYYKKASRSK-GNTGENLLQLLERRLD
RS4_BAUCH       --RKPRLSDYGLQLREKQKVRRIYGIL-ERQFRNYYQEAARLK-GNTGESLLQLLESRLD
RS4_BLOFL       --RKSRLSDYGVQLREKQKVKRMYGIL-ENQFANYYRKSASMK-GNTGEILLQLLESRLD
RS4_BLOPB       --RKSRFSDYGIQLREKQKVRRIYGIL-ERQFSNYYKRAARIK-GNTGENLLKLLESRLD
RS4_BUCBP       --KRQRLSDYGVQLREKQKVRRLYGIL-EAQFRNYYKHASRLK-GNTGENLLFLLENRLD
RS4_WIGBR       --RRSRLSDYGIQLREKQKLRRMYVIL-ERQFKKYYKKAVRMK-GNTGENLLILLESRLD
RS4_BUCCC       --RKLRLSEYAKQLREKQKLRRLYGIL-EKQFHNYYKKASKLK-GNTGQNLLFLLESRLD
RS4_RUTMC       -ARRQKGTEYGLQLREKQKVRRIYGIL-EKQFRLYYKKASQKK-GSTGENLLSLLECRLD
RS4_LEGPA       --KKPRLNSYGIQLREKQKIRRLYGIL-EKQFRNYYKKAARQK-GSTGENLMALLERRLD
RS4_COXBU       --RRGRTTDYGVQLRMKQMIKRYYDVL-EKQFANYYKQADRLK-GSTGDNLLKLLESRLD
RS4_XANOM       -SRKGKLSDYATQLREKQKVKRIYGLL-ERQFRNYYKKASTKK-GNTGENLLQLLETRLD
RS4_XYLFT       -VRKSKLSDYASQLREKQKVKRIYGVL-ERQFRNYYKNASTKK-GNTGENLLQLLETRLD
RS4_AROAE       -RSGQRMSGYGVQLREKQKIRRLYGVL-EAQFRKVYAEAERRR-GQTGENLLQLLEGRLD
RS4_AZOSB       -RSGQRLSGYGVQLREKQKIRRLYGVL-ERQFRKVYAEADRRR-GQTGENLLQLLEGRLD
RS4_DECAR       -KSGARLSDYGVHLRAKQKIRRVYGVL-EGQFRKTFAEADRRK-GQTGENLLQLLEARLD
RS4_THIDA       -KSGARLSGYGVQLREKQKIRRIYGVL-EGQFRLTYKRADSRK-GVTGENLLSMLESRLD
RS4_NITMU       -KSG-RLSDYGVQLREKQKLRRIYGVL-ERQFRNGYELAERQR-GVTGENLLQLLECRLD
RS4_NITEC       -RKT-RLSDYAVQLREKQKIRRIYGLL-ENQFRNVYKRADRQK-GITGENLLKLLESRLD
RS4_MAGMM       -RRR-KVSDYGVHLREKQKVKRSYGLL-EAQFRTLYKKAERMK-GVTGENLLQLLERRLD
RS4_DESVV       -ARKKV-SDYAVQLREKQKVRRMYGIL-EQQFHAYFTKADMAK-GVTGANLLSLLERRLD
RS4_DESAG       -ARKKN-SDYAVQLREKQKVRRMYGLL-EKQFHSYFVKADMSK-GVTGSNLLSILERRLD
RS4_LAWIP       -VRKKM-SDYAIQLREKQKVRRVYGVL-EKQFREYFVHADMAK-GITGVNLLSYLERRLD
RS4_GEOSL       -GRPKV-SNYGVQLREKQKVRRIYGIL-EKQFRSYFQEADRLK-GVTGENLLSLLERRLD
RS4_PELPD       -GRTKN-SAYGIQLREKQKVRRIYGLM-ENQFRGYFAEADRMK-GVTGENLLSLLERRLD
RS4_PELCD       -GRTKV-SDYGTQLREKQRMKRTYGLL-EKQFRAYFDKADSMK-GVTGENLLVLLERRLD
RS4_SYNFM       -GRGKF-SDYGLQLREKQKIRRMYGLV-EKQFKTYFKHADRQK-GVTGTNFLTLLERRID
RS4_ANADE       -GRTKF-SEYGVQLREKQKVKRMYGLL-EAGFRHAYQNAAAAK-GKTGENLLQTLELRLD
RS4A_MYXXD      -GRVKF-SGYGVQLREKQKVKRMYGLL-ENQFRGYYHRASAAK-GKTGDNLLQQLELRLD
RS4_SYNAS       -LRRKQPSDYGVQLREKQKLKRMYGLL-EKQFRGYFEKADKKK-GITGTNLLLYLERRLD
RS4_DESPS       -ARFKKVSDYAVQLREKQKVKSMYGVL-EAQFRLTFEKAEAQK-GVAGENLLILLERRLD
RS4A_BDEBA      -SRLKF-SEFALQLREKQKAKRYYGVS-EKQFVKYVGEANRAK-ELTGHALLKFLETRLD
RS4_CARHZ       -TR-KKPTEYALQLREKQKAKRIYGVL-EAQFRRYFEMAERQP-GITGENLLVILERRLD
RS4_ACET2       -NK-KKLSEYGLQLREKQKARRYYGIL-EGQFRRYFEMAVKKK-GITGENLLQILESRLD
RS4_DESHY       -SRGKKPTEYGIQLREKQKVRRIYGVQ-EKQFRSYYDKANRQK-GIVGENLLRLLERRLD
RS4_MOOTA       -GRK-KVSEYGLQLREKQKVRRIYGIL-ERQFRNYFEKAERQK-GVTGENLLILLERRLD
RS4_SYNWW       -GRRQKPSEYGIQLREKQKTRRIYGIQ-EKQFRNYFRKADRKQ-GITGDNLLVLLERRLD
RS4A_CLOAB      -SR-KKISNYGLQLREKQKAKRIYGVL-EKQFRIYYKRAERIK-GISGENLLKLLELRLD
RS4_CLOTE       -SR-KKISNYGLQLREKQKAKRIYGVL-EKQFRTYYKRADKAR-GITGENLLVLLEMRLD
RS4A_CLOPS      -SR-KKLSNYGTQLREKQKAKRIYGVL-EGQFRNTYERAEKMR-GIAGENLLKLLEMRLD
RS4A_CLONN      -GR-KKLSNYGVQLREKQKARRIYGIL-EAQFRKYYEKAETMR-GITGENLLKLLEMRLD
RS4_CLOD6       -GR-KKVSNYGLQLREKQKVKRIYGVL-ETQFRNLYERAENMP-GKAGENLLSLLERRLD
RS4_CALS4       -EK-KKLTQYGMQLREKQKLKRYYGIL-ERQFVRYYERAERMR-GITGENLLQLLERRLD
RS4_GLOVI       -ARQKL-SEYAIRLKEKQKARWSYGVL-EKQFRRTFSDASRAT-GNTGAKFLELLERRLD
RS4A_SYMTH      -SRRKP-TEYAIQLREKQKARRYYGVL-ERQFERYFEMASRKK-GVTGEVLLQTLERRLD
RS4_SOLUE       -DRAKKIVGYGLQLREKQKVRRVYGVL-ERQFRNAFEKAALQK-GITGENLMQNLERRLD
RS4_DEHMC       -GRPRRLSDRGQQLRQKQSIRWSYGMT-ERQFRRFFGLANAQP-GVTGDNMMILLERRLD
RS4_THEMA       -RR-TKLTQYGIQLRAKQTVKRIYGIL-ERQFERYVEKAMQKA-GDTRENLIQILEARLD
RS4_DEIGD       -RGRGRPSDYSVRLREKQKLARLYGVN-EKQFRNLFEEAANVP-GVTGTVFLQLLERRLD
RS4_THET8       -RAR-RPSDYAVRLREKQKLRRIYGIS-ERQFRNLFEEASKKK-GVTGSVFLGLLESRLD
RS4_CAMFF       --RKTKISEYGLQLREKQKAKFMYGVS-EKQFRRLFSEAARRE-GNTGALLIGLLEQRLD
RS4_HELHP       --KRGKISEYGLQLREKQKAKIMYGVS-EKQFRALFKEANRQE-GNTGENLVRIIEQRLD
RS4_SULDN       --RRKKVSEYGLQLNEKQKAKFMYGVS-EKQFRALFVEAKRRE-GNTGTNLVTLIEQRLD
RS4_WOLSU       --RRSKISEYGLQLREKQKAKFMYGIS-EKQFRSIFQEANRLE-GNTGELLIKLLERRLD
RS4_HELPY       --RRAKTSDYGLQLKEKQKAKMMYGIS-EKQFRSIFVEANRLD-GNTGENLIRLIERRLD
RS4_CHLCH       --RKGKISEYALQLREKQKMKYLYGIL-EKQFRNYYKKAVAQR-GVTGDNLVKLLERRLD
RS4_CHLL3       --RRGKISEYALQLREKQKMKYLYGIL-EKQFRNYYKKAVSQR-GVTGDNLVKLIERRLD
RS4_CHLPD       --RKGKISEYALQLREKQKMKYLYGVL-ENQFRSYYRKAVSQR-GVTGDNLVKLLERRFD
RS4_CHLTE       --RRGKVSEYALQLREKQKMKYLYGIL-EKQFRNYYKKAVAQR-GVTGDNLVKMLERRLD
RS4_CORGL       --ARIKESEYLLQLQEKQKARFIYGVM-EKQFRRYYAEANRRA-GKTGENLVVLLESRLD
RS4_CORJK       --ARIKESEYLLQLQEKQKAKYTYGVL-EKQFRRYYAEANRRP-GKTGDNLVILLESRLD
RS4_MYCUA       --ARIKDSEYRQQLQEKQKARFTYGVM-EKQFRRYYEEAVRHS-GKTGEELLKILESRLD
RS4_MYCVP       --ARIKESEYRTQLQEKQKARFTYGVM-EKQFRRYYEEANRLP-GKTGDNLLRILESRLD
RS4_NOCFA       --ARIKESEYLLQLQEKQKARFSYGVM-EKQFRRYYEEANRQK-GKTGDNLLRLLETRLD
RS4_RHOJR       --ARIKESEYLLQLQEKQKARFTYGVM-EKQFRLYYKEANNRP-GKTGENLLRILESRLD
RS4_SACEN       --ARIKETEYLLQLQEKQKAKFTYGVL-ERQFRSYYEEANRRP-GKTGDNLLQVLECRLD
RS4_NOCSJ       --GRIKESEYLLQLREKQKARFTYGVL-EKQFHNYYTEASRRA-GKTGDNLLQLLECRLD
RS4_CUTAK       --GRTKDSEYSLQLREKQKARYAYGVL-EKQFRRYYEEADRAQ-GKTGDVLLQILESRLD
RS4_FRACC       --GRTKDSEYLLQKREKQKCARIYGVL-EKQFRGYYDEANRRA-GKTGDELLKILESRLD
RS4_ACIC1       --TRAKESEYLLQLREKQKCARIYGVL-EKQFRRYYEEASRKT-GRTGENLLRILESRLD
RS4_RUBXD       --DRQRQTEYGLRLMEKQKARWYYGVS-ERQFRRAYEEAIRQP-GVSGENLLRLMELRMD
RS4_FUSNN       ----KKPTEYATQLREKQKAKFIYNVM-EKQFRKIYEEAARKL-GVTGLTLIEYLERRLE
RS4_BACTN       -RKR-KTSEYGVQLREKQKAKYTYGVL-EKQFRNLFEKAATAK-GITGEVLLQLLEGRLD
RS4_PORGI       -RRR-KTSEYGLQLREKQKAKYTYGVL-EKQFRHLFHRAQRAK-GVTGELLIQFLEARLD
RS4_CYTH3       -KKR-KQSEYSIQLKEKQKAKYTYGVL-ERQFAKTFDTAARKQ-GITGENLLKMLEARLD
RS4_GRAFK       -RRRGKKSEYAIQLMEKQKAKYTYGIL-ERQFRNMFEKATRAQ-GITGEVLLQLCESRLD
RS4_SALRD       -RRR-RESEYAVQLKEKQKTKYTYGLL-ERQFKNLFDKASRMQ-GVTGEKLLILLEARLD
RS4_TREDE       -RKRGKTSVYGEQLKEKQKFRFAYGIS-ERQFRNLYKKASRMP-GVTGDNMISLMEQRLD
RS4_TREPA       -KQRAKVSVYGEQLKEKQKFRFAYGMS-ERQFRNLFAQAHRMK-GVTGNNMLSLMERRLD
RS4_BORAP       -ARKAKITEYGKQLIEKQKIKFTYGVS-ERQLPNTFKEAKKHH-GVTGYNLLSILETIID
RS4_RHOBA       -RRP---SNYGAALMEKQKIKHYYGLG-ERQLRRYFENVGRKS-GNTGELLLLMCERRLD
RS4_BACCR       -NQRKKLSEYGLQLQEKQKLRHMYGMT-ERQFRRTFDQAGKMP-GKHGENFMILLEARLD
RS4_BACSU       -GQRKKLSEYGLQLQEKQKLRHMYGVN-ERQFRTLFDKAGKLA-GKHGENFMILLDSRLD
RS4_BACSK       -NQRKKLSEYALQLHEKQKLRHMYGVN-ERQFLRTFNDAGKMN-GIHGENFMILLESRLD
RS4_ALKHC       -NQRKKLSEYGLQLQEKQKLRHMYGVN-ERQFRRIFNDAGKMA-GIHGENFMILLESRLD
RS4_GEOKA       -GQRRKLSEYGLQLQEKQKLRHMYGVN-ERQFRKTFEEAGKMP-GKHGENFMILLESRLD
RS4_OCEIH       -NQRRKLSEYGLQMQEKQKLRFMYGLN-ERQFRTLFDKAGKMK-GIHGENFMILLESRLD
RS4_STAHJ       -NQRKKLSEYGLQLREKQKLRYLYGMT-ERQFRNTFDIAGKQH-GVHGENFMILLASRLD
RS4_STAS1       -NQRKKLSEYALQLREKQKLRYLYGMT-ERQFRNTFEIAGNQH-GVHGENFMQLLAARLD
RS4_LISMO       -TQRKKISEYGLQQAEKQKLRHMYGLT-ERQFKNTFNKAGKLR-GKHGENFMILLEQRLD
RS4_LACDB       -NHRGRLSEYGMQLQEKQKLRWMFGLN-ERQFRTLFARAGKIREGQHGTNFMILLERRLD
RS4_LACAC       -NSRGRLSEYGQQLHEKQKLRWMYGLN-ERQFRTLFIRAGKIREGQHGINFMILLERRLD
RS4_LACGA       -NNRAKVSEYGQQLKEKQKLRWMFGLN-ERQFQNLFIRAGKIREGKHGVNFMALLERRLD
RS4_LACP3       -NNRRKISEYGQQLREKQKLRWMYGLN-ERQFQNLFLRAGKIKEGTHGDNFMILLETRLD
RS4_ENTFA       -NSRGKVSEYGMQLTEKQKLRHMYGMN-ERQFRTLFIKASKIKEGKHGVNFMVLLEQRLD
RS4_LACSS       -DRRGKISEYGMQLSEKQKLRLMYGLT-ERQFRNLFARAGKIREGKHGVNLMILLEQRLD
RS4_LACPL       -GRRGKLSEYGTQLREKQKLRMMYGLT-ERQFANLFIKAGKIREGKHGVNFMILLERRLD
RS4_PEDPA       -NNRRKISEYGMQLREKQKLRMMYGLT-ERQFSNLFVRAGKIREGLPGTNFMVLLERRLD
RS4_LEVBA       -GRRQKLSEYGTQLREKQKLRFTYGMT-ERQFYNLFKRAGKIKEGTHGTNFMILLERRLD
RS4_LACS1       -DRRGSLSEYGLQLREKQKLRMTYGLT-ERQFSNLFKRAGKIREGKHGDNFMILLERRLD
RS4_LEUMM       -GRRAKISEYGMQLREKQKLRFTYGLT-ERQFKALFNKAGKIRKGTHGTNFMISLEQRLD
RS4_OENOB       -GRRPKLSEYATQLREKQKLRFTYGLS-ERQFHNLFLKAGKIRKGLHGTNFFILLETRLD
RS4_LACLA       -NNRSKLSEYGLQLAEKQKLRFSYGLS-ERQFRNLYIAATKVKEGTVGFNFMTLLEQRLD
RS4_STRMU       -NNRSKLSEYGLQLAEKQKLRFSYGLG-EKQFRNLFVQATKIKGGILGYNFMLLLERRLD
RS4_ONYPE       -QKKLKLSDYGLQLQEKQKLRFTYGVS-EKQFRKTFDNASKLK-GIHGEMFLVLLESRLD
RS4_MYCMS       -RAKVKVSEYGQQLQEKQKVKFMYGLS-ERQFRNTFAKAKKMQG-ILGTNFLVLLESRLD
RS4_MESFL       -KARLKMSGYGAQLQEKQKVKFMYGMT-ERQFRNTFAKAKKVHGGILGTNFLVLLESRLD
RS4_MYCGE       -FRSSTLSGYAQQLQEKQRMQYMYGIT-DKQFRRLFRFVLKQKG-NLTVNLFRVLESRLD
RS4_MYCPN       -FRSSTMSGYAQQLQEKQRMQYMYGIT-DKQFRRLFRLVLKQRG-NLAVNLFRVLESRLD
RS4_MYCGA       -IRP-KLSNYGEQLQEKQKMQFMYGLN-DRQFRRLFAVSKKMSG-ILTMNLFRTLESRLD
RS4_MYCPE       --KRVKLSGYGEQLQEKQKMMYLYGLN-DRQFRRTFVIAKHMKG-ALTLNTFIALESRLD
RS4_UREPA       --KKVKLSNYGQQLVEKQKLMFLYGLN-DRQFRRLYRVALGRPG-VLTLNLLQVLESRLD
RS4_MYCHJ       --RRSKPSDYGVHLREKQKVRFMYGLS-EKQFRNTYRKATKKTG-IAGTLFLQALESRLD
RS4_MYCMO       --RRGKLSDFGIHQLEKQKVRFMYGIN-ERQFRNTFAIANKAKG-VTGTAFLQLLESRLD
RS4_MYCPU       --RRTKLSDYGLHLYEKQKVKNLYGVN-ERQFANSFKKSSKLKG-VQGTNFLQFLEQRLD
RS4_MYCS5       --KRVKLSDYGLHLYEKQKVKLVFGVS-EKQLLKTYKKAVKSKE-ITGTVLLQLLESRLD
RS4_TRIV2       GQNRKKRSEYAIRLEEKQKLRLNYGLT-EKQLLRYVRRARRVT-GSTGQVLLQLLEMRLD
RS4_TRIEI       GQNRRKRSEYAIRLEEKQKLLYNYGVC-ERQLLRYVKKARRAG-GSTGKVLLELLEMRLD
RS4_SYNY3       GQARRKRSEYAIRLEEKQKLRLNYGIT-EKQLVRYVKKARRAT-GSTGQALLELLEMRLD
RS4_THEEB       GQARKKRSEYALRLEEKQKLRFNYGVS-ERQLVRYVRKARRVS-GSTGQTLLQLLEMRLD
RS4_PROMA       GNARRKRSEYAIRLEEKQKLRFNYGIS-ERQLVRYVKKARAME-GSTGTNLLKLLEGRLD
RS4_PROM5       GQARRKRSEYAIRLEEKQKLRFNYGVS-ERQLVRYVKKARAQE-GSTGTNLLRLLENRLD
RS4_SYNS9       GQARRKRSEYAIRLEEKQKLRFNYGVS-ERQLVRYVKKARAQE-GSTGTNLLKLLESRLD
RS4_SYNE7       GQARRKRSEYAIRLEEKQKLRFNYGLS-ERQLVRYVKKARRMQ-GSTGTNLLQLLEMRLD
RR4_CYAPA       GQKSRKRSEYAIRLEEKQKLRYNYGLT-ERQLVQCVRRAKQMK-GSTGQILLQLLEMRLD
RR4_PYRYE       GQKSRKPSEYAVRLEEKQKLRFNYGLS-EKQLFKYVKAAKKLQ-GSTGQILLQLLEMRLD
RR4_GRATL       GQQLRKPSEYSLRLEEKQKLRFNYGLS-EKQLSKYIKIAKKVT-GSTGLILLQILEMRLD
RR4_EMIHU       GAVQKKPTQYGIRLEEKQKLRFNYGIS-EKQLMNYIRQAKGIK-GTTGTILLQLLEMRLD
RR4_NEPOL       GAASKKPSQYRIRLEEKQKLRYNYGVT-EKQLLRYMQRARRAK-GSSGENLLQLLEMRLD
RR4_NYMAL       RSG--KRSQYRIRLEEKQKLRFHYGLT-ERQLLRYVRIAGKAN-GSTGQVLLQLLEMRLD
RR4_ACOCL       RSG--KRSQYRIRLEEKQKLRFHYGLT-ERQLLRYVHIAGKAK-GSTGQVLLQLLEMRLD
RR4_PIPCE       RSG--KRSQYRIRLEEKQKLRFHYGLT-ERQLIRYVRIAGKAK-GSTGQVLLQLLEMRLD
RR4_PHAAO       RFG--KRSQYRIRLEEKQKLRFHYGLT-ERQLLKYVHIAGKAK-GSTGQVLLQLLEMRLD
RR4_CUCSA       RSG--KKSQYRIRLEEKQKLRFHYGLT-ERQLLKYVRIAGKAK-GSTGQVLLQLLEMRLD
RR4_LOTJA       RST--KKSQYRIRLEEKQKLRFHYGLT-ERQLLKYVRIAGKAK-GSTGQVLLQLLEMRLD
RR4_PHAVU       RFS--KKSQYRIRLEEKQKLRFHYGLT-ERQLLKYVRISGKAK-GSTGQVLLQLLEMRLD
RR4_VITVI       RSG--KRSQYRIRLEEKQKLRFHYGLT-ERQLLNYVRIAGKAK-GATGRVLLQLLEMRLD
RR4_OENEH       LSG--NKSQYRIRLEEKQKLRFHYGLT-ERQLLKYVRIAGKAK-GPTGQVLLQLLEMRLD
RR4_SPIOL       RSG--KRSQYRIRLEEKQKLRFHYGIT-ERQLLKYVRIARKAK-GSTGQVLLQLLEMRLD
RR4_JASNU       RSR--KKSQYRIRLEEKQKLCFHYGLR-EYQLLNYVRIAAKAK-GPTGQVLLQLLEMRLD
RR4_SORBI       HSG--KKEQYRIRLQEKQKLRFHYGLT-ERQLLRYVHIAGKAK-RSTGQVLLQLLEMRLD
RR4_EPIVI       RSD--KKSQYRIRLEEKQKLRFNYGLR-ERQLRKYFSIAIKTR-GSTGKVLMQLLEMRLD
RR4_PELHO       RPKPKKKSQYRIRLEEKQKLRFHYGLT-ERQLLKYVRIAGKAK-GPTGQVLLQLLEMRLD
RR4_PSINU       QSTSKKRSQYSLRLEAKQRLRFNYGVT-ERQLLKYVCIAKKAR-GSTGQVLLQLLEMRLD
RR4_ANGEV       QSASKKISQYCIRLEAKQRLRFNHGLT-ERQLLKYVRIAGKAK-GSTGQVLLQLLEMRLD
RR4_MARPO       STSNKKVSQYRIRLEEKQKLRFHYGLT-ERQLLKYVRIARKAK-GSTGQVLLQLLEMRLD
RR4_PHYPA       STA-KKISQYRIRLEEKQKLRFHYGIT-ERQLLNYVRIARKAK-GSTGQILLQLLEMRLD
RR4_ANTAG       STSSRKISQYRIRLEEKQKLRFHYGIT-ERQLLKYVRIARKAK-GSTGQVLLQLLEMRLD
RR4_HUPLU       STPNKKVSQYCIRLEEKQKLRFHHGLA-EQQLLKYVRIARRAK-GSTGQVLLQLLEMRLD
RR4_PINKO       SSS-RKISQYRIRLEEKQKLRFHYGLT-ERQLLKYVRVSRRAK-GSTGQVLLQLLEMRLD
RR4_PINTH       SSS-RKISQYRIRLEEKQKLRFHYGLT-ERQLLKYVRIARRAK-GSR-VRSIAITEMRLD
RR4_CHAGL       SKSKKKDSQYRIRLQEKQKLRYHYGLH-ERQLLKYVRIARKAK-GSTGQVLLQLLEMRLD
RR4_STAPU       SQRKDK-SEYRIRLEEKQKLRFHYGIT-ERQLLRYVRLARRAK-GSTGQVLLQLLEMRLD
RR4_ZYGCR       QDKKQKKSQYRIRLEEKQKLRFHYGLT-ERQLLRYIRIARKAK-GSTGQTLLQLLEMRLD
RR4_CHAVU       SSSNKKISQYNIRLLEKQKLRFYYGLT-ERQLLKYVTIARNAK-GPTGQVLLQLLEMRLD
RR4_MESVI       KSTKTKLSQYGIRLQEKQKLKYNYGVT-EKQLLLYIRKARTIK-GSTGQMLLQYLEMRLD
RR4_CHLAT       KTAKKRLSQYSIRLQEKQKLRYNYGVT-ERQLLLYVRKARRIK-GSTGQILLQQLEMRLD
RR4_OLTVI       ---FAKSSAYGIRLQEKQKLRFNYGIT-ERQLLSYVKKAKRMK-GSTGEVLLQLLEMRLD
RR4_TUPAK       NKLLKNRSPYGLRLLEKQKLRFNYNIT-ERQLLRYVKQAKNLT-GSTGEILLAILEMRLD
RR4_CHLVU       GNQKTKESQYAVRLKEKQKLRFNYGIS-ERQLMSYVREARKRK-GSTGEILLQILEMRLD
RR4_TRICV       ADNSKKTTEYGIRLEEKQKLKFNYGLT-ESQLYRYIKEARRRK-GVTGLILLQLLEMRLD
RR4_THAPS       GEGKKKTTEYGIRLEEKQKLKFNYGIS-ENQLYHYIKEARRRN-GVTGLILLQLLEMRLD
RR4_PHATC       TDIGKKLTEYGVRLEEKQKLKFNYGLT-EKQLFRYVKEARRRQ-GVTGLILLQLLEMRLD
RR4_EUGLO       LSFNKKTSKYKIRLKEKQKLRFNFAIS-EKQLFNYVKKAIKLK-GSSGENLLVALEMRLD
RR4_EUGGR       FKRKKKISKYNIRLKEKQKLRFNYGIT-ERQLLNYVKKSRKKK-GSSGRFLLTFLEMRLD
RR4A_CYACA      WSTNEELSEYAIRLQEKQKIRFNYGIN-EKQLRRYVKKAKKSR-GSTGSYLLNLLEMRLD
RR4_BIGNA       ----KQLSQYGFHLQEKQKLRYNYGIS-EHELIKYVKSARRKR-GNSGDKLLQLLEMRLD
RR4_CHLRE       RPYDSSESDYLIRLKVKQRLRFNYGIT-ERQLVNYVRKAKKIK-ESTGQVLLQFLEMRLD
RR4_TETOB       RPFDSNESDYLIRLKVKQRLRYNYGIT-EKQLVKYVRQAKKMK-ESTGQVLLQLLEMRLD
RR4_CYAM1       RKL----SEYAGVLQGEQKLQYYYGIT-NNQLARYFRQAKKSR-ASTGIELLKMLETRLD
RS4_SYNJA       ER--KKKSEYAIRLEEKQKVRLNYGVS-ERQMLRYMRKARRSK-GSTGLALLQMLEMRLD
RR4_OSTTA       SSGMTKMSQYRVRLQEKQKLRYNYGVS-EKQLLSYVRRARRMK-GPTGELLLQMLEMRLD
RS4B_NITEU      KLVRRRKSDFGIKLQEKQKLRFNYGLS-ERQLRHLMLNARKST-EPTGETLLQLLERRLD
RS4_METFK       KNTRRKKSDFGVKLQEKQKLRFNYGLS-EKQLRRLMVDARKGK-SPTGETLLQLLERRLD
                                .:     .    .  :                          : 

RS4_ARTS2       ALVLRAGFARTIAQARQLVVHRHILVD---GI----RVDRPSFRVGEGQLVHVHSRSETM
RS4_LEIXX       ALVLRAGFARTISQARQFVVHRHILVD---GK----LVDRPSFRVKPGQTIGVKARSEGT
RS4_TROWT       ALVLRAAFARSISQARQLVVHRHILVD---GK----LVDRPSYSVSPGQTVKVKPKSVPL
RS4_BIFAA       ALVLRAGFARTTAQARQFVVHRHILVD---GN----IVDRPSYRVKPGQTIQVKAKSQTM
RS4_STRCO       ALVLRSGIARTIYQARQMVVHGHIQVN---GQ----KVDKPSFRVRPDDVVQVRERSKEK
RS4_THEFY       TVLLRAGFAASIYAARQFINHGHITVD---GK----KVDIPSYQVKPGQIVSVREKSRKL
RS4_RHIME       AIVYRAKFVPTVFAARQFVNHGHVKVNGV-------RVNIGSYRCKPGDVIEVKEKSKQ-
RS4_AGRFC       AIVYRAKFVPTVFASRQFINHGHVTVNGV-------RVNIGSYRCKAGDVIEVRQKSKQ-
RS4_CHESB       AIVFRAKFVPTPFAARQFVNHGHVKVNGR-------RVNIPSYRCKPGDVIEVREKSKQ-
RS4_BRUSU       AVVYRAKFVPTIFAARQFINHGHVNVNGR-------RVNIQSYRLKVGDVVEVREKSKQ-
RS4_RHILO       AVVYRAKFVPTIFAARQFVNHGHVNVNGK-------RVNIGSYRCKPGDVIEVREKSKQ-
RS4_BARBK       AIVYRSKFVPTIFASRQFINHGHVNVNGR-------RTNIQSYRCKPGDVIEIRERSKQ-
RS4_RHOS1       AIVYRAKFVPTIFAARQFVNHGHVTVNGQ-------RVNIGSYRCKEGDVIQVREKSRQ-
RS4_PARDP       AVIYRAKFVPTIFAARQFVNHGHVEVNGK-------RVNIASYRVKEGDVVSIRERSRQ-
RS4_JANSC       AVVYRAKFVPTVFAARQFVNHGHVTVNGQ-------KVNIPSYRVKEGDVIAVRDKSKQ-
RS4_ROSDO       AVVYRAKFVATVFAARQFVNHKHVRVNGK-------IVNIPSYRVKEGDVIEVRDRSKQ-
RS4_RHOPB       TVVYRAKFVSTMFAARQFINHGHVKVNGK-------RVNIASYKVKVGDLVEVKESSKQ-
RS4_BRADU       AVVYRAKFVSTIFAARQFINHGHIKVNGR-------KVNISSYQLKVGDVVEVKEASKQ-
RS4_CAUVC       AIVYRAKFVPTVFAARQFVNHGHVTVNGK-------RVNIPSYRCKAGDVIQVREKSRN-
RS4_MARMM       AIVYRCKFVPTVFASRQFVNHGHVKVNGI-------KVNIPSYRCKPGDVIEVRERSRS-
RS4_HYPNA       AVVYRAKFVPTVFAARQFINHGHVMVNGR-------RCNIGSARLKPGDVVQVREKSRN-
RS4_ERYLH       MVVYRAKFAPTVFAARQIVNHGHIYVNGV-------KTNIPSARVKVGDVISLGNKAKE-
RS4_NOVAD       MVVYRAKFAPTIFSARQVVSHGHIYVNGV-------KCNIASRRVRPGDVVSLGKKAKE-
RS4_SPHAL       AVVYRAKFTPTIFSARQLVSHGHVYVNGV-------KCNIASRLVKPGDEITLGKKAQE-
RS4_ZYMMO       MIVYRAKFAPTIFAARQLVSHGHIRVNGV-------KCNIASRRVNPGDEISLGSKAQE-
RS4_GLUOX       AVVYRLKFAITPFASRQFISHGHVTVNGK-------KVNIPSYLVKEGDVIEVRDSSKQ-
RS4_GRABC       AVIYRMKFALTPFAARQFVNHGHVLVNGK-------RVNIPSYLVKVGDVVEVREKSKQ-
RS4_MAGSA       AVVYRLKFAPTPFAARQLVNHCHILVNGK-------RVNIPSYRVNEGDVISVKTKSKD-
RS4_RHORT       AVVYRMKIVPTVFSSRQIINHGHILVNGR-------RVSVASYRVQEGDVIEVKEKSRQ-
RS4_PELUB       SVVYRARFSTTVFSARQLINHGHVRVNGK-------KVNIGSYVVKEEDIIEIRDKSKQ-
RS4_RICTY       TVVYRMNIAPTIFAARQLVSHGHIKLNGK-------KADIASIRLKEGDIIEIKESIQQ-
RS4_RICBR       SIVYRMNIAPTIFSSRQLISHGHIKVNGK-------KADIASMRLKEGDVIEIKEASRQ-
RS4_ANAMM       VVVYSAGFVPTVFSARQLVSHKHVTVNGK-------VVNIPSFSVKPGDVVQIRERATE-
RS4_ANAPZ       SVVYSAGLVPTMFSARQLVSHKHVTVNGR-------VVNIPSFSVKPGDIVEVRKRASQ-
RS4_EHRCR       SVLYNSGLVPTIFSARQLISHKHVLVNGK-------TVNISSYVVKVGDVVTLKEKAKN-
RS4_EHRRW       SVLYNSGLVPTIFSARQLISHKHVLVNGK-------VVNISSYSVKPGDTIKLREKAVN-
RS4_WOLTR       SVLYHSGLVPTIYSAKQLISHKHVTVNDK-------IVNIPSYRVKPGDIVKIRERAAK-
RS4_CHLAB       NMVYRMGFAKTIFAAQQLVAHGHVLVNGK-------KVDRRSFFLRPGMQVSLREKSRK-
RS4_CHLPN       NMVYRMGFAKTIFAAQQLVAHGHILVNGR-------RVDRRSFFLRPGMQISLKEKSKR-
RS4_CHLMU       NIVYRLGFAKTIFAAQQLVSHGHVLVNGK-------KVDRRSFFVRPGMQISLKEKSRR-
RS4_PARUW       NLVYRLKFGHTIFAAQQLVAHGHILVDGK-------KVDRRSFQVKPGMVISIKEKSRK-
RS4_AQUAE       NVVYRLGFASTRRQARQLVAHGHVLVN---GK----KVNIPSYLVEPGDVIEIKEKSRD-
RS4_LEPBL       NVVYRLGFAVTRRQARNFIAHRHVLVN---GE----RVDIPSYRLNVGDKVEIREKFRA-
RS4_ACIBT       NVVYRMGFGSTRAEARQLVSHRSITLN---GR----RVNIASIQVKAGDVIAVHEGAKQ-
RS4_PSYCK       NVVYRMGFGSTRAEARQLVSHRTVMVKK-AGRDEFIRVNIPSIQLQDGDVIAIQEKSRE-
RS4_ECOLI       NVVYRMGFGATRAEARQLVSHKAIMVN---GR----VVNIASYQVSPNDVVSIREKAKK-
RS4_HAES1       NVVYRMGFAATRAEARQLVSHKAIVVN---GR----VVNIPSFQVSVNDVVAVREKSKK-
RS4_SHELP       NVVYRMGFGATRAEARQLVSHKSIMVN---GR----VVNIPSFKVSANDVISVREKSQK-
RS4_AERS4       NVVYRMGFGATRAESRQLVSHKAIMVN---GR----VVNIPSFQVSPEDVVCVREKAKK-
RS4_PSEA6       NVVYRIGFASTRSEARQLVSHKAILVN---GQ----VVNVPSFNVSADDVVSVREKAKK-
RS4_VIBCH       NVVYRMGFGATRAEARQLVSHKAILVN---GK----VVNVPSFNVAANDVVAVREKAKK-
RS4B_PSYIN      NVVYRMGFGATRAESRQLVSHKAVLVN---GK----VVNIPSFNVKASDVIAIREKAKK-
RS4_COLP3       NVVYRMGYASTRAEARQLVSHKAIVVN---GV----VVNIPSFTVKAEDTVSVREKSKT-
RS4_PSET1       NVVYRMGFASTRAEARQLVSHKAILVN---GR----VVNVPSYVIAPEDTVVIREKSKT-
RS4_PSEAB       NVVYRMGFGSTRSESRQLVSHKAITVN---GQ----TVNIPSYQVKAGDVVAVREKSKN-
RS4_PSEE4       NVVYRMGFGSTRSESRQLVSHKAISVN---GK----TVNIPSYQVRPGDVVSVREKSLN-
RS4_SACD2       NVVYRMGFGSTRAESRQLVSHKAILVN---GK----TVNIPSFQVNVGDVISVREKSKN-
RS4_HAHCH       NVVYRMGFGSTRSEARQLVSHKAILVN---GK----AVNIPSYQVKPGDVVSIREKSKN-
RS4_MARHV       NVVYRMGFGSTRAEARQLVSHKAVLVN---DK----PVNIPSYQVKPGDVVSVREKAKN-
RS4_ALCBS       NVVYRMGFGSTRSEARQLVSHRAILVN---GQ----SVNVASYQVKPGDQINVREKSKN-
RS4_CHRSD       NVVYRMGFGSTRSEARQLVSHKAIAVN---GR----TVNVASYQVKPGDVVSVREKAKN-
RS4_HYDCU       NVVYRMGFASTRAEARQLVSHKSIQVN---GQ----SVNIPSYEVSAGDVISIREKSRN-
RS4_ALKEH       NVVYRMGFATTRAEARQLVSHRGVQVN---GR----VVNVPSMQVSPGDLVGLKEKAQK-
RS4_HALHL       NVCYRMGFGSTRAEARQLVNHRGVLVN---GR----VVNIPSYQVQPGDTVSVKEKAKS-
RS4_NITOC       NVVYRMGFGSTRAEARQLINHKGVLVN---GQ----GINIPSYQVRAEDVVAVREKAKR-
RS4_FRATO       NVVYRMGFAATRAEARQLVVHKGIMVN---GH----TCNVPSAQVKVGDVVAVREKAKK-
RS4_PARXL       NVVYRMGFGSTRAEARQLVSHKAIMVN---GV----VSNIPSMQVKAGDVVAVREQKKK-
RS4_RALSO       NVVYRMGFGSTRAEARQLVSHKAILVN---GQ----ALNVPSAQIKSGDVVAIREKSKK-
RS4_BORA1       NVVYRMGFGSTRAEARQLVSHRAIELN---GH----TADIASMLVKAGDVITVREGAKK-
RS4_POLSJ       NVVYRMGFGSTRAEARQLVSHKAITVN---GN----SVNIPSYMVKTGDVIAVRDKSKK-
RS4_RHOFT       NVVYRMGFGSTRAEARQLVSHKAMTVN---GK----SVNIPSYMVKAGDMIAVRDKSKK-
RS4_VEREI       NVVYRMGFGSTRAEARQLVSHKAITVN---GQ----SVNIPSYLVKTGDLVAVREKSKK-
RS4_METPP       NVVYRMGFGSTRAEARQLVSHKGITVN---GE----VVNIASYLVKTGDVVAVREKAKK-
RS4_NEIMF       NVVYRMGFGSTRAEARQLVSHKAIVVN---GQ----VVNIPSFQVKAGDVVSVREKAKK-
RS4_CHRVO       NVVYRMGFGSTRAEARQLVSHKAIVVN---GQ----VVNIPSYQVKAGDVVSVREKAKK-
RS4_METCA       NVVYRMGFASTRAEARQLVSHKAINLN---GR----TLNIPSYQVQSGDVVEIRDKAKS-
RS4_BUCAI       NVVYRMGFGCTRSESRQLINHKSIMVN---NK----VVNIASYQVSPNDQISIRNKSKN-
RS4_BUCAP       NVVYRMGFGCTRSESRQLISHKSIKVN---NN----IVNIASYQISPNDRISVRDKSKN-
RS4_BAUCH       NVVYRMGFGATRAESRQLVSHKAIMVN---NH----IVNIASYQVAINDKISIRDKAKK-
RS4_BLOFL       NVVYRMGFGSTRAESRQLVSHKSIIVN---DC----IVNIASYQVVPNTVIQVYKKSHN-
RS4_BLOPB       NTVYRMGFGATRAEARQLVSHKSIMVE---NR----IVNIASYQVVPNTVIKIHKKSHK-
RS4_BUCBP       NVTYRIGFGSTRAEARQLVSHKSILVN---NC----TVNIPSYQVSPGDVISIHKNSKL-
RS4_WIGBR       NVVYRMGFGSTRLESRQLISHKSIIIN---KK----VINIPSYQIKPNDCIEVKEIAKK-
RS4_BUCCC       NIVYRLGFGTTRLEARQLINHKSICVN---NK----IVSFPSFQVSIDDKISVVKKSKN-
RS4_RUTMC       NVVYRMGFGSTRAEARQLVSHKSILMN---GL----VVNIPSYQVSVNDEISIREKAKK-
RS4_LEGPA       NVVYRMGFASTRAEARQLVAHKAILVN---DK----VVNVPSFLVNPGDTISVRQKAKN-
RS4_COXBU       NVVYRMGFAATRAEARQLISHKAILVN---GE----VVNIPSYQVKPGDIIEVRSRAKG-
RS4_XANOM       NVCYRMGFAVTRPAARQLVSHRCVLVN---GK----SVNLASYQIKAGDAITLSEKAQK-
RS4_XYLFT       NVIYRMGFAVTRPAARQLVSHRSVLVN---GK----MVNLPSYHVKPGDVVALSQRAQK-
RS4_AROAE       SVVYRMGFGGSRAESRQLVRHNGILVN---GK----RVNIPSYVVRPGDVVELTEGSRG-
RS4_AZOSB       SVAYRMGFGASRAEARQVVRHNGVLVN---GK----RVNIPSYTVRPGDVIELAEGTKG-
RS4_DECAR       SVAYRMGFGASRSESRQVVRHNGILVN---GK----RVNIPSFIVKPGDVVQLTDRARA-
RS4_THIDA       SVCYRMGFGASRTEARQIVRHNGIVVN---GR----RVNIPSYQVRPGDVVEVAEKSKA-
RS4_NITMU       TVSYRMGFGASRSEARQIVRHNGILVN---GR----RINIPSYQVKPGDVIEVAEKAKN-
RS4_NITEC       NVAYNMGFGASRAEARQIIRHDCILLN---GK----KANIPSQLIGPGDQIEVAEHAKS-
RS4_MAGMM       NVVYRLGLAASRTEARQIISHKTLLVN---GK----MVNVPSYLCKPGDVVAVREKSRG-
RS4_DESVV       NVIYRLGFANSRNQARQLVRHGIFTLN---GR----KVNIPSLQVRIGDTIEVPEKSRK-
RS4_DESAG       NVIYRLGFANSRSQARQMVRHGIFTVN---GR----KATIPSIQVKVGDVIEVREKNRK-
RS4_LAWIP       NVVYRLGLANSRVQARQLIRHGIFTLN---GH----KVTIPSLQVNVGDSIEVPEKNRK-
RS4_GEOSL       NVVYRLGFAASRTEARILVRHNHFTLN---GK----KANIPSIQLRAGDVVELKEKSRK-
RS4_PELPD       NVVYRLGFASSRSESRQLVRHGHFTLN---GK----KVDIPSIQTRVGDVIELREKSRK-
RS4_PELCD       SAVYRLGFASSRTEGRALVRQGHFLVN---GR----KVNIPSYVMRPNDVIELREKSRK-
RS4_SYNFM       NTVYRLGFASSRAQARQLVRHSHFLVN---GK----KVNIPSFLLRPGDSVSVVEGSRQ-
RS4_ANADE       NVVFRLGFADTRNEARQLVRHGHFKVN---GR----KVNIPSYLCRPGDKVELKDRSKK-
RS4A_MYXXD      NVVFRMGFADTRNEARQLVRHGHFQVN---GR----KVNIPSFAVKPGTAVEVVEKSRK-
RS4_SYNAS       NMVYRLGFANSRNEARQLVRHNHFLVN---GR----KVNIPSFLVNIGDFIEVTEEGRK-
RS4_DESPS       NAVFRAGFASSRTQARQIVRHKHILIN---GK----RVDIPSYQVSEGDVISLREKSRA-
RS4A_BDEBA      NVVYTLGYANSRREARQLVKHNHFLLN---GK----RANIPSILVNKGDVIQVAESSRE-
RS4_CARHZ       NVVYRLGLAESRAQARQLVRHNFFTVN---GR----KVNIPSYLVKVGDVIALKEEKKD-
RS4_ACET2       NVVYRMGLAVSRREARQLVRHGHFTVN---GK----RVDIPSYLVKVGDVIAVKEKSKS-
RS4_DESHY       NVVFQLGFATSRPEARQLVRHGHFTIN---GR----RVDIPSFLVRVGDVVGVKEASKS-
RS4_MOOTA       NVVYRLGFADSRAEARTLVRHGHFLVN---GR----KVNIPSYLVRPGDTISVREKSKA-
RS4_SYNWW       NVVYRLGFASSRKEARQLVNHGHFFIN---GH----KANIPSMLVRVGDIIEVRQSSRE-
RS4A_CLOAB      NVAYKLGYGSSRKEARQLVTHGHFLVN---GK----KVDIPSYTLKVNEVVSVSEKSRG-
RS4_CLOTE       NVVYRLGYGDSRKESRQLVTHGHFLVN---GK----KVNIPSFNVSVNDVITVSEKSRA-
RS4A_CLOPS      NVVYRLGYGASRTEARQLVNHGHFLVN---GK----KVDIASFKVSVNDVITVCEKSRG-
RS4A_CLONN      NVVYKLGFGSSRAEARQLVTHGHFLVN---GK----KVDIISYQVSAGDVISVREKSRG-
RS4_CLOD6       NVVYRMGLASSRKEARQLVTHGHFTLN---GN----KVDIPSLIVKVGDVIEVKEKSRS-
RS4_CALS4       NVVYRLGFAVSRAQARQLVSHGHIEVN---GK----KVDIPSYLVKPGDVISVKESSRS-
RS4_GLOVI       NVVYRLGFATSRAQARQWVNHGHFAVN---GR----RVSIPSYRVRPGDAITVMPNSAA-
RS4A_SYMTH      NVVYRMGFAASRAEARQIVKHSHIEVN---GR----KVNIPSYLVREGDVVAVRESSRE-
RS4_SOLUE       SVIYRMGFGTSRAQARQVVRHGHINVN---GR----KCNIPSALINVGDEITVRETSKN-
RS4_DEHMC       NVLFRLGFGTSRAQARQIVMHGHILVN---GQ----KTDIPSYLIKEGQEITVRETSKA-
RS4_THEMA       NVVYRMGFAINRRQARQLVNHGHFLVN---GK----KVNIPSYLLRPNDVVEVREKSRD-
RS4_DEIGD       NVVFRMGFASTRRQARQFVGHGHILVN---GK----RVDIPSYRVRIGDEISVAEGSRS-
RS4_THET8       NVVYRLGFAVSRRQARQLVRHGHITVN---GR----RVDLPSYRVRPGDEIAVAEKSRN-
RS4_CAMFF       NVVYRMGFATTRRFARQLVTHGHILVN---GK----KVDIPSYRVTAGEKIEVAEKSKT-
RS4_HELHP       NVVYRMGFATTRRFARQLVTHGHILVN---GK----RVDIPSYMVKPGQKIEVKEKSKN-
RS4_SULDN       NVVYRMGFATTRRFARQLVTHGHLLVD---GA----KLDIPSYRVRPGQKIEIRESSKN-
RS4_WOLSU       NVVYRMGFATTRRFARQMVSHGHVLVD---GK----RVNIPSYMVLPGQKVEIREKSKN-
RS4_HELPY       NVVYRMGFATTRSSARQLVTHGHVLVD---GK----RLDIPSYFVRSGQKIEIKEKTKS-
RS4_CHLCH       NIVFRAGFSPSRAGARQLVSHGHVTVN---GK----KVDIPSYLVSPADVMEFRQKSKN-
RS4_CHLL3       NVVFRAGFAPSRAGARQLVSHSHLLVN---GR----KVNIPSFLVSPGDLIEFRQKSRN-
RS4_CHLPD       NVVFRSGFAASRSAARQLVTHGHLTIN---GK----KVNIPSYLLTPGELIEFRQKSKN-
RS4_CHLTE       NVVYRCGFSPSRAGARQLVTHGHMLVN---GK----KVNIPSFLVSPGDQIEFRQKSRN-
RS4_CORGL       NVVYRAGLANTRRQARQLVSHGHFTVN---GK----AIDVPSFRVSQYDIINVREKSQK-
RS4_CORJK       NVVYRAGLARTRRQARQLVSHGHFTVN---GK----KVNVPSFKVSQYDIIDVREKSRS-
RS4_MYCUA       NVVYRAGLARTRRMARQLVSHGHFSVN---GV----HVNVPSYRVSQYDIIDVRDNSLN-
RS4_MYCVP       NVVYRAGLARTRRMARQLVSHGHFTVN---GV----KVDVPSYRVSQYDIIDVKDKSIN-
RS4_NOCFA       NVVYRAGLARTRRQARQLVSHGHFLVN---GV----KVDVPSYRVSQYDIIDVKEKSLS-
RS4_RHOJR       NVVYRAGLARTRRQARQLVTHGHLLVN---NK----KVDIPSYRVSQYDIIDVKEKSLS-
RS4_SACEN       NVVYRAGLARTRRMARQLVSHGHFTVN---GK----KVNIPSYQVSKWDIIDVKQKSLG-
RS4_NOCSJ       NVVYRAGFARTRRHARQLVTHGHFKVN---GK----KVDIPSFQVTAHDVIDVREKSLE-
RS4_CUTAK       NVVYRAGLAATRRQARQMVSHGHFLVN---GK----KVNIPSYRVSTHDIIDVREKSKD-
RS4_FRACC       NVVYRGGFAPSRDAARQAVRHGHVQVN---GR----KVDIPSYRISENDIVEIAPKARE-
RS4_ACIC1       NVVYRAGFAASRDQARQLVRHGHFLVN---GR----RVDIPSYRVSENDVIEVAEKSRE-
RS4_RUBXD       NVVYRMGFATSRPQARQLVVHGHFLLN---GR----KHNIPSATLKPGDVITVRDKSRR-
RS4_FUSNN       NVVYRLGFAKTRRQARQIVSHGHIAVN---GR----RVNIASFRVKVGDIVSVIENSKN-
RS4_BACTN       NVVFRLGIAPTRAAARQLVSHKHITVDGE-------VVNIPSFAVKPGQLIGVRERSKS-
RS4_PORGI       NVVFRLGIAPTRSAARQLVSHRHITVDGS-------VVNIPSYSVKPGQVIGVRERSKS-
RS4_CYTH3       NTVYRLGIASSRRAARQLVIHKHIVVNGD-------VVNIPSYQLKPGDQLGVREKSKS-
RS4_GRAFK       NVVYRMGVAPSRRAARQLVGHRHITVNGE-------LVNIPSYHLKAGDVVGVREKSKS-
RS4_SALRD       NTVFRMGIARTRRQARQFVAHRHIMVNDE-------VVDIPSYEMSPDDVVSVKPSSQD-
RS4_TREDE       NTIYRMGFAISRAQARQMVTHAYFFIN---GK----PVNIPSMCVSVNDVITTKNKKGI-
RS4_TREPA       NTVFRMGFAISRVQARQMVSHRYFLIN---GK----TANIPSMRISAHDVITTKNRKGI-
RS4_BORAP       NIVYRAGFAFSRAHARLIVSHGIVILN---GR----RVTIPSIILRANDQILIQEIDSL-
RS4_RHOBA       NVVRRVGFTKTRPQARQGITHGHFRVN---GV----KVTKPGYMLRAGDLIEVRGRENL-
RS4_BACCR       NLVYRMGLARTRRAARQLVNHGHIMVD---GA----RVDIPSYRVKPGQTISVREKS---
RS4_BACSU       NVVYKLGLARTRRQARQLVNHGHILVD---GS----RVDIPSYLVKPGQTIGVREKS---
RS4_BACSK       NLVYRMGLARTRRAARQLVNHGHVLVD---GS----RVDIPSYRVKPGQTIGLRERS---
RS4_ALKHC       NLVYRMGLARTRRAARQLVNHGHITVD---GQ----RVDIPSYRVKPGQVIGVREKS---
RS4_GEOKA       NLVYRLGLARTRRQARQLVTHGHILVD---GS----RVNIPSYRVKPGQTIAVREKS---
RS4_OCEIH       NLVYRLGLARTRRQARQLVNHGHVTVD---GG----RVDIPSYAIKPGQVIGLREKS---
RS4_STAHJ       AVVYSLGLARTRRQARQLVGHGHVEVD---GR----RVDIPSYSLKPGQVITVREKS---
RS4_STAS1       AVVYSLGLARTRRQARQIVNHGHIEVD---GK----RVDIPSYTLKPGQEISVREKS---
RS4_LISMO       NIVYRLGLARTRRAARQLVNHGHITVD---GK----RVDIPSYQVSVGQVISVREKS---
RS4_LACDB       NVVYRLGLATTREQARQLVNHGHITVD---GK----RVDIPSYEVKVGQTISLKEKS---
RS4_LACAC       SIVYRLGLATTREQARQLVNHGHITVD---GK----RVDIPSYEVSVGQTIGLKDKS---
RS4_LACGA       NIVYRLGLASTREQARQLVNHGHILVD---GK----RVDIPSYEVKVGQEISLRDKS---
RS4_LACP3       NLVFRLGLASSRPQARQLVNHGHITVD---GK----RVDIPSYEVEPGQVIALRERS---
RS4_ENTFA       NVVYRLGLATTRRQARQLVNHGHITVD---GK----RVDIPSYHVEVGQVIGVREKS---
RS4_LACSS       NIVYRLGLASTRAQARQLVNHGHVTVD---GK----RVDIPSYEVKPGQEISIREKS---
RS4_LACPL       NMVYRLGLATTRRQARQLVNHGHITVD---GK----RVDIPSYEVSVGQVVSVREKS---
RS4_PEDPA       NMVYRLGLATTRRQARQLVNHGHITVD---GK----RVDIPSYEVEIGQVIGVREKS---
RS4_LEVBA       NMVYRLGLATTRRQARQLVNHGHITVD---GQ----RVDIPSYEVKIGQVISVREKS---
RS4_LACS1       NVVYRLGLASTRRQARQLVNHGHITVD---GK----RVDIPSYEVEPGQVISLRERS---
RS4_LEUMM       SVVYRLGLATTRQQARQLVNHGHILVD---GK----RVDIPSYSVQPGQVVSVREKS---
RS4_OENOB       SVVFRLGLASTRPQARQLVNHGHILVD---GK----RVTIPSYEVKPGQIISVRERS---
RS4_LACLA       NVVFRLGLATTRRQARQFVNHGHILVD---GK----RVDIPSFRVQPGQVISVREKS---
RS4_STRMU       NVVYRLGLATTRRQARQFVNHGHILVD---GK----RVDIPSYRVEVGQVISVREKS---
RS4_ONYPE       NVVYRLGFAKTRAQARQLANHGHILVD---GK----KVDIASYRLKPGQTVTLREKS---
RS4_MYCMS       NIVYRLGFSATRQGARQLVNHGHILVN---GK----KVDIPSYLLSVGDLVEVKASM---
RS4_MESFL       NIVFRLGFAMTRQAARQLVNHGHILVN---GK----KLDIPSYQVKPGDSIEVKEAM---
RS4_MYCGE       NIVYRMGFAPTRKSARQMVNHGHVILN---DQ----TVDTPSIIINPGDKVRLKARI---
RS4_MYCPN       NIVYRMGFAPTRRSARQLVNHGHVLLN---DR----TVDTPSIILNPGDKVRLKAKT---
RS4_MYCGA       NLVFRMGFAPTRRGARQLVSHGHVLVN---GK----TFDIPSALISLGSVVELKPRA---
RS4_MYCPE       NLVYRMGFAPTRRAARQLVNHGHILLD---GK----KVTIPSCMVKLEQTIEVAPKS---
RS4_UREPA       SLVYRAGFAPTRRAARQLVNHSHVLVN---NK----KVNIPSALVEVGSTIALKAKS---
RS4_MYCHJ       NSVYRAGFAETRRQARQLVNHGHFLVN---NK----KVDIPSFQLKQGDIFELTTRKDGK
RS4_MYCMO       NIVYRMGFAQTRRQARQLVNHGHFLLN---GK----KADIPSQRINVGDTIELRAKS---
RS4_MYCPU       NLVYRAGFAETRRQARQFVNHGHVLVD---GK----KVDIPSYRVAVGKVIEIKEKL---
RS4_MYCS5       NLVYRAGFATTRRQARQLVNHGHFTID---GK----KANIPSMQIKTGTTVVLKETS---
RS4_TRIV2       NTVFRLGMAPTIPAARQLVNHGHVTVNGR-------VVNIASYQCRPGEEIAVRDKAPSR
RS4_TRIEI       NTVFRLGMAPTIPSARQLVNHGHVTVNGK-------VVSIASYQCKPGEVISVKEKEKSK
RS4_SYNY3       NTVFRLGMAGTIPGARQLVCHGHITVNGQ-------VVDIPSYQCRPGDIVSVRDRDRSR
RS4_THEEB       NTVFRLGMAPTIPAARQLVNHGHILVNGR-------NVSIPSYQCRPGDVITVRDNERSR
RS4_PROMA       NVCFRLGFGPTIPGSRQLVNHGHVTVNGK-------TLDIASYQCKSGDTIAIRERKGSK
RS4_PROM5       NVCFRLGFGGTIPGSRQLVNHGHVTVNGK-------VLDIAGYQCKSGDVISIKEKKASK
RS4_SYNS9       NICFRLGFGPTVPGSRQLVNHGHVTVNGR-------VTDIASYQVKPGDVLAIREKKGSK
RS4_SYNE7       NLVFRLGFAPTIPGARQLVNHGHVTVNGR-------VVDIASYNCRPGEVIGVRQREASR
RR4_CYAPA       NIVFRLGMAPTIPASRQLVNHGHICVNNK-------VVSIPSYQCKPGDIITVKERNASK
RR4_PYRYE       NTVFRLGMAPTIPAARQLVNHGHICINGQ-------VVSICSYQCKPGESISVKNQEASR
RR4_GRATL       NVIFRLGLSPTLPAARQLVNHGHILINKQ-------KVSICSYQCKPGDIIDVQAKDSSQ
RR4_EMIHU       NLIFRLGLAPTIAAARQLVSHKHIQVNNT-------RVSIPSYQCQPGDVLSVRDNAASK
RR4_NEPOL       TTIFRLGMAPTMLSARQLITHGHILVSEQ-------RVNIPSYQCSPKEKISIRSNSRSR
RR4_NYMAL       NILFRLGMASTIPGARQLVNHGHILVNGR-------LVDIPSYRCKPRDIITTKDKQGSR
RR4_ACOCL       NILFRLGMAPTIPGARQLVNHRHILVNGR-------IVDIPSYRCKPRDIITTKDKQRSK
RR4_PIPCE       NILFRLGMSSTIPGARQLVNHRHVLVNGR-------IVDIPSYRCKPRDIISTRNEQRSK
RR4_PHAAO       NILFRLGMASTIPGARQLVNHRHILVNGR-------IVDIPSYRCKPLDIITTKDKERSK
RR4_CUCSA       NILFRLGMASTIPQARQLVNHRHILVNGS-------IVDIPSYRCKPRDIITAKDEKKSR
RR4_LOTJA       NILFRLGMASTIPQARQLVNHRHVFVNGH-------IVDIPSYRCKPQDIITAKDNKKSK
RR4_PHAVU       NILFRLGMAATIPQARQFINHRHVLVNGR-------IVDIPSYRCKPQDIITAKDEQKSK
RR4_VITVI       NILFRLGMASTIPGARQLVNHRHILVNGR-------IVDIPSYRCKPRDIITAGNEQKSR
RR4_OENEH       NILFRLGMASTIPQARQLVNHRHILVNGR-------IVDIPSYRCKPRDIITAKDDQKSK
RR4_SPIOL       NILFRLGMAPTIPGARQLVNHRHILVNGR-------IVDIPSYRCKPQDTIMARDEQKSI
RR4_JASNU       NILFRLGMASTIPAARQLVNHRHILVNGR-------IVDRPSYRCKPRDIIMTKDNQKSR
RR4_SORBI       NILFRLGMASTIPGARQLVNHRHILVNGR-------IVDIPSFRCKPRDIITTKDNQRSK
RR4_EPIVI       NIIFRLGMASTIPAARQLVNHRHVLVNGR-------IVDIPSYRCKSRDIIMARDEQQSN
RR4_PELHO       NTLFRLGMASTIPQARQLVNHRHILVNGR-------IVDIPSYRCKPRDLISGREKEKSK
RR4_PSINU       NIIFRLGLSPTIPGARQLVNHRHILVNDQ-------IVDIPSYRCKPNDIITVRDHQKSQ
RR4_ANGEV       NILFRLGMSPTIPAARQLVNHRHILVNNR-------LVDIPSYRCKPKDIISVRDQTNSQ
RR4_MARPO       NIIFRLGMAPTIPGARQLVNHRHILINNN-------TVDIPSYNCKPKDVITIKDRSKSQ
RR4_PHYPA       NIVFRLGMAPTIPGARQLVNHRHVLVNDC-------IVDIPSYRCKPEDSITVKNRQKSQ
RR4_ANTAG       NIIFRLGLAPTIPGARQLVNHRHVLVNDC-------TVDIPSFRCKPQDVITIRDRQKSQ
RR4_HUPLU       NIIFRLGMAPTIPGARQLVNHKHILVNNR-------AINVPSYRCKPKDIITTRDRPESR
RR4_PINKO       NIIFRLGMAPTIPGARQLVNHGHIRVNDH-------MVDIPSYPCKPQDVITIRDQPRLR
RR4_PINTH       KS-FSIGYGST-SGARQLVNHGHIRVNDH-------MVDIPSYPCKPQDVITIRDQQRLR
RR4_CHAGL       NTIFRLGMAPTIPAARQLVNHGHILVNGR-------IVNIPSYRCKPQDSITINTRTQTI
RR4_STAPU       NIIFRLGMAPTIPAARQLVNHGHVLVNER-------VVDIPSFRCKPQENISIRDRARSR
RR4_ZYGCR       NTIFRLGMAATIRAARQLVNHGHIVLNER-------VVDIPSYRCKPNDKITIRDRDRSR
RR4_CHAVU       NIVFRLGMAPTIPAARQLVNHRHILVNDF-------TVNIPSYSCKLGDKISVQKRFESK
RR4_MESVI       NTVFRLGLAPTIAGARQLVNHGHIMVNNR-------IVTIPSYKCKPKDILSIRNNNKSR
RR4_CHLAT       NIIYRLGMAPTIANARQLVNHGHIVVNDR-------IVTIPSYRCKPKDIISVRNNSTSR
RR4_OLTVI       NVVFRLGMAPTVVAARQLISHGHIVVNDQ-------KVTIPSYACQVKDVISVRAKNNSR
RR4_TUPAK       NIVYRLGMAPTIVAARQLVSHGHILVNKQ-------KVNIPSYPCQLKEVISVKDKKASR
RR4_CHLVU       TIIFRLGFAPTIAAARQLINHGHIVVNGR-------RVDIPSSLCKVNDSISVALN--SQ
RR4_TRICV       TICFTLGFAPTIASARQLVNHGHITVNDN-------VVSIPSFQCQINDVIGIKPKATSK
RR4_THAPS       TICFSLGYAPTIAAARQLVNHGHIIVNDK-------VIDIPSFQCQIGDVIGIKSKSPAK
RR4_PHATC       TLCFTLGFAKSLAQARQLVNHGHITINKK-------VVSIPSFQCRLNDIISIKEKSSSK
RR4_EUGLO       NIVYRLGLAPTIISSRQLINHGHIYVDGK-------VVNIPSFKCKPTNNIKIKDNLVSK
RR4_EUGGR       NIVHRIGFAPTIMAAKQLINHGHICVDDK-------VINIPSFICQPKSIIKPKKSTVSE
RR4A_CYACA      NIVLRAGLAPTIAASRQLVSHKHIEVNNK-------IVNIPSFQCSIGDTIHVKKSNKSR
RR4_BIGNA       TLLYRTGFVPTVASARQLISHGHINVNGK-------KVDIPGFNCSISDKI-VINKEILK
RR4_CHLRE       NIVFRLNMAPTIPAARQLISHGHIRVNNK-------KVNIPSYMCKPKDVISVAMKQRSL
RR4_TETOB       NIVFRLNMAPTICAARQLISHGHIHVNSK-------KVNIASYMCKPKDVISVSMKQSSL
RR4_CYAM1       HVVYRAGFAPTLPAARQLVNHGHVKVNGN-------QVTIASFACQVNHIIEVKAKSPSS
RS4_SYNJA       CIVFRLGMAPTIPAARQLVSHGHIEVNGR-------KVTIPSYGCKVGDVITVRNKESSR
RR4_OSTTA       AVVYRLGFAPTIRAARQYVSHGLVTVNGQ-------AVTIPSYQCSVGEVIK-----SNS
RS4B_NITEU      NVVFRAGFAPTVIAARQLVSHRHVRLNGK-------PVNIPSIRLNVGDEITIKPESLNL
RS4_METFK       NVVFRAGFAPTIAAARQLVTHRHVMLNGK-------SVNIPSIRVRVGDEISLKASSTKL
                          .   .:    :  . :.              .        .         

RS4_ARTS2       PPFQVAA--------AGAHRDVLPQVPAYLDVKLDA-------LQARLVRRPK--RSEV-
RS4_LEIXX       EPFQVAA--------AGGHVDVLPKTPAYLSVELDK-------LQARLERRPK--RAEV-
RS4_TROWT       DPFQVAA--------SGGHADVLPPIPGYIEADLEG-------LSFRLVRRPK--RSEV-
RS4_BIFAA       VPFQAAA--------EGVHRDVLPAVPGYLDVNLPS-------LKATLTRKPE--AEEI-
RS4_STRCO       TLFTIAR--------EGGFAPD-GETPRYLQVNLKA-------LAFRLDREPN--RKEI-
RS4_THEFY       VPFIEAA--------EGVHADE--KIASYLAVSHKD-------LTIAVVDRPK--REQV-
RS4_RHIME       --LVTVL--------EAVQLAERD-VPDYIEADHNK-------MVATFVRVPA--LSDV-
RS4_AGRFC       --LVTVL--------EAVQLAERD-VPDYIEVDHNK-------MVATYARVPS--LSDV-
RS4_CHESB       --LTVVL--------ESVALAERD-VPDYIEVDHNK-------MTAKYVRMPA--LADV-
RS4_BRUSU       --LAIVL--------EAVQLAERD-VPDYIDVDHNK-------MVATYNRVPG--LLDV-
RS4_RHILO       --LVIVL--------ESVGLAERD-VPDYIEADHNK-------MVATFSRIPG--LADV-
RS4_BARBK       --LLLVL--------EATQLNERD-VPDYIEADHSK-------MKATFVRIPA--FSDV-
RS4_RHOS1       --LALVL--------EATQLAERD-VPDYIEVDYSK-------MTATFVRTPG--LGDV-
RS4_PARDP       --LAIVL--------ESVGLAERD-VPDYLEVDHNK-------MTATFVRTPA--LGDV-
RS4_JANSC       --LAVVL--------EAVGLAERD-VPDYVDADHSK-------MTATFVRTPG--LSDV-
RS4_ROSDO       --MVALI--------EATQLAERD-VPDYIEADHSK-------MQATFVRTPA--LGDV-
RS4_RHOPB       --LTFVL--------EANQLAERD-VPDFIEVDHGK-------MTAKFIRIPH--LSDV-
RS4_BRADU       --LAHVL--------EASQLPERD-TPDYLDVDHGK-------MTAKYIRIPG--LSDV-
RS4_CAUVC       --MALVL--------EAVASNERD-FAEYVSVDAKS-------LSATFVRAPE--LSEV-
RS4_MARMM       --MALVL--------EALDSPERD-LPEYIDLDAKA-------MKATFVRMPE--FSEV-
RS4_HYPNA       --LALVL--------EALGSPERD-IPEYVEVDPKA-------MTATYKRVPA--LADV-
RS4_ERYLH       --MALVI--------EAQSLPERE-IPDYVAPDGN--------DKVTFTRVPK--LDEV-
RS4_NOVAD       --MALIA--------EAQALPERE-VPDYVAADG---------DKVTFTRVPT--LDEV-
RS4_SPHAL       --MALVA--------EAQSLPERD-LPEYLAVDG---------TKATYVRVPT--LDEV-
RS4_ZYMMO       --MALVL--------EAQSLAERD-IPDYVLPDGN--------TKVTFVRIPT--LDEV-
RS4_GLUOX       --LAIVL--------DAVQTGERD-TPEYVEVDHRQ-------MKGTFLRTPV--LSDV-
RS4_GRABC       --LAMVL--------DATQSGERD-VPEYLHVDHRL-------MKGTYARYPK--LSDV-
RS4_MAGSA       --MALIL--------EAAQSGERD-VPDYMEVDHKE-------MKGKFVRIPK--LGDV-
RS4_RHORT       --MPLIL--------EALQSHERD-IPEYITMDLAH-------AKGTFLRAPK--LEDV-
RS4_PELUB       --LAIID--------IALASKERE-TPEYINLDEKN-------KKVTFVRTPK--FDEV-
RS4_RICTY       --IPLIQ--------ESIAKQGQT-TPKYLSFDVSS-------LTGKYLRVPA--LSDV-
RS4_RICBR       --MGIIQ--------ESVSKQGQT-TPDYVSFDVDS-------LSGKYLRVPT--ISDV-
RS4_ANAMM       --LPMVL--------AAIQSQERR-VPDHLEVDTAQ-------RSARYLRVPK--YCEV-
RS4_ANAPZ       --LPMVL--------AAIQSQERR-VPDHLDVNTEK-------LSVKYLAVPK--YSDV-
RS4_EHRCR       --LPAVV--------FAVQSQEQK-VPDYLEVDTQE-------KSIRYLRVPK--YCEV-
RS4_EHRRW       --LPPVL--------AAIDAQEQK-VPDYLEVDVKE-------RSVKYLRVPK--YYEV-
RS4_WOLTR       --IPVIV--------EAVQKQERK-APDYLEADSKE-------YSVKYLRIPQ--YSEV-
RS4_CHLAB       --LQSVK--------ESLENKDESSFPSYISVDKSN-------FKGELLISPE--QDQIE
RS4_CHLPN       --LQSVK--------DALESKDESSLPSYISLDKTG-------FKGELLVSPE--QDQIE
RS4_CHLMU       --LAIVT--------ESLENKDQSSLPAYLSLDKAA-------FKGELVVSPE--LDQIS
RS4_PARUW       --IKIIA--------EALDNPARS-VPEYLSSDKEH-------FSGQLLAKPI--PEQM-
RS4_AQUAE       -IPFIKE--------NLENVDP-RSIPSWLELDKDN-------FRGRVVRLPENVQEYL-
RS4_LEPBL       -STFIAD--------NIRLSQSLQGIPSWLSADYTN-------FGGDVTALPE--RHHI-
RS4_ACIBT       -QLRIKN--------AIELAAQ-RGIPAWIEVDHSK-------LEGTFKAAPD--RSDL-
RS4_PSYCK       -QLRIKN--------AIELATQ-RGIPEWLDVDHSK-------LQGTFKKAPD--RIDL-
RS4_ECOLI       -QSRVKA--------ALELAEQ-REKPTWLEVDAGK-------MEGTFKRKPE--RSDL-
RS4_HAES1       -QARIKA--------SLELAEQ-RERPTWLEVEAAK-------MEGVFKRVPE--RSDL-
RS4_SHELP       -QARIKA--------ALEVASQ-REKPTWVEVDAAK-------MEGAFKRLPE--RSDL-
RS4_AERS4       -QARIKA--------SLEVAGQ-REKPTWVEVDTAK-------MEGAFKRLPE--RSDL-
RS4_PSEA6       -QARIVS--------ALELAEQ-REKPTWIEVDSKK-------MEGTFKRVPE--RTDL-
RS4_VIBCH       -QSRIKA--------ALEVAEQ-REKPTWIEVDVNT-------MEGTFKRMPE--RSDL-
RS4B_PSYIN      -QSRIGA--------ALEIAGQ-REVPTWVSVDATK-------MEGIFTRQPE--RSDL-
RS4_COLP3       -QARIIA--------ALELADQ-REKPLWVEVDTKK-------LEGVFKRVPD--RADL-
RS4_PSET1       -QARIIA--------ALELAEQ-REKPTWVEVDGKK-------LEGSFKRLPE--RSDL-
RS4_PSEAB       -QLRIAQ--------ALELCGQ-RGRVEWVEVDLDK-------KAGTFKSAPA--RSDL-
RS4_PSEE4       -QLRIVQ--------ALELCAQ-RGRVEWVDVDAAK-------KSGVFKNVPA--RSDL-
RS4_SACD2       -QLRIQN--------SLGIAGQ-RADVEWVDVNTEK-------KEGVFKRCPD--RADL-
RS4_HAHCH       -QLRIKG--------SLELAAQ-RATLEWIEVDAAK-------MSGTFKSVPE--RTDL-
RS4_MARHV       -QLRVKG--------ALDLASS-RAPVSWVEVDANK-------MSGVYKSVPE--RTEL-
RS4_ALCBS       -QLRVKN--------AMELAQQ-RGFMPWIEVDDKK-------LEGTYKAKPE--RIDL-
RS4_CHRSD       -QARIQN--------ALGIAAN-RGDVAWIDVDSKK-------MEGTFKAVPE--RGDL-
RS4_HYDCU       -QSRIAA--------ALELSAQ-AGNVGWVEVDSSK-------FEGVFKTVPD--RSDL-
RS4_ALKEH       -QLRVQA--------ALEMAQQ-NGWPAWVEVDPKK-------FEGTYKARPD--RADL-
RS4_HALHL       -QLRIQA--------ALELAQQ-NGWASWVDVDATK-------MEGVFKQAPD--RADL-
RS4_NITOC       -QDRIKF--------ALELAQA-RAEAEWIEINAGK-------LEGVFKRVPE--RSEL-
RS4_FRATO       -QLRIQN--------AVELAKH-RKELSWIDVNTDS-------LEGTMKSSPD--RSEL-
RS4_PARXL       -QARILE--------ALSLAEQ-GGLPSWVAVDSKK-------FEGTFKQKPE--RSDI-
RS4_RALSO       -QVRIAE--------SLSLAEQ-TGFPGWVAVDAKK-------MEGTFKQAPD--RGDI-
RS4_BORA1       -QARIRE--------SLDLAAS-IGIPQWVEVDSNK-------MTGTFKSPPD--RADV-
RS4_POLSJ       -QTRVTE--------ALELAKQ-VGLPAWVDVNADK-------GEGVFKKVPD--RDEF-
RS4_RHOFT       -QNRIVE--------ALQLAQQ-VGMPAWVEINAEK-------AEGTFKAVPD--RDQF-
RS4_VEREI       -QGRIAE--------ALQLATQ-VGMPAWVEVNTEK-------AEGLFKKAPD--RDEF-
RS4_METPP       -QLRVTE--------SLKLAES-MGLPAWVQVDATK-------LEGVFKKSPD--RDEF-
RS4_NEIMF       -QVRIQE--------ALGLATQ-IGLPGWVSVDADK-------LEGVFKNMPD--RSEL-
RS4_CHRVO       -QARIVE--------GLALAEQ-GGFPSWVSVDSKK-------MEGTFKSAPE--RSEL-
RS4_METCA       -QGRVKD--------ALQVTEQ-YGFPSWVDVDVKS-------MKGIFKSAPE--RSEL-
RS4_BUCAI       -QSRIKA--------ALELVEQ-REKPIWLEVNSTK-------MEGIFKRFPE--RSDL-
RS4_BUCAP       -QSRIKA--------ALELTEQ-REKLMWIEVNVTK-------MEGIFKRFPE--RSDL-
RS4_BAUCH       -QSRIRA--------SLELAEQ-REKPTWLEVDIVK-------MEGIFKKIPE--RIHL-
RS4_BLOFL       -QSRIYA--------ALEIAEQQRESVPWIEVDSAK-------LKGIFKRRPE--RSEL-
RS4_BLOPB       -QSRIRA--------SLELSEQQREKLAWIEVDPIK-------LQGLFKRYPE--RSEL-
RS4_BUCBP       -QSRIKA--------ALELSEQ-RETPIWIEVDFNK-------MQGIYKRVPE--RSDL-
RS4_WIGBR       -QSRIKA--------AIEISEQ-REKQSWIDVDRVK-------MQGIFKKFPD--RSDL-
RS4_BUCCC       -QLRIKA--------SLEIMKQ-KEKPSWLSIDYPN-------MEGVFLRSIE--RDDL-
RS4_RUTMC       -QSRIQL--------ALELAEQ-STQPQWLDIDHKA-------LKGVFKNVPA--RDEL-
RS4_LEGPA       -QGRIQA--------ALALSEQ-RAPCDWITVDTGS-------FKGTFSTAPT--LMDL-
RS4_COXBU       -QLRIKG--------ALELAQQ-RAPISWIEVDTKK-------MTGTFKEQPD--VAEL-
RS4_XANOM       -QLRVQE--------ALTVAEQHDMTPSWVEVDSKK-------FSGVFKAVPD--RADL-
RS4_XYLFT       -YLCVQE--------SLTIKDQHGSAFSWIEVDSEK-------FSGVFKALPD--RADL-
RS4_AROAE       -QLRVKA--------ALEAAAS-RGFPEWLDVDAKA-------GKGTFKAYPQ--RAEL-
RS4_AZOSB       -HLRVKA--------ALEAAES-RGFPEWIEVDAKA-------GKGVFKAYPQ--RSEL-
RS4_DECAR       -SLRCKA--------ALEAAES-RGFPEWISVDVKE-------GKGTFKAMPQ--RSEL-
RS4_THIDA       -QLRIKA--------AADATAT-RGYPEWIEVDAKA-------LKGTYKAHPQ--RSEL-
RS4_NITMU       -HLRIKA--------SVEAAEQ-RHFPEWLEVDTKA-------MKGTFKNKPE--RSDL-
RS4_NITEC       -YLRIKS--------SIELAKR-RSIPSWLEVDFDN-------LKGLYKNKPD--RSDL-
RS4_MAGMM       -QLRIKG--------ALASAMQ-RGLPSWVEVDAEK-------LVGTFRSIPE--RSDL-
RS4_DESVV       -IPVLAE--------AQEVIAR-RGCPAWLEADGAN-------FRGVVKALPQ--REDI-
RS4_DESAG       -MPVIAE--------AQEVIAR-RGCPSWLEADGPN-------FRGVVKALPQ--REDI-
RS4_LAWIP       -ISVVAD--------AQSIVGR-RGCPSWLELDAST-------FKGVVKALPQ--REDI-
RS4_GEOSL       -IACINE--------SLDAVVR-RGIPQWLELEKDA-------YKGVVKTLPV--REDI-
RS4_PELPD       -IVSIND--------ALDAVAR-RGIPQWLELDRDA-------FKGNLKALPV--REDV-
RS4_PELCD       -ITRIND--------ALDGVMR-RGLPSWVELDREA-------FKGTFKTLPV--REEM-
RS4_SYNFM       -LQMINE--------AMEAMPR-RGLPPWLELDKAK-------YEGVFKTLPT--REEM-
RS4_ANADE       -VVRITE--------ALEAVDR-RGVPAWLDLDKGG-------FKGTVKTSPA--REDI-
RS4A_MYXXD      -VLRISE--------ALETVDR-RGIPQWISLDKKA-------FKGTVTTVPN--REDL-
RS4_SYNAS       -NNKIIE--------AMETIVR-RGIPQWLELEQEN-------FKGKVKMLPT--REEL-
RS4_DESPS       -NAGVVD--------NLEAVVR-RGVPTWLELDKDN-------FKASVKALPN--REEI-
RS4A_BDEBA      -MAKIQS--------AIQAVAR-RSVPAWLEADHAK-------FTGTVKDLPN--REDV-
RS4_CARHZ       -SPIAKE--------IMERAAS-KTLPAWLSYDANN-------AVGKVEALPK--REDI-
RS4_ACET2       -SPKMQS--------NKEYAAG-RPRPKWLEYDAEE-------MSGKVVALPA--REDI-
RS4_DESHY       -SPRLKE--------IL-SSLD-RTPPKWMNLDANA-------ATGTIIALPD--REDI-
RS4_MOOTA       -SPKFKE--------IAEAAAH-RNVPAWLKADSST-------LEGHVLALPT--REQI-
RS4_SYNWW       -SNKFQE--------MKEQAAY-KTPPEWLSVDAEK-------MTGTVLAYPR--REQI-
RS4A_CLOAB      -TEKFKT--------FAE-NPK-TL-PAWIEANYDN-------FEAKIVAEPN--REDI-
RS4_CLOTE       -TEKFKT--------FIE-NPR-TL-PNWLEGNLEN-------FEGKVVSQPS--REDI-
RS4A_CLOPS      -SERFKM--------FAE-NPK-AL-PKWLEANVEN-------FEGKVIAEPA--REDI-
RS4A_CLONN      -TEKFKT--------FAE-NPK-TL-PAWLEGNIEN-------FEGKVIAEPT--RADI-
RS4_CLOD6       -SAKFKN--------LVEVNSR-IA-PKWLEANVEG-------MTAKVVGVPT--REDI-
RS4_CALS4       -MELIKN--------NLE-MGR-NV-PDWLELNKDA-------FEGRVVSLPR--REHI-
RS4_GLOVI       -FVK--E--------ALEAASL-PQAPKWLEANRET-------LAATVKALPE--REDI-
RS4A_SYMTH      -HKRI-K--------ELAAAAT-RTVPAWLSVDPEA-------LRGTVLRLPN--RDEI-
RS4_SOLUE       -NATILS--------ARDATAH-APAPNWIEVDREG-------LKGRVQSLPK--REDL-
RS4_DEHMC       -TAYFKT--------LAENIEA-KAIPGWLSLDRKT-------LSGKVISLPN--AGD--
RS4_THEMA       -LEVIKK--------AIEANKE-RSIVPWIEVDYDN-------YRGTFLRYPS--LEEV-
RS4_DEIGD       -MGFIQE--------NMEAQKR-RRVSPWIELNPDT-------FTGTFVRLPA--REDL-
RS4_THET8       -LELIRQ--------NLEAMKG-RKVGPWLSLDVEG-------MKGKFLRLPD--REDL-
RS4_CAMFF       -NPQIVR--------AIELTNQ-TGIVAWVDVEKDK-------KYGIFTRIPE--REEV-
RS4_HELHP       -NPQVIR--------AIDLTSQ-TGIVPWVDVDKEK-------KFGIFTRFPQ--REEV-
RS4_SULDN       -NSQIVR--------ALELTNQ-TGLAPWVDIDADK-------KFGIFTRLPE--REEV-
RS4_WOLSU       -NPQVQR--------SIELTKQ-TGIAPWVDVDQAK-------VFGIFTRLPE--REEV-
RS4_HELPY       -NSQVVR--------AMELTAQ-TGIVPWIDVEKDK-------KYGIFTRYPE--REEV-
RS4_CHLCH       -MSAVTD--------SLNKTPE-SRIPAWIQVDKAH-------QKAVFLSVPE--RADI-
RS4_CHLL3       -MDAVTD--------ALNRAPD-ARIPAWIQVDKAN-------QKAVFLSVPE--RVDI-
RS4_CHLPD       -MGAVTD--------SLNKAPD-ARIPSWIQVDKAN-------QKAVFLSVPE--REEV-
RS4_CHLTE       -LDAVAD--------SLNKVPD-SRIPEWIQVDKAN-------RKAVFLAIPE--REAV-
RS4_CORGL       -MNWFEE--------AQDNLAD-AVVPAWLQVVPEN-------LRILVHQLPE--RAQI-
RS4_CORJK       -MLWFEE--------AQEALVD-TIVPAWLQVVPST-------LRILVHQLPE--RAQI-
RS4_MYCUA       -TVPFQI--------ARETAGD-RPIPSWLQVVGGR-------QRILIHQLPE--RAQI-
RS4_MYCVP       -TLPFEV--------ARQTAGE-RPIPGWLQVVGER-------QRILVHQLPE--RAQI-
RS4_NOCFA       -TLPFQV--------ARETLGE-RPVPGWLQVLPGR-------LRILVHQEPE--RAQI-
RS4_RHOJR       -TLPFQV--------ARETQGD-RPIPGWLQVVGGR-------LRVLVHQLPE--RAQI-
RS4_SACEN       -TTPFII--------AKETIGE-RPVPAWLQVVPSN-------LRILVHQRPE--RAQI-
RS4_NOCSJ       -MTPFIV--------ARETHGE-RVVPAWLEAIPSR-------MRVLVHQLPV--RAQI-
RS4_CUTAK       -LPPIVI--------ARETFET-RDVPAWLEVRPNK-------GRILVHQLPT--RDQI-
RS4_FRACC       -LTPFIV--------ARETAGQGRAVPAWLEVIPSQ-------LRILVHSLPA--RQVI-
RS4_ACIC1       -LTPFVI--------ARAVAGE-RTVPPWLEVIPNR-------LRILVHSLPS--RQVI-
RS4_RUBXD       -LQPIQE--------AVEQVVA---VPAWLEADHEN-------FTGRVLHTPS--RDEI-
RS4_FUSNN       -VELIKL--------AVEDATP----PAWLELDRAA-------FSGKVLQNPT--KDDL-
RS4_BACTN       -LEVIAN--------SLAGFNHSKY--AWLEWDETS-------KVGKMLHIPE--RADI-
RS4_PORGI       -LEVIAD--------ALTGFNHSKY--PWMEWDQSS-------LSGKLLHMPD--RTDI-
RS4_CYTH3       -IEAITD--------SLSTQSAKKF--TWLEWDQSS-------MLGKFVTYPQ--REEI-
RS4_GRAFK       -LAVVQE--------SLSN-NSSVY--EWISWNSEK-------KEGTFVAVPG--RVQI-
RS4_SALRD       -LEVIQT--------NVEH-RQRTF--SWLEMDRQE-------MKGKFIDYPN--REEI-
RS4_TREDE       -QNLIRH--------NMSTSQSARG--SWLTIDDEK-------LSATVNILPV--TTDI-
RS4_TREPA       -HSIIRH--------NLTLSQGQRG--SWLNVDEEQ-------LSATVSELPR--AQDI-
RS4_BORAP       -KKLIGS--------NIEQTSAQRNLPTGIELNADY-------LNIKVKHAPS--RDEI-
RS4_RHOBA       -KNLYRG--------VIANSPPDGL--DWVSFDSET-------LRATVLSLPG--AVDI-
RS4_BACCR       --NSLVV--------VKEAIEVNNFVPEYLTFDADK-------LEATYTRHAE--RSEL-
RS4_BACSU       --RNLSI--------IKESVEVNNFVPEYLTFDAEK-------LEGTFTRLPE--RSEL-
RS4_BACSK       --RNLTV--------VKEALDVNDFTPGYVSFDEEK-------LEGTYTRYPE--RSEL-
RS4_ALKHC       --RNLQV--------IKESLESNDFVPAYVTFDADK-------LEGTYSRFPE--RSEL-
RS4_GEOKA       --RNLQV--------IKEALEANNYIPDYLTFNPEK-------MEGTYTRLPE--RSEL-
RS4_OCEIH       --KNLDV--------VKEALEANSFVPEYTSFDADK-------MEGSYTRFPE--RSEL-
RS4_STAHJ       --QNLDI--------IKESVEINNFVPEYLDFDADS-------LKGTFVRFPE--RSEL-
RS4_STAS1       --LKLDI--------IAESVEINNFVPDYLEFDADN-------LKGKYIRVPE--RSEL-
RS4_LISMO       --AKNSA--------IAESLEVSSFVPEYVTFDAEK-------LTGSLNRLPE--RSEL-
RS4_LACDB       --KNLQQ--------VKDALEAVASRPSFVSFDEDK-------MEGQLVRFPE--RDEM-
RS4_LACAC       --KNLQQ--------IRDALEATTARPSFVSFDENK-------MEGTLVRLPE--RDEM-
RS4_LACGA       --KNLQQ--------VKDALDAVVSRPPFVSFDDSK-------MTGTLVRLPE--RDEM-
RS4_LACP3       --QNLAI--------VNEAIENTVSRPAYVTFDDTK-------KTGSLVRLPE--RGEL-
RS4_ENTFA       --QNIST--------IKEAVEATVGRPAFVSFDTEK-------LEGSFTRLPE--RDEL-
RS4_LACSS       --KNLVI--------IKDAIEGTVGRPSFVEFDADN-------LKGSLVRLPE--RSEL-
RS4_LACPL       --KKLAV--------ITGAVEAVVARPNFVQFDADK-------LEGSLTRLPE--REEL-
RS4_PEDPA       --KDLKI--------ISEAVEAVVGRPQFVQFDADK-------LEGSLVRLPQ--RDEL-
RS4_LEVBA       --KDMAI--------IKGAVEAVVGRPQYVEFDADK-------LAGSLTRFPQ--REEL-
RS4_LACS1       --KDLQI--------VKEALEAVVGRVPFVNFDENK-------MEGTLVRLPD--REEL-
RS4_LEUMM       --KNILP--------IQAAIESVVARPQFVSLDTEK-------LEGSLVRLPE--REEL-
RS4_OENOB       --KKIVP--------ILNSVEASLNNTPFVEFDADK-------LEGKLTRYPE--REEL-
RS4_LACLA       --MKVPA--------ILEAVEATKGRANFVSFDADK-------LEGTLVRLPE--RDEI-
RS4_STRMU       --AKVPA--------ILEAVESVVGRPAFVSFDADK-------LEGSLTRLPE--RDEI-
RS4_ONYPE       --KNLNI--------VQEAVNSKFVRADYVSLDKE--------LVGKYVRYPQ--RNEF-
RS4_MYCMS       --KKNEK--------VLEALQNNEATLEFVKVNKNE-------VKGEFVRLPE--RTEL-
RS4_MESFL       --KKNDK--------IAEALQNNESTVEFVKVDKAN-------LKGQFVRLPE--RQEL-
RS4_MYCGE       --TKSPL--------VKNFIENS-VISSFVETNKKA-------FEGTYIRFPE--RSEL-
RS4_MYCPN       --IKIPI--------VKAASESG-VVSPFVETNNKT-------FEGTYVRFPE--RSEL-
RS4_MYCGA       --HNLPL--------VKLALESK-AVAPFVEVNKKT-------LSGTYVRYPE--RNEL-
RS4_MYCPE       --KDLPI--------VAAGASNT-PCKFVDSDLKTK-------K-GKYVRFPE--RDEL-
RS4_UREPA       --LEIPL--------IK-NTLNK-PADFIELIDKEK-------KVAKLARLPE--RNEL-
RS4_MYCHJ       -IRKNQQ--------ILTSLETR-TPAAWLEVDKDN-------FKVVFNRMPE--RSEL-
RS4_MYCMO       --QNVPT--------ILASIETR-VVAPWIEKDK---------FKGKLIRVPE--RKEL-
RS4_MYCPU       --QKNAQ--------VLRNKEIR-TAADWLSVKD---------FKATFTRLPE--RNEF-
RS4_MYCS5       --RKLKL--------VQEALEMQ-PASAWVTRKD---------FQFTFYRVPE--RTEM-
RS4_TRIV2       KLVENNL-------QYPGLA----NLPSHLEFDKNK-------LVGKVNGVIEREWVALQ
RS4_TRIEI       EMVKTNL-------QYPGLA----NIPSHLEFDKNK-------LVGKVNGIVEREWVALQ
RS4_SYNY3       KLVETNM-------EFPGLA----NVPSHLEFDKNT-------FTGKVNSVIDREWVALQ
RS4_THEEB       RLVETNL-------QNPGLA----NLPSHLELDKST-------LTGRVTGIVERQWVALE
RS4_PROMA       KLAEGNL-------EFPGLA----NVPPHLELEKSK-------MTAKVTGKCDREWVAIE
RS4_PROM5       KLVEGNI-------EFPGLA----NVPPHIELDKPK-------LTGKINGKCDREWVALE
RS4_SYNS9       QLAEGNL-------AFPGLS----NIPPHLELDKAK-------LSAKCTGRCEREWVALE
RS4_SYNE7       KLVTANL-------EYPGLA----NVPVHLDFDKNK-------LEAKVTGACEREWVALQ
RR4_CYAPA       KIVETNL-------LFPGLA----NLPSHLEFDKSK-------LQGKVNDIIQREWVALE
RR4_PYRYE       KLVENYL-------AFPGLA----NIPSHLELNKSN-------LSGKVNGVIDREWVALQ
RR4_GRATL       NLVKRYL-------SFPTLV----GIPNHLELNTKT-------LNAKINAIVERESVALQ
RR4_EMIHU       SLVNTYL-------ESPSLS----QSPQHLDFDKKN-------LTAKVLGIVDREWVALK
RR4_NEPOL       KLIEGYM-------STMGSI----VTPPHLELKKEK-------LEGNIQEIIDRQWVGLP
RR4_NYMAL       ALIQNHM-------DSSSNA----ELPKHLTLHSFQ-------YKGVVNQIIDSKWVGLK
RR4_ACOCL       VLIQNNM-------DSSTRE----ELPKHLTLDSFQ-------HKGLVNQIIDSKWVGLK
RR4_PIPCE       VLVQNSM-------DSASRE----ELPKHLTLDSSQ-------YKGVVNQIIDSKGVGLK
RR4_PHAAO       ALIQNYL-------VSSPRG----ELPNHLTIDSLQ-------YKGFVNQIIDSKWIGLK
RR4_CUCSA       TLIQNYL-------DSSPPQ----ELPKHLTLQPLQ-------YKGLVNQIIDSKWVSLK
RR4_LOTJA       TLIQNSL-------ESAPRE----ELPTHLTLQPFQ-------YKGLVNQIIDSKWVGLK
RR4_PHAVU       TLIQNYL-------DSAPRD----KLPNHLTVHPFQ-------YKGLINQIIDNKWVGLK
RR4_VITVI       ALIQNVF-------DSSSHE----ELPKHLTLHPFQ-------FKGLVNQIIDSNWVGLK
RR4_OENEH       AMIQNSL-------ESPPHE----EVPKHLTFHPFQ-------YKGLVNQIIDSEWVGLK
RR4_SPIOL       ALIQNSL-------DLSPRE----ELPKHLTLNPFP-------YKGLVNQIIDSKWVGLK
RR4_JASNU       TLIQNSL-------GSSPQK----ELPNHLTLHPFQ-------YKGLVNQIIDSKWVGLK
RR4_SORBI       RLVQNYI-------ASSDPG----KLPKHLTVDTLQ-------YKGLVKKILDRKWVGLK
RR4_EPIVI       TFINNCI-------NYSTHNR--MEAPNHLTL-LHP-------FKGLVNQIIDSKWVGFK
RR4_PELHO       ALIQNYL-------DSTAKRP--IPLPKHLLLFHSDDPRD--LLKGSVKKIIDRKEVGLK
RR4_PSINU       ELIKRNI-------KLAKID----EIPSHLNISYLEETK----PKGFINKIVDRGSIGLE
RR4_ANGEV       ILVKKNL-------ESLNKD----QIPEHLTFSSLEDNK----PQGFVNRIVTRDSIGLD
RR4_MARPO       SIIIKNL-------NSFQKQ----KIPNHLTFDLMQ-------IKGLVNQIIDREWIYLK
RR4_PHYPA       AIITKNI-------DFSQKS----KVPNHLTFDSTQ-------KKGLVNQILDRESIGLK
RR4_ANTAG       NLMKRSR-------DSYEKY----GIPNHLTFNSVQ-------NIGLVNETIDRDWIGLK
RR4_HUPLU       ARITKNY-------EFSQTY----KIPNHLTLHSLQ-------SVGLVNKIVDRESIDLN
RR4_PINKO       AIIKKNI-------DLFQRD----KLPNHLTFHPLQ-------YKGFINQIIDSKWISLK
RR4_PINTH       AIIKKNI-------DLFQRD----KLPNHLTFHSLQ-------YKGFINQIIDSKWINLK
RR4_CHAGL       ALIQQNL-------GTTRKT----KLPSHLMLRSTE-------NSATVKQIVSRQSVGLK
RR4_STAPU       ALVDKNLNNSQESKKLSPSRDFLSKVPTHLRINTKN-------YKASVNQVVNRNSIGVK
RR4_ZYGCR       ILIEKN--------RTARSR---LRIPGHLAM--KQ-------NTALITQVVDPKSIGLK
RR4_CHAVU       TNIFANS-------TQSASL----KVPSHLTLNPAK-------NEGLVHQIVDREFIGAK
RR4_MESVI       NLVLNNL--------ASPSV---SKIPNHLLLKKDT-------LTATVNGIVERKSIPLE
RR4_CHLAT       NVITNNL--------SFSD----SRLPPHLSFKKES-------LVALVNGLVDRQWIPLN
RR4_OLTVI       KMVTE--------ANSTATA----NVPSHLSWNKES-------LVGVVNKVIDRKDVGLQ
RR4_TUPAK       DLVKKF-------VQESAVN----PVPSHLSFNKEN-------LVGIVNNVATREWIGLQ
RR4_CHLVU       NFVKNLL-------QSFTKT----LDAPYLEVNQEK-------LSAVVRDNIPREAVSLQ
RR4_TRICV       NLVEGNL-------QTIKQV----DLPTHLKFDKSK-------QEATVINYCDRNELLLN
RR4_THAPS       KIIENNL-------KTINFS----APPAHLTFNKEK-------LEGVVQNYCDRSELLLD
RR4_PHATC       TLVETNI-------KNNQVR----EIPTHLRFDTVK-------LEAIVLDYCDRNDVSLQ
RR4_EUGLO       RIIEKNIELL----DKYFRA------PSHLYFNKKK-------LEAKVINMVKREDIKLI
RR4_EUGGR       NVIQKNIES-----KELLLI------PPHLSLNKKN-------LEAKIIGLINRKAISLI
RR4A_CYACA      QLIDLNSRR-----DTTKFF------PKYLEVNKDN-------MGARVVKTMDKQDVNLT
RR4_BIGNA       SLNDKNN-------SFSTLN------CSHLVLNELNND-----LTITVTNLPDIQVLGYS
RR4_CHLRE       QLVNKNLQE-----YYRRMRFYKKRLEKTLPFILLKIKPLGLTSVTAAVELITKGNVRVN
RR4_TETOB       KLVNRNLQE-----YSQKMSAYKKRLERTLAYVLFQRNI--SPNMANALEYINQGKVQVN
RR4_CYAM1       AQLPPYLQV-----ENQFVKMIQPVEKDWLAFRVNELLV---------VEYYTRVGA---
RS4_SYNJA       KLVAAYA-------EYPGLF-----LPDYLEFDKEK-------LRGRIKELPPREQICAP
RR4_OSTTA       APIVEHA-------KTFGGV-----VPSHLSVDKNN-------ATGKVERNVTRSQIGLT
RS4B_NITEU      PIVLGTL-------QDLPLS-----RPEWLLWDEKD-------KTGKITHLPTAEDVPFP
RS4_METFK       PIVVETL-------ANPPLT-----RPEWISWAEQS-------QQAKVAHLPAAEDVPFP
                                                                            

RS4_ARTS2       ----PVTCEEQLVVEFYAR------------------------
RS4_LEIXX       ----PVTCEVQLVVEYYAAR-----------------------
RS4_TROWT       ----PVTCNVQLVVEYYAAR-----------------------
RS4_BIFAA       ----PVQVNIQYVVEFYAR------------------------
RS4_STRCO       ----PVICDEQLVVEYYAR------------------------
RS4_THEFY       ----PVPFDEQLVVEYYAR------------------------
RS4_RHIME       --PYPVVMEPHLVVEFYSR------------------------
RS4_AGRFC       --PYPVVMEPHLVVEFYSR------------------------
RS4_CHESB       --PYAVHMEPNLVIEYYSR------------------------
RS4_BRUSU       --PYAVQMEPNLVVEFYSR------------------------
RS4_RHILO       --PFAVQMEPNLVVEFYSR------------------------
RS4_BARBK       --PYAVQMEPNLVVEFYSR------------------------
RS4_RHOS1       --PYPVQMEPNLVVEFYAKN-----------------------
RS4_PARDP       --PYAVQMEPNLVVEFYAKN-----------------------
RS4_JANSC       --PYPVVMEPNLVVEFYAKN-----------------------
RS4_ROSDO       --PYPVMMEPNLVVEFYAKN-----------------------
RS4_RHOPB       --PFAVQMEPHLIVEFYSR------------------------
RS4_BRADU       --PFPVQMEPHLVVEFYSR------------------------
RS4_CAUVC       --PYPVKMEPNLVVEFYAS------------------------
RS4_MARMM       --PYAVQMEPNLVIEFYSS------------------------
RS4_HYPNA       --PYPVKMEPAQVVEFYSS------------------------
RS4_ERYLH       --PYPVTMEPNLVVEFYSR------------------------
RS4_NOVAD       --PYPVKMEPNLVVEFYSR------------------------
RS4_SPHAL       --PYPVKMEPNLVVEFYSR------------------------
RS4_ZYMMO       --PYPVKMEPNLVVEFYSR------------------------
RS4_GLUOX       --PYPVQMEPNLVVEFYSR------------------------
RS4_GRABC       --PYPVQMEPNLVIEYYSR------------------------
RS4_MAGSA       --PYAVQMEPNLVVEFYSR------------------------
RS4_RHORT       --PYPVQMEPNLVVEFYSR------------------------
RS4_PELUB       --PYPVIMEPNLVIEYYSR------------------------
RS4_RICTY       --PYPFEAEVHLVIELYSR------------------------
RS4_RICBR       --RYPFTPEVHLVVELYSR------------------------
RS4_ANAMM       --PYPANMEVNLVVEFFSG------------------------
RS4_ANAPZ       --PYPANMEVNLVVEFYSG------------------------
RS4_EHRCR       --PYPATMEVNLVIEFYSR------------------------
RS4_EHRRW       --PYPANMEVNLVIEFYSR------------------------
RS4_WOLTR       --PYSADMEVNLVVEFYSR------------------------
RS4_CHLAB       -AQLPLPVDVSVVCEFLSHRT----------------------
RS4_CHLPN       -AQLPLPINISVVCEFLSHRT----------------------
RS4_CHLMU       -SQLPLPVNVSVICEFLSHRT----------------------
RS4_PARUW       --PWPIEISLPVICDFLAHST----------------------
RS4_AQUAE       ---EIP-INLQYIVEFYSKV-----------------------
RS4_LEPBL       ---DLP-VKEQVIVELYSK------------------------
RS4_ACIBT       ---PAE-INESLIVELYSK------------------------
RS4_PSYCK       ---PAE-INESLIVELYSK------------------------
RS4_ECOLI       ---SAD-INEHLIVELYSK------------------------
RS4_HAES1       ---SAD-INEHLIVELYSK------------------------
RS4_SHELP       ---SAD-INEQLIVELYSK------------------------
RS4_AERS4       ---SAD-INEQLIVELYSK------------------------
RS4_PSEA6       ---SAE-INEQLIVELYSK------------------------
RS4_VIBCH       ---SAD-INEQLIVELYSK------------------------
RS4B_PSYIN      ---SAE-INEQLIIELYSK------------------------
RS4_COLP3       ---SAE-INEQLIVELYSK------------------------
RS4_PSET1       ---SAD-INEQLIVELYSK------------------------
RS4_PSEAB       ---SAD-INENLIVELYSK------------------------
RS4_PSEE4       ---SAD-INENLIVELYSK------------------------
RS4_SACD2       ---PAE-INENLIVELYSK------------------------
RS4_HAHCH       ---SPD-INENLIVELYSK------------------------
RS4_MARHV       ---PAD-INENLIVELYSK------------------------
RS4_ALCBS       ---PAE-INENLIVELYSK------------------------
RS4_CHRSD       ---SAD-INENLIVELYSK------------------------
RS4_HYDCU       ---SAD-ISENLIVELYSK------------------------
RS4_ALKEH       ---SAE-INESLIVELYSK------------------------
RS4_HALHL       ---SQE-INESLIVELYSK------------------------
RS4_NITOC       ---APD-IQENLVVELYSK------------------------
RS4_FRATO       ---SAD-INEQLIIELYSK------------------------
RS4_PARXL       ---AGD-INESLIVELYSR------------------------
RS4_RALSO       ---AGD-INESLIVELYSR------------------------
RS4_BORA1       ---ARD-VNESMVVELYSR------------------------
RS4_POLSJ       ---AAD-VNESLIVELYSR------------------------
RS4_RHOFT       ---AAD-VNESLIVELYSR------------------------
RS4_VEREI       ---GAD-INESLIVELYSR------------------------
RS4_METPP       ---GSD-INESLIVELYSR------------------------
RS4_NEIMF       ---TGD-INEQLVVEFYSK------------------------
RS4_CHRVO       ---SSD-INEQLVVEFYSK------------------------
RS4_METCA       ---GSD-INEQLVVELYSK------------------------
RS4_BUCAI       ---SAE-INEYLIVELYSK------------------------
RS4_BUCAP       ---SAE-INEHLIVELYSK------------------------
RS4_BAUCH       ---SAH-INEHMIVELYSK------------------------
RS4_BLOFL       ---SAN-INEHLIVELYSK------------------------
RS4_BLOPB       ---SAN-IDEHLIIELYSK------------------------
RS4_BUCBP       ---SAE-INEYLIIELYSK------------------------
RS4_WIGBR       ---SSE-INEHLIIELYSK------------------------
RS4_BUCCC       ---SSD-INEHLIIELYSK------------------------
RS4_RUTMC       ---SSD-IQEHLIVELYSK------------------------
RS4_LEGPA       ---SSD-YNVNLVVELYSK------------------------
RS4_COXBU       ---PAE-FKVNLVVELYSK------------------------
RS4_XANOM       ---PSD-INEALIVELYSK------------------------
RS4_XYLFT       ---PSD-INEALIVELYSK------------------------
RS4_AROAE       ---PPT-INEGLVVELYSR------------------------
RS4_AZOSB       ---SAT-INEGLVVELYSR------------------------
RS4_DECAR       ---PAT-LNEGLVIELYSK------------------------
RS4_THIDA       ---PST-INESLVVELYSK------------------------
RS4_NITMU       ---PSS-INESLVIELYSK------------------------
RS4_NITEC       ---SST-INESLVVELYSK------------------------
RS4_MAGMM       ---PAE-FNENLIVELYSK------------------------
RS4_DESVV       ---QFP-INEHLIVELYSK------------------------
RS4_DESAG       ---QFP-MSEQLIVELYSK------------------------
RS4_LAWIP       ---QFP-INEHLIVELYSK------------------------
RS4_GEOSL       ---TMP-IQEQLIVELYSK------------------------
RS4_PELPD       ---TTP-IQEQLVVELYSK------------------------
RS4_PELCD       ---TTPAFQEQLIVELYSK------------------------
RS4_SYNFM       ---NLP-VQEQLVVEFYSK------------------------
RS4_ANADE       ---TMP-IQEQLIVELYSK------------------------
RS4A_MYXXD      ---TMP-ISEQLIVELYSK------------------------
RS4_SYNAS       ---TMP-IQEQLVVELYSK------------------------
RS4_DESPS       ---TMP-IQERLIVELYSKN-----------------------
RS4A_BDEBA      ---AVA-VEENMIVEYYSR------------------------
RS4_CARHZ       ---DIP-VEEHLIVELYSR------------------------
RS4_ACET2       ---DLP-IRENLIVELYSK------------------------
RS4_DESHY       ---QLP-IQEHLIVEKYSR------------------------
RS4_MOOTA       ---DTP-AQEHLIVELYSR------------------------
RS4_SYNWW       ---DTL-VNEQLIVELYSR------------------------
RS4A_CLOAB      ---DTP-IKETLIVELYSK------------------------
RS4_CLOTE       ---DVP-VNETLIVELYSK------------------------
RS4A_CLOPS      ---DVP-VNETLIVELYSK------------------------
RS4A_CLONN      ---DVP-VNETLIVELYSK------------------------
RS4_CLOD6       ---DLE-IAEHLIIELYSK------------------------
RS4_CALS4       ---DLP-VQEHLIVELYSK------------------------
RS4_GLOVI       ---DTP-VQELLIVEFYSR------------------------
RS4A_SYMTH      ---DTP-VQEQLIVEFYSR------------------------
RS4_SOLUE       ---VQIQLNEQLIVELYSK------------------------
RS4_DEHMC       ---IDARFDAQTVVEYYSR------------------------
RS4_THEMA       ---TDLPVDLQTVIEFYSR------------------------
RS4_DEIGD       ---ALP-INENFIIEYYSR------------------------
RS4_THET8       ---ALP-VNEQLVIEFYSR------------------------
RS4_CAMFF       ---VIP-VEERYIVELYSK------------------------
RS4_HELHP       ---VIP-IEERLIVELYSK------------------------
RS4_SULDN       ---VIP-VEERLIVELYSK------------------------
RS4_WOLSU       ---VIP-VEERLIVELYSK------------------------
RS4_HELPY       ---VVP-IEERLIVELYSK------------------------
RS4_CHLCH       ---QEE-FNEQLVVELYSK------------------------
RS4_CHLL3       ---QEP-YNEQLVVELYSK------------------------
RS4_CHLPD       ---QEP-FNEQLVVELYSK------------------------
RS4_CHLTE       ---QEP-FNEQLVVELYSK------------------------
RS4_CORGL       ---DIP-LQEQLIVEFYSK------------------------
RS4_CORJK       ---DIP-LQEQLIVELYSK------------------------
RS4_MYCUA       ---EVP-LTEQLIVEYYSK------------------------
RS4_MYCVP       ---DVP-LTEQLIVELYSK------------------------
RS4_NOCFA       ---DVP-LQEQLIVEYYSK------------------------
RS4_RHOJR       ---DVP-LQEQLIVEYYSK------------------------
RS4_SACEN       ---DTP-VTEQLIVELYSK------------------------
RS4_NOCSJ       ---DIP-VQEQLIVEYYSKK-----------------------
RS4_CUTAK       ---VID-VNEQAIVELYSK------------------------
RS4_FRACC       ---DTQ-VQEQLIVELYSK------------------------
RS4_ACIC1       ---DTP-VQEQLIVEFYSK------------------------
RS4_RUBXD       ---DAP-VEEQLIIEFYSR------------------------
RS4_FUSNN       ---DFD-LNESLIVEFYSR------------------------
RS4_BACTN       ---PEN-IKEHLIVELYSK------------------------
RS4_PORGI       ---PEN-IKEQLIVELYSK------------------------
RS4_CYTH3       ---PEN-IQEQLIVELYSK------------------------
RS4_GRAFK       ---PEN-INEQFIVELYSK------------------------
RS4_SALRD       ---PEN-IDEQLIVELYSK------------------------
RS4_TREDE       ---QPV-GNIQNVVEYYSRNA----------------------
RS4_TREPA       ---HPV-GNIQHIVEYYSR------------------------
RS4_BORAP       ---PTL-ANEQMVVEYYSKRA----------------------
RS4_RHOBA       ---SLP-VDANSVVEFLSR------------------------
RS4_BACCR       ---PAE-INEALIVEFYSR------------------------
RS4_BACSU       ---APE-INEALIVEFYSR------------------------
RS4_BACSK       ---PAE-ITEALIVEWYSR------------------------
RS4_ALKHC       ---PAE-ITEALIVEFYSR------------------------
RS4_GEOKA       ---PAE-INEALIVEFYSR------------------------
RS4_OCEIH       ---PAE-INEQLIVEFYSR------------------------
RS4_STAHJ       ---PAE-INEQLIVEYYSR------------------------
RS4_STAS1       ---PAE-INEQLIVEYYSR------------------------
RS4_LISMO       ---AAE-INEAFIVEFYSR------------------------
RS4_LACDB       ---EPE-IDEALVVEYYNKLL----------------------
RS4_LACAC       ---EPE-IDESLVVEWYNKLL----------------------
RS4_LACGA       ---EPE-VDEALIVEWYNKKL----------------------
RS4_LACP3       ---EPE-VDESLVVEYYNQKL----------------------
RS4_ENTFA       ---YPE-IDEALVVEYYNQKL----------------------
RS4_LACSS       ---EPE-IDEALIVEFYNR------------------------
RS4_LACPL       ---EAD-IDESLIVEYYNKL-----------------------
RS4_PEDPA       ---EAD-IDDSLIVEYYNKL-----------------------
RS4_LEVBA       ---DAE-LDDSLIVEYYNR------------------------
RS4_LACS1       ---DAN-IDEALVVEFYNR------------------------
RS4_LEUMM       ---DAD-INEALIVEYYNHLG----------------------
RS4_OENOB       ---GAD-INESLIVEYYNRLG----------------------
RS4_LACLA       ---NPE-INEALIVEFYNKMM----------------------
RS4_STRMU       ---NPE-INEALVVEFYNKML----------------------
RS4_ONYPE       ---LPD-INEQLIVEYYNR------------------------
RS4_MYCMS       ---SSE-ISESLIVEWYNRLIKK--------------------
RS4_MESFL       ---NLE-INDALIVEWYNRLIK---------------------
RS4_MYCGE       ---PAG-INESYVVEWYKRLVK---------------------
RS4_MYCPN       ---PAG-INESYVVEWYKRLVK---------------------
RS4_MYCGA       ---PAD-VNETYVVEYYKRLVK---------------------
RS4_MYCPE       ---PEG-INEAYVVEWFNRLV----------------------
RS4_UREPA       ---PAD-VNEAYVVEWYNRLM----------------------
RS4_MYCHJ       ---NQE-IKESLIVEFYSK------------------------
RS4_MYCMO       ---NQE-INEALIVEFYNK------------------------
RS4_MYCPU       ---LKE-VNDSLIVEFYNK------------------------
RS4_MYCS5       ---HKD-IKEALVVEFYAK------------------------
RS4_TRIV2       -------VNELLVVEYYSRQA----------------------
RS4_TRIEI       -------INELLIVEYYSRQA----------------------
RS4_SYNY3       -------INELLVIEYYSRKA----------------------
RS4_THEEB       -------VNELLVVEYYSRKV----------------------
RS4_PROMA       -------INELLVVEYYSRKV----------------------
RS4_PROM5       -------INELLVVEYYSRKV----------------------
RS4_SYNS9       -------INELLVVEYYSRKV----------------------
RS4_SYNE7       -------INELLVVEYYSRKV----------------------
RR4_CYAPA       -------VNELLIVEFYSR------------------------
RR4_PYRYE       -------LNELLVIEYYSRK-----------------------
RR4_GRATL       -------MNELLVVEYYSRK-----------------------
RR4_EMIHU       -------LNELFVIEYYSRKI----------------------
RR4_NEPOL       -------INELLVVEYYSPKV----------------------
RR4_NYMAL       -------VNELLIVEYYSRQT----------------------
RR4_ACOCL       -------INELLVVEYYSRQT----------------------
RR4_PIPCE       -------INELLVVEYYSRQT----------------------
RR4_PHAAO       -------INELLVVEYYSRQT----------------------
RR4_CUCSA       -------INELLVVEYYSRQT----------------------
RR4_LOTJA       -------INELLVVEYYSRQT----------------------
RR4_PHAVU       -------INELLVVEYYSRQT----------------------
RR4_VITVI       -------INELLVVEYYSRQT----------------------
RR4_OENEH       -------INELLVVEYYSRQTKT--------------------
RR4_SPIOL       -------INELLVVEYYSRQT----------------------
RR4_JASNU       -------INELLVVEYYSRQTKA--------------------
RR4_SORBI       -------INELLVVEYYSRQT----------------------
RR4_EPIVI       -------INELLVVEYYFRKT----------------------
RR4_PELHO       K------IKELLVIEYYSRQISP--------------------
RR4_PSINU       -------INELLVVEYYSRQA----------------------
RR4_ANGEV       -------INELLVVEYYSRKA----------------------
RR4_MARPO       -------INELLVVEYYSRQV----------------------
RR4_PHYPA       -------INELLVVEYYSRQA----------------------
RR4_ANTAG       -------INELLVVEYYSRQA----------------------
RR4_HUPLU       -------INELLVVEYYSRKA----------------------
RR4_PINKO       -------INELLVVEYYSRQA----------------------
RR4_PINTH       -------INELLVVEYYSRQA----------------------
RR4_CHAGL       -------INELLVVEYYSRQA----------------------
RR4_STAPU       -------VNELLVVEYYSRQA----------------------
RR4_ZYGCR       -------VNELFIVEYYSRQA----------------------
RR4_CHAVU       -------INELLVVEYYSRQV----------------------
RR4_MESVI       -------INELLVVEYYSRQT----------------------
RR4_CHLAT       -------INELLVVEYYSRMA----------------------
RR4_OLTVI       -------LNELLVVEYYSR------------------------
RR4_TUPAK       -------INELLVIEYYSRN-----------------------
RR4_CHLVU       -------INELLVVEFYSRKV----------------------
RR4_TRICV       -------LDELLVIEYYSRR-----------------------
RR4_THAPS       -------LNELLVIEYYSRR-----------------------
RR4_PHATC       -------LDELLVIEHYSRR-----------------------
RR4_EUGLO       -------INELLIIEFYSRKV----------------------
RR4_EUGGR       -------VNELLVIEFYSRKV----------------------
RR4A_CYACA      -------INELLVVEFYSRKG----------------------
RR4_BIGNA       -------INILLVLEYYSGK-----------------------
RR4_CHLRE       -------NKSVKTPNYICRPRDTVSLRTKQGIKKVFLKNYLKG
RR4_TETOB       -------NRKVLLPNYLCHSKDMISVKTDKGIRKFQFSE----
RR4_CYAM1       -------------------------------------------
RS4_SYNJA       -------VNELLVVEFYSRKL----------------------
RR4_OSTTA       -------VNELLIIEFYSRK-----------------------
RS4B_NITEU      -------IDVQQVVEYYANRM----------------------
RS4_METFK       -------VDVQQVVEYYANRL----------------------