CLUSTAL format seed alignment for MF_01307_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RS5_NEOSM       --------------------------------------MKNV------------------
RS5_MYCHJ       -MDRKLENQKDLLNQDPKVELNSQSVAKNPLNSREVKPIQRR------------------
RS5_MYCH7       MDKKLENQKDLLNQDPKVELNSQSVAKNPLNSREVKPIQRRR------------------
RS5_MYCMO       MPIDKKQEKNFTNKIQEEGQKSLDTSLTQEIEILEEKLNKNPDHKGTINTTPNDNSTSKN
RS5_MYCPU       -----MEKEKNKKFDSSSFKKEEKSNLAWKKEAKATKEIIKK-DDEMEVVTEESQSKNEG
RS5_LEPIN       ------------------------------------------------------------
RS5_LEPIC       ------------------------------------------------------------
RS5_BORBU       ------------------------------------MVDVHA------------------
RS5_BORBP       ------------------------------------MVDVQA------------------
RS5_TREDE       --------------------------------------MSHQ------------------
RS5_TREPA       --------------------------------------MDRH------------------
RR5_THAPS       -------------------------------MSTEFNQVNKL------------------
RR5_TRICV       -------------------------------MSTDLKQVNKS------------------
RR5_PHATC       -------------------------------MSSDLKKINKV------------------
RR5_CYACA       --------------------------------------MSRD------------------
RR5_CYAM1       --------------------------------------MQNM------------------
RS5_GLOVI       MPPQQQRGRGRGRGPGGPGGPGGPGPEQAPEDPDRESGGERR----------------RG
RR5_GUITH       --------------------------------------MLNA------------------
RS5_PROM9       -------MTDTPTKQEITSKNDKVPGAIPGEQKKNNRNNDRK------------------
RS5_PROMP       -------MTDTPTKQENQSKTENPPSSNANEQRRGNRNNDRK------------------
RS5_PROMA       --MTETKAKSKSKENSSSPVPAAAEGQQQEQKRGNSRGGERR------------------
RS5_PROMT       ----MTDSNNQSPNKKTSGSSSAPPAADGRQENRRSRGEKRG------------------
RS5_PROMM       --------MTQPNTQTTPNDVPAAAEGQQEQQQQQRRGGGRE------------------
RS5_SYNPX       ----MTDSSPQSNPNAVPGAADVPAAAEGQQQEQRRGGGRGE-R---------------G
RS5_SYNP6       ---------------------------------MAEEKDKKQ------------------
RS5_SYNY3       --------------------------------------MAKR------------------
RS5_THEEB       --------------------------------------MANR------------------
RS5_TRIV2       --------------------------------------MATG------------------
RR5_CYAPA       --------------------------------------MANR------------------
RR5_GRATL       --------------------------------------MKKK------------------
RR5_PORPU       --------------------------------------MANR------------------
RR5_PYRYE       --------------------------------------MANR------------------
RS5_MYCGA       ------------MEDIKHNKKPNTNNSAETKKASGANPQANH-A-NPNNRSASVNNNSVN
RS5_MYCGE       MNDQKTTNTGLLTSTLKTKPKHNLKPSSEAIKKAVSKKEGHY------------------
RS5_MYCPN       -------------------MTDQNQKANQGNGLQTTNLQAHA-QRKHNLRPSSEGIKKAV
RS5_MYCPE       MEDIKTTTPEVKNEENKTSEVKEGKALEKNNKPHFVKANSSN-V-KPFERRSNPNNKKPF
RS5_LEGPH       ----------------------------------MSFDELPK------------------
RS5_NEIMB       --------------------------------------MAKH------------------
RS5_CHRVO       --------------------------------------MAKH-E----------------
RS5_NITEU       --------------------------------------MTKT------------------
RS5_DECAR       --------------------------------------MAKP------------------
RS5_BORPE       --------------------------------------MATK------------------
RS5_THIDA       --------------------------------------MART------------------
RS5_AROAE       --------------------------------------MAKQ------------------
RS5_NITMU       --------------------------------------MAKM------------------
RS5_BURP1       --------------------------------------MAKM------------------
RS5_BURL3       --------------------------------------MAKM------------------
RS5_CUPPJ       --------------------------------------MAKM------------------
RS5_RALSO       --------------------------------------MAKI-Q----------------
RS5_HYDCU       --------------------------------------MSSK------------------
RS5_XANC5       ------------------------------------MAEERA------------------
RS5_XYLFA       ------------------------------------MAEERS------------------
RS5_XYLFT       ------------------------------------MAEERS------------------
RS5_FRATT       --------------------------------------MSNE------------------
RS5_COXBU       ---------------------------------MQEAGIGTT------------------
RS5_PSEAE       --------------------------------------MANN------------------
RS5_PSEPK       --------------------------------------MANN------------------
RS5_PSEF5       --------------------------------------MSNN------------------
RS5_PSEPF       --------------------------------------MSNN------------------
RS5_PSESM       --------------------------------------MSNH------------------
RS5_PSE14       --------------------------------------MSNH------------------
RS5_PSYA2       --------------------------------------MARN------------------
RS5_ACIAD       --------------------------------------MAKV------------------
RS5_ACIBT       --------------------------------------MAKV------------------
RS5_BLOFL       --------------------------------------MRYS------------------
RS5_WIGBR       --------------------------------------MVNF------------------
RS5_BUCBP       --------------------------------------MSNI------------------
RS5_BLOPB       --------------------------------------MKYT------------------
RS5_COLP3       --------------------------------------MANH------------------
RS5_PSEHT       --------------------------------------MANV------------------
RS5_BUCAI       --------------------------------------MANI------------------
RS5_BUCAP       --------------------------------------MANI------------------
RS5_PHOLL       --------------------------------------MAHI------------------
RS5_HAEDU       --------------------------------------MSNI------------------
RS5_HAEI8       --------------------------------------MSNI------------------
RS5_MANSM       --------------------------------------MANI------------------
RS5_PASMU       --------------------------------------MANI------------------
RS5_YERPS       --------------------------------------MSHI------------------
RS5_PECAS       --------------------------------------MAHI------------------
RS5_ECOLI       --------------------------------------MAHI------------------
RS5_SHIDS       --------------------------------------MAHI------------------
RS5_PHOPR       ------------------------------------MANEKT------------------
RS5_ALIF1       --------------------------------------MAKE------------------
RS5_VIBPA       --------------------------------------MAKE------------------
RS5_VIBVY       --------------------------------------MAKE------------------
RS5_VIBCH       --------------------------------------MAKE------------------
RS5_IDILO       --------------------------------------MANV------------------
RS5_SHEON       --------------------------------------MAKL-E----------------
RS5_METCA       --------------------------------------MANV------------------
RS5_NITOC       --------------------------------------MAQTDR----------------
RS5_RICBR       --------------------------------------MSKV------------------
RS5_RICPR       --------------------------------------MSKV------------------
RS5_RICTY       --------------------------------------MSKV------------------
RS5_RICCN       --------------------------------------MSKV------------------
RS5_RICFE       --------------------------------------MSKV------------------
RS5_WOLPM       --------------------------------------MAIK------------------
RS5_WOLTR       --------------------------------------MTIK------------------
RS5_EHRRW       --------------------------------------MDVV------------------
RS5_EHRCJ       ------------------------------------MDVVKK------------------
RS5_EHRCR       ------------------------------------MDVVKK------------------
RS5_ANAMM       ------------------------------------MSVDKK------------------
RS5_ANAPZ       --------------------------------------MSVD------------------
RS5_PELUB       --------------------------------------MDFK------------------
RS5_ZYMMO       -MANESEIQKTENAEVANAANGTNPNNERRGRGGRGRGGRGR-D-G--------------
RS5_GLUOX       --------------------------------------MAREPR----------------
RS5_RHORT       ------------------------MARTPNTDRRQRGGDDQR------------------
RS5_RHOS4       --------------------------------------MAER------------------
RS5_RUEPO       --------------------------------------MAER-E----------------
RS5_CAUVC       ---------------------------MARGEQQRGEGGQRR------------------
RS5_BRADU       -----------------------------MAEREQRGGRDQR------------------
RS5_NITWN       ------------------------------------MAGERE------------------
RS5_RHOPA       ------------------------------------MAAERE-R----------------
RS5_RHILO       ------------------------------------MAQERR------------------
RS5_AGRFC       ------------------------------------MAQEKR------------------
RS5_RHIME       ------------------------------------MAQERR------------------
RS5_BRUSU       --------------------------------------MAQR------------------
RS5_BARHE       --------------------------------------MAQK------------------
RS5_BARQU       --------------------------------------MAQK------------------
RS5_DEHM1       ----------------------------------MLAKVERI------------------
RS5_DEHMC       ----------------------------------MLAKVERI------------------
RS5_FUSNN       -------------------------------------MLNRE------------------
RS5_PARUW       --------------------------------------MAKN------------------
RS5_CHLTA       ------------------------------------MTLSRN------------------
RS5_CHLPN       ------------------------------------MSLSKN------------------
RS5_CHLAB       ------------------------------------MTLSKN------------------
RS5_CHLCV       ------------------------------------MTLSKN------------------
RS5_RHOBA       --------------------------------------MSNA------------------
RS5_THEMA       --------------------------------------METQ------------------
RS5_UREPA       ------------MENNVKKETIVDSEKVEKQQLVTAPVVNKK------------------
RS5_ONYPE       --------------------------------------MKAI------------------
RS5_PORGI       --------------------------------------MAIV------------------
RS5_BACFN       --------------------------------------MAGV------------------
RS5_BACTN       --------------------------------------MAGV------------------
RS5_DEIRA       ----------------------------------MALTFNRR------------------
RS5_THET8       ------------------------------------------------------------
RS5_TROW8       ----------MVRQSGSELSDQSDTDISADSDTSASQGSARH----------------SA
RS5_TROWT       ----------MVRQSGSELSDQSDTDISADSDTSASEGSARH------------------
RS5_BIFLO       ------------MAEETQNTVATESNNEDRKGRRGQRGEGRR------------------
RS5_LEIXX       -------MAAEVTETAQPVETAASTDNNREQREPRRGGRERN------------------
RS5_CORJK       -------------MSGRERNGGRSAENNDKKERNERNGRNDR------------------
RS5_CORDI       -----------------------MPGRERRDGGRSADDNQKK------------------
RS5_COREF       ------------MPGRERRDGGRSADENKSNDRNERRGGGRR------------------
RS5_CORGL       -----------------------MPGRERRDGGRSADDNKQN------------------
RS5_NOCFA       ---------MPGRQRRDGGNGPAGQNSNGPEGRDNRRGGGDR------------------
RS5_MYCLE       -----------------------MAAQSAGLLGDSREGRSRR------------------
RS5_MYCTU       ----------------MAEQPAGQAGTTDNRDARGDREGRRR------------------
RS5_MYCPA       -------------------MAEQPAGGQGAGDSRDSRGDRDS----------------RG
RS5_CUTAK       --------------------------MSGTQRRGGGAGGERR------------------
RS5_THEFY       ----------------------------MAAAPRRGAGGERR------------------
RS5_STRAW       -------------------------MAGPQRRGSGAGGGERR------------------
RS5_STRCO       ------------------------MAGPQRRGSGAGGGERRD-R----------------
RS5_SOLUE       ----------------------------------MNTTVKRI------------------
RS5_AQUAE       ------------------------------------MGGKDI------------------
RS5_PELLD       --------------------------------------MAKT------------------
RS5_CHLCH       --------------------------------------MAKT------------------
RS5_CHLTE       --------------------------------------MSKK------------------
RS5_MESFL       --------------MENKTEVVVAENANNQTQPERKKFDRKP------------------
RS5_MYCCT       -----------MNVVETSSEMNSNVEKASTPKQENNKRFERK------------------
RS5_MYCMS       --------MTEEMNVVETSSEMNSNVEKASTQVKETKKFERR------------------
RS5_BDEBA       --------------------------------------MEKV------------------
RS5_DESPS       --------------------------------------MSDF------------------
RS5_CAMJR       --------------------------------------MEKY------------------
RS5_SULDN       --------------------------------------MEIN------------------
RS5_HELPJ       --------------------------------------MEEI------------------
RS5_HELHP       --------------------------------------MEIN------------------
RS5_WOLSU       ------------------------------------------------------------
RS5_DESAG       --------------------------------------MEQN------------------
RS5_DESVH       ------------------------------------------------------------
RS5_PELCD       --------------------------------------MLRI------------------
RS5_GEOMG       --------------------------------------MQKI------------------
RS5_GEOSL       --------------------------------------MYKI------------------
RS5_SYMTH       --------------------------------------MARN------------------
RS5_CALS4       --------------------------------------MARV------------------
RS5_LACAC       --------------------------------------MANR------------------
RS5_LACJO       --------------------------------------MANR------------------
RS5_CARHZ       --------------------------------------MARI------------------
RS5_CLOAB       ---------------------------------------MRI------------------
RS5_CLOPE       -----------------------------------------M-R----------------
RS5_LACSS       --------------------------------------MTYI------------------
RS5_LACPL       --------------------------------------MTFI------------------
RS5_STAS1       --------------------------------------MARR------------------
RS5_STAAW       --------------------------------------MARR------------------
RS5_STAEQ       --------------------------------------MARR------------------
RS5_STAHJ       --------------------------------------MARR------------------
RS5_LISMF       -------------------------------------MPEQI------------------
RS5_LISIN       -------------------------------------MPEQI------------------
RS5_OCEIH       -------------------------------------MNTNI------------------
RS5_GEOKA       --------------------------------------MRRI------------------
RS5_BACSK       --------------------------------------MRSI------------------
RS5_BACHD       --------------------------------------MRRI------------------
RS5_BACHK       --------------------------------------MHRI------------------
RS5_BACLD       ------------------------------------MNMRRI------------------
RS5_BACSU       ------------------------------------MRRI-D------------------
RS5_ENTFA       --------------------------------------MVYI------------------
RS5_LACLA       --------------------------------------MAEN------------------
RS5_STRR6       ------------------------------------MAFKDN------------------
RS5_STRT1       ------------------------------------MAFKDN------------------
RS5_STRP3       ------------------------------------MAFKDN------------------
RS5_STRA5       ------------------------------------MAFKDN------------------
RS5_STRMU       ------------------------------------MAFKDN------------------
                                                                            

RS5_NEOSM       ------------DHR----------NLDLFESVVDIARVSKVTKGGRQFSFRVAALVGD-
RS5_MYCHJ       ---RPLRKNSRDKNS----------KPEFEERVIAIHRVVKVVKGGRRFSFSAFAVVGN-
RS5_MYCH7       ----PLRKNARDKNS----------KPEFEERVIAIHRVVKVVKGGRRFSFSAFAVVGN-
RS5_MYCMO       SKDKDFKFKKKTNSQNFKKNANKKPEKEFEEKIVNIARVTNVVKGGRRFSFAAVVVVGD-
RS5_MYCPU       NFKARRKVKKVISKP----------KTEFSEKIVDIARVTKVVKGGRRFSFSAFVVVGN-
RS5_LEPIN       --------MAYQDEE----------SKEYSEKVVKIDRVAKVVKGGRRFSFNALSVVGD-
RS5_LEPIC       --------MAYQDEE----------SKEYSEKVVKIDRVAKVVKGGRRFSFNALSVVGD-
RS5_BORBU       -------------------------QRKQIEKLISLNRVTKVVKGGRRFSFAAFMVVGD-
RS5_BORBP       -------------------------QRKQIEKLISLNRVTKVVKGGRRFSFAAFMVVGD-
RS5_TREDE       -----KESKRDNQHT----------DKEYVEKLVKLNRTAKVVKGGRRFSFSALTVVGD-
RS5_TREPA       ------RDFGKDRLR----------DKEFTEKLIKLNRTAKVVKGGRRFSFSALTVVGD-
RR5_THAPS       ----KKTPRRNDNLN----------EAKFVERLIKISRVTKVTKGGKKLSFRAVVVIGD-
RR5_TRICV       ----KKALQRNDNLS----------ESKFVERLIKISRVSKVTKGGKKLSFRAIVVVGN-
RR5_PHATC       ----KKNSRRISNTQ----------EPKLVERLIKISRVSKVTKGGKKLSFRAIVVVGD-
RR5_CYACA       ------TSANSSGQQ----------NYTWSERVIQITRVTKVVKGGKKLSFRAIIVIGN-
RR5_CYAM1       ------------NEQ----------QEQWQERVIQIRRVAKVVKGGKKLSFRVLVVVGN-
RS5_GLOVI       RGRGAGRGGGDKAER-------AQAETEFQERVVQIRRVTKVVKGGKKLSFRAVIVVGD-
RR5_GUITH       ------KKSNKTKEK----------ETDWQERVIQVRRVTKVVKGGKKLSFRAIIILGN-
RS5_PROM9       ---RNRRGDSKNLER----------DSDWQERVVQIRRVSKTVKGGKKMSFRAIVVVGN-
RS5_PROMP       ----RNRRGDSKNER----------DSEWQERVVQIRRVSKTVKGGKKMSFRAIVVVGN-
RS5_PROMA       ----GRRSDRRNQDR----------DSEWQERVIQIRRVSKTVKGGKKMSFRAIVVVGN-
RS5_PROMT       -----GRRDRRGQER----------DSEWQERVVQIRRVSKTVKGGKKMSFRAIVVVGN-
RS5_PROMM       RRGGGRRGDRRGQER----------DSEWQERVVQIRRVSKTVKGGKKMSFRAIVVVGN-
RS5_SYNPX       DRRGGRRGDRRNQER----------DSEWQERVVQIRRVSKTVKGGKKMSFRAIVVVGN-
RS5_SYNP6       ---SSRRRNNRRTEK----------ESEWQERVVQIRRVTKVVKGGKKLSFRAIVIVGN-
RS5_SYNY3       ------RKTSREKKE----------DTNWQERVIQIRRVSKVVKGGKKLSFRAIVVVGN-
RS5_THEEB       ------RKNPRKVEK----------ETDWQERVVQIRRVSKVVKGGKKLSFRAIVVVGN-
RS5_TRIV2       -----RRKANRTKKE----------ETNWQERVIQIRRVSKVVKGGKKLSFRAIVVVGN-
RR5_CYAPA       ------QKMSKTRDK----------KPDWQERVVQIRRVSKVVKGGKKLSFRAIVVIGN-
RR5_GRATL       --------SIKDKEQ----------ENNWEEKVVQVKRVTKVVKGGKKLSFRAILIVGN-
RR5_PORPU       ------KKQGKSKEK----------DNGWEERVVQVKRVTKVVKGGKKLSFRVILVVGN-
RR5_PYRYE       ------KKQSKGKDK----------DSGWEERVVQVKRVTKVVKGGKKLSFRVILVIGN-
RS5_MYCGA       NNKKNSSRSSDERNK---RKNEKRTKSEFEEKIVKISRISKTTKGGRTMRFSALVVVGD-
RS5_MYCGE       ---KNKRFQKHNFNN----------KSEFEERIVKLKRISKTTKGGRNMRFSVLVVVGN-
RS5_MYCPN       SKKEGGGHNRNNQNR---RFQKPAFKSEFEERIVKLKRISKTTKGGRNMRFSVLVVVGN-
RS5_MYCPE       SKDGSGNKPNKIVKQ---S------VTGLEEKIVGVKKISKTTKGGRNMRFSALAVIGD-
RS5_LEGPH       -------------------------SDGYQEKLVSVTRTAKVVKGGRVFGFAVLVVVGD-
RS5_NEIMB       ----------EIEER----------GDGLIEKMVAVNRVTKVVKGGRIMAFSALTVVGD-
RS5_CHRVO       -----------MEDR----------GDGLVEKMISVNRVTKVVKGGRIMAFSALTVVGD-
RS5_NITEU       --TKSANTKTPDEVK----------TDGLKEKMVSVNRVTKVVKGGRILGFAALTVVGD-
RS5_DECAR       ---ERNKKPQQAEER----------DDGMREKMVAVNRVTKVVKGGRILGFAALTVVGD-
RS5_BORPE       ----VQGKHAAEKEN----------DDGLREKMIAVNRVSKVVKGGRTMSFAALSVVGD-
RS5_THIDA       -------APTSNEER----------GDGLREKMISVNRVTKVVKGGRIMGFAALTVVGD-
RS5_AROAE       ----QSKRPQAADER----------DDGLREKMVAINRVTKVVKGGRILGFAALTVVGD-
RS5_NITMU       -QGRMQGKVAPGDDR----------GDGLKEKMVAINRVTKVVKGGRILGFAALTVVGN-
RS5_BURP1       ------QAKVQADER----------DDGLREKMISVNRVTKVVKGGRILGFAALTVVGD-
RS5_BURL3       ------QAKVQADER----------DDGLREKMISVNRVTKVVKGGRILGFAALTVVGD-
RS5_CUPPJ       ------QAKVQQDER----------DDGLREKMISVNRVTKVVKGGRILGFAALTVVGD-
RS5_RALSO       -------PKVQGDER----------DDGLREKMIAVNRVTKVVKGGRILGFAALTVVGD-
RS5_HYDCU       ----------ELQEG----------QDGLVEKLVSVRRVAKVVKGGRVFGFSALTVVGD-
RS5_XANC5       -PRGRDRDRNREEKV----------DDGMIEKLVAVNRVSKTVKGGRQFTFTALTVVGD-
RS5_XYLFA       ----QRNRDRSREEK---I------DDGMIEKLVAVNRVSKTVKGGRQFTFTALTIVGN-
RS5_XYLFT       ----QRSRDRSREEK---------IDDGMIEKLVAVNRVSKTVKGGRQFTFTALTIVGN-
RS5_FRATT       ------------VKK----------NEELIEKLVSVKRHSKTVKGGRIMSFAALTVVGD-
RS5_COXBU       -------------------------TDGIQEKLVAVRRTAKVVKGGRVFGFSALVVAGD-
RS5_PSEAE       -----------EQKR----------DEGYIEKLVQVNRVAKTVKGGRIFAFTALTVVGD-
RS5_PSEPK       -----------DQKR----------DEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGD-
RS5_PSEF5       -----------DQKR----------DEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGD-
RS5_PSEPF       -----------DQKR----------DEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGD-
RS5_PSESM       -----------DQKR----------DEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGD-
RS5_PSE14       -----------DQKR----------DEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGD-
RS5_PSYA2       -------DKNDKNEQ----------TDGLVERLVTVDRVAKVVKGGRIFSFTALTVVGD-
RS5_ACIAD       -------------EQ----------NEGLVEKLVAVDRVAKVVKGGRIFSFTALTVVGD-
RS5_ACIBT       ------------ETK----------NEGLVEKLVAVDRVAKVVKGGRIFSFTALTVVGD-
RS5_BLOFL       ---------NKQTSN----------IHELQEKLITVNRVSKTVKGGRVFSFAALTVVGN-
RS5_WIGBR       ------------EKN----------INELQEKLISVNRVSKTVKGGRIFSFTALTVVGD-
RS5_BUCBP       -----------GRNV----------SGDLKEKLISVNRVSKTVKGGRIFSFSALTVVGD-
RS5_BLOPB       ------------DKQ----------PGELQEKLITVNRVSKTVKGGRVFSFTALTVVGD-
RS5_COLP3       ---------NQENSQ----------QSDMAEKLIAVNRVSKVVKGGRIFSFTALTVVGD-
RS5_PSEHT       ----------EAKQQ----------QPDLAEKLIAVNRVSKVVKGGRIFSFTALTVVGD-
RS5_BUCAI       -----------EKKN----------HNDLQEKLITVNRVSKTVKGGRIFSFTALTVVGN-
RS5_BUCAP       -----------EKKN----------NSELQEKLITVNRVSKTVKGGRIFSFTALTVVGN-
RS5_PHOLL       ------------EKQ----------AGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGD-
RS5_HAEDU       ------------EKQ----------AGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGD-
RS5_HAEI8       ------------EKQ----------VGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGD-
RS5_MANSM       ------------EKQ----------AGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGD-
RS5_PASMU       ------------EKQ----------AGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGD-
RS5_YERPS       ------------EKQ----------AGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGD-
RS5_PECAS       ------------EKQ----------AGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGD-
RS5_ECOLI       ------------EKQ----------AGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGD-
RS5_SHIDS       ------------EKQ----------AGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGD-
RS5_PHOPR       -------------------------QSDLNEKLIAVNRVSKTVKGGRIFSFTALTVVGD-
RS5_ALIF1       ------------QQQ----------ATDLNEKLIAVNRVSKTVKGGRIFSFTALTVVGD-
RS5_VIBPA       -----------QQVQ----------ANDLQEKLIAVNRVSKTVKGGRIMSFTALTVVGD-
RS5_VIBVY       -----------QQVQ----------ANDLQEKLIAVNRVSKTVKGGRIMSFTALTVVGD-
RS5_VIBCH       -----------QQVQ----------ANDLQEKLIAVNRVSKTVKGGRIMSFTALTVVGD-
RS5_IDILO       ------------EAQ----------TGELIEKLITVNRVAKVVKGGRIFSFTALTVVGD-
RS5_SHEON       ------------AQQ----------KDDLQEKLIAVNRVSKVVKGGRIFSFTALTVVGD-
RS5_METCA       ---------NIQAGA----------GEGLQEKLVAVRRVSKVVKGGRQFGFTALTVVGD-
RS5_NITOC       ------------RAT----------GDGLLEKLVGVRRVAKVVKGGRQFGFSALTVVGD-
RS5_RICBR       ------------RKN----------EEALSEVLVDVNRVTKVVKGGRRFAFSAYVVVGD-
RS5_RICPR       ------------KKN----------EEALSEVLVDVNRVTKVVKGGRRFAFSAYVVVGD-
RS5_RICTY       ------------KKN----------EEALSEVLVDVNRVTKVVKGGRRFAFSAYVVVGD-
RS5_RICCN       ------------KKN----------DETLSEVLVDVNRVTKVVKGGRSFAFSAYVVVGD-
RS5_RICFE       ------------KKN----------EETLSEVLVDVNRVTKVVKGGRRFAFSAYVVVGD-
RS5_WOLPM       -----------NLQN----------NNDLSELLVSVRRVTTVTKGGRRFSFSILVVVGD-
RS5_WOLTR       ----NFQ-------N----------NNDWSELLVSVRRVTTVTKGGRRFSFSILVVVGD-
RS5_EHRRW       -------KKSRNTHG----------SNDFSELIVSVRRVAKVVKGGRRFSFSVLVVIGD-
RS5_EHRCJ       ---------SRNVHG----------ANDFSELIVSVRRVAKVVKGGRRFSFSVLVVIGD-
RS5_EHRCR       ---------SRNVHG----------SNDFSELIVSVRRVAKVVKGGRRFSFSVLVVIGD-
RS5_ANAMM       ---------PRAAHD----------SHDLSELLVSVRRVSKVVKGGRRFSFSVLVVVGD-
RS5_ANAPZ       -------RKPRTSND----------AHDLSELLVSVRRVSKVVKGGRRFSFSVLVVVGD-
RS5_PELUB       ------------DKK----------DDGILEKLVHINRITKVVKGGRRFGFSALVVVGN-
RS5_ZYMMO       ----RGRRDDRRNEE---A------GEELIEKLVHINRVSKTVKGGKRFGFAALVVVGD-
RS5_GLUOX       ----EGGRGGREREQ----------GDDLVDKLVTINRVAKVVKGGRRFAFAALVVVGD-
RS5_RHORT       ------NRSPRSDER----------DEEFLDKLVHINRVAKVVKGGRRFAFAALVVVGD-
RS5_RHOS4       -ENRRDRRDDRSREE----------TPEFADRLVAINRVSKTVKGGKRFGFAALVVVGD-
RS5_RUEPO       ----NRRGNRRDREE---A------APEFADRLVAINRVSKTVKGGKRFGFAALVVVGD-
RS5_CAUVC       ----DRRDRNAPEER---------VDSDIVEKLVHINRVAATVKGGRRFSFAALMVVGD-
RS5_BRADU       ---GGGRERKEREER----------DSEFVDKLVHINRVAKVVKGGKRFGFAALVVIGD-
RS5_NITWN       --RGGRERSRDREER----------DSEFVDKLVHINRVAKVVKGGKRFGFAALVVIGD-
RS5_RHOPA       ----GGRERSREREE---R------DSEFVDKLVHINRVAKVVKGGKRFGFAALVVVGD-
RS5_RHILO       ----EGGRGREREER----------DDGMVDKLVHINRVAKVVKGGRRFGFAALVVVGD-
RS5_AGRFC       ---GSRDDRQNREER----------DSEFVDKLVAINRVAKVVKGGRRFGFAALVVVGD-
RS5_RHIME       ---GSREDRQNREER----------DSEFVDKLVAINRVAKVVKGGRRFGFAALVVVGD-
RS5_BRUSU       ---ERNREERGREER----------DSEFVDKLVHINRVAKVVKGGRRFGFAALVVVGD-
RS5_BARHE       -------ERSERDER----------ESEFVDRLVHINRVAKVVKGGRRFGFAALVVVGD-
RS5_BARQU       -------ERGERDER----------DGEFVDRLVHINRVAKVVKGGRRFGFAALVVVGD-
RS5_DEHM1       ------------DPS----------ELELNDKLIFINRVTKVVKGGKRMGFAALVVTGD-
RS5_DEHMC       ------------DPS----------ELELNDKLIFINRVTKVVKGGKRMGFAALVVTGD-
RS5_FUSNN       -------------------------DNQYQEKLLKISRVSKTTKGGRTISFSVLAAVGD-
RS5_PARUW       ----NESPKKEREKA----------ESDLTEKVLHINRCSKVVKGGRKFSFSALILVGD-
RS5_CHLTA       ------------SHK----------EDQLEEKVLVVNRCCKVVKGGRKFSFSALILVGD-
RS5_CHLPN       ------------SHK----------EDQLEEKVLVVNRCSKVVKGGRKFSFSALILVGD-
RS5_CHLAB       ------------SHK----------EDQLEEKVLVVNRCSKVVKGGRKFSFSALILVGD-
RS5_CHLCV       ------------SHK----------EDQLEEKVLVVNRCSKVVKGGRKFSFSALILVGD-
RS5_RHOBA       ----RNKRNNKNEEQ--------GLEAGLLDRVVKIKRCAAVVKGGRRFSFAAMVVVGN-
RS5_THEMA       --------GVMKEIQ----------YEEFEEKIIEIRRTSKVTKGGKNLSFRVVAIVGN-
RS5_UREPA       ENTEPKAKTFKRETT----------TSNFEERVVKIKRISKTTKGGRMMRFSALVVIGD-
RS5_ONYPE       --------KKEFNKK----------APLLEEKVVKINRITKVVKGGARFRFSALVVVGD-
RS5_PORGI       -------YNRVKSTN----------DLELKDRLVAINRVTKVTKGGRTFTFAAIVVVGN-
RS5_BACFN       -------NNRVKITN----------DIELKDRLVAINRVTKVTKGGRTFSFSAIVVVGN-
RS5_BACTN       -------NNRVKVTN----------DIELKDRLVAINRVTKVTKGGRTFSFSAIVVVGN-
RS5_DEIRA       ----------NDRTE----------SSEFEEKMLFVNRTSKTYQGGRRFRFAALVILGD-
RS5_THET8       -------------MP----------ETDFEEKMILIRRTARMQAGGRRFRFGALVVVGD-
RS5_TROW8       RGRHRDSRQKGDSSS----------RGQFLERVVRINRVAKVVKGGRKFSFSALVVVGD-
RS5_TROWT       -----SARGRHRDSR---QKGDSSSRGQFLERVVRINRVAKVVKGGRKFSFSALVVVGD-
RS5_BIFLO       ----GERRNRREENH----------GDELLDRVVTINRVSKTHKGGRTFSFAALVVVGD-
RS5_LEIXX       ----PNRDRGNRDAD----------KSQFLERVVTINRVSKVVKGGRRFSFTALVVVGD-
RS5_CORJK       ---GGRNDRRNQQDE----------RSQFIERVVTINRVSKVVKGGRRFSFTALVIVGD-
RS5_CORDI       ----NDRRGGRRDDR---RNQQQDERSQYIERVVTINRVSKVVKGGRRFSFTALVIVGD-
RS5_COREF       -----DDRRNQQQDE----------RSQYIERVVTINRVSKVVKGGRRFSFTALVIVGD-
RS5_CORGL       -DRNERRGGGRRDDR---RNQQQDERSQYIERVVTINRVSKVVKGGRRFSFTALVIVGD-
RS5_NOCFA       ----RGGGDRRDNAA----------EKNQLERVVAINRVSKVVKGGRRFSFTALVIVGD-
RS5_MYCLE       EGGSRGGRDRDRDGE----------KGNYLERVVAINRVSKVVKGGRRFSFTALVIVGD-
RS5_MYCTU       ---DSGRGSRERDGE----------KSNYLERVVAINRVSKVVKGGRRFSFTALVIVGD-
RS5_MYCPA       RRGDGGRGGRDRDGD----------KSNYLERVVAINRVSKVVKGGRRFSFTALVIVGD-
RS5_CUTAK       -GRDNRRGQNDRNRN----------QNEYLERVVAINRVAKVVQGGRRFSFTALVVVGD-
RS5_THEFY       --SGRDDRRGGSADK----------GVSYIERVVKINRVAKVVKGGRRFSFTALVVVGD-
RS5_STRAW       --DRKGRDGGAAAAE----------KTAYVERVVAINRVAKVVKGGRRFSFTALVVVGD-
RS5_STRCO       ----KGRDGGAGAAE----------KTAYVERVVAINRVAKVVKGGRRFSFTALVVVGD-
RS5_SOLUE       ------------DPA----------SLNLKEQVVAINRVTKVVKGGKNLSFSALVVIGDP
RS5_AQUAE       ----DRLIEERRKQQ---NIEEILPELQLEERLIYANRTARVTKGGRRFSFSTLVVVGD-
RS5_PELLD       --------AKGIRPG----------ELNLKEKLVHINRTAKVVKGGKRFGFNAIVVVGD-
RS5_CHLCH       -------SAKSIRPG----------ELNLKEKLVHINRTAKVVKGGKRFGFNAIVVVGD-
RS5_CHLTE       -------SGRNIKPG----------ELNLKEKLVHINRTAKVVKGGKRFGFNAIVVVGD-
RS5_MESFL       ----NRRPQGPKQFQ----------KDDFEEKVVTIRRVTKVTKGGRHFRFAAVVVVGD-
RS5_MYCCT       -----SRPSSRQKVV----------KDEFEEKVVTIRRVTKVTKGGRHFRFAAVVVVGN-
RS5_MYCMS       -----TRPQSKSKQV----------KDEFEEKVVTIRRVTKVTKGGRHFRFAAVVVVGN-
RS5_BDEBA       ------------QAQ----------AAELEERVVAINRVTKVVKGGRRFSFAALVVVGN-
RS5_DESPS       -------KRSKANNN----------TEELIEKIVFINRVAKVVKGGRRFSFSAIVVVGD-
RS5_CAMJR       --------------N----------REEFEEVIVDIGRVTKVVKGGRRFRFTALVIVGN-
RS5_SULDN       -------------------------REDFEESIVNIGRVTKVVKGGRRFRFTALVVVGN-
RS5_HELPJ       --------------N----------REEFQEVVVNIGRVTKVVKGGRRFRFNALVVVGN-
RS5_HELHP       -------------------------REEFSEVVVNIGRVTKVVKGGRRFRFNALVVVGN-
RS5_WOLSU       ------------MEI---N------RDEFKEVVVNIGRVTKVVKGGRRFRFNALVVVGN-
RS5_DESAG       -------------------------EFGLIEKIVDLNRVAKVVKGGRRFSFSALVVVGD-
RS5_DESVH       ------------MEQ---N------EFGLIEKIVYLNRVAKVVKGGRRFSFSALVVVGD-
RS5_PELCD       ------------DPN----------ELELTDRVVHINRCAKVVKGGRRFSFSALVVVGD-
RS5_GEOMG       ------------NPN----------ELNLTDKVVHISRVAKVVKGGRRFSFSALVVVGD-
RS5_GEOSL       ------------NPN----------DLNLTDKVVHISRVAKVVKGGRRFSFSALVVVGD-
RS5_SYMTH       ------------ENV----------QGELKEKMVDLRRVAKTVKGGRRMSFSAVVVVGD-
RS5_CALS4       ------------DWT----------KLNLKERVVSINRVSKVVKGGKNFRFSVTVVVGDP
RS5_LACAC       ------NDSRNNRRN----------KDDIEDQLVAVNRITKVVKGGRRMRFAALVVVGD-
RS5_LACJO       ---NDSRRDSRKDRK----------KDDIEDQLVAINRITKVVKGGRRMRFAAVVIVGD-
RS5_CARHZ       ------------DAS----------QLELSEKVIAINRTAKVVKGGRRFSFSALVVVGD-
RS5_CLOAB       ------------DPS----------TLDLKEKVVFINRVAKVVKGGRNFRFTALVVVGD-
RS5_CLOPE       ------------IDP---S------TLDLKEKVVSISRVTKVVKGGRNFRFSALVVVGD-
RS5_LACSS       ------------DPT----------HLDLEDRVVSINRVTKVVKGGRRLRFAAIVIVGD-
RS5_LACPL       ------------DPS----------KLDLDDNVVAINRITKVVKGGRRLRFAALVIVGD-
RS5_STAS1       -------------EE----------AKEFEERVVTINRVAKVVKGGRRFRFTALVVVGD-
RS5_STAAW       ------------EEE----------TKEFEERVVTINRVAKVVKGGRRFRFTALVVVGD-
RS5_STAEQ       ------------EEE----------TKEFEERVVTINRVAKVVKGGRRFRFTALVVVGD-
RS5_STAHJ       ------------EEE----------TKEFEERVVTINRVAKVVKGGRRFRFTALVVVGD-
RS5_LISMF       ------------DGN----------KLDLEERVVTINRVAKVVKGGRRFRFTALVVVGD-
RS5_LISIN       ------------DGN----------KLDLEERVVTINRVAKVVKGGRRFRFTALVVVGD-
RS5_OCEIH       ------------DPN----------KLDLEERVVTVNRVAKVVKGGRRFRFAALVVVGD-
RS5_GEOKA       ------------DPN----------KLELEERVVAVNRVAKVVKGGRRLRFSALVVVGD-
RS5_BACSK       ------------DPN----------TLELEEKVVTINRVAKVVKGGRRFRFAALVVVGD-
RS5_BACHD       ------------DPN----------TLELEEKVVAINRVAKVVKGGRRFRFAALVVVGD-
RS5_BACHK       ------------DPS----------KLELEERVVTINRVAKVVKGGRRFRFAALVVVGD-
RS5_BACLD       ------------DPS----------KLELEERLVTVNRVAKVVKGGRRFRFAALVVVGD-
RS5_BACSU       ------------PS-----------KLELEERLVTVNRVAKVVKGGRRFRFAALVVVGD-
RS5_ENTFA       ------------DPK----------HLELEDRVVAINRVTKVVKGGRRLRFAALVVVGD-
RS5_LACLA       ---------RRNDRE----------QSEFEERVVSINRVTKVVKGGRRLRFAALVVVGD-
RS5_STRR6       -------------------------AVELEERVVAVNRVTKVVKGGRRLRFAALVVVGD-
RS5_STRT1       -------------------------AVELEERVVAINRVTKVVKGGRNMRFAALVVVGD-
RS5_STRP3       -------------------------AVELEERVVAINRVTKVVKGGRRLRFAALVVVGD-
RS5_STRA5       -------------------------AVELEERVVAINRVTKVVKGGRRLRFAALVVVGD-
RS5_STRMU       -------------------------AVELEERVVAINRVTKVVKGGRRLRFAALVVVGD-
                                              : ::   .      **  : *      *: 

RS5_NEOSM       KKGCVGYATAKHDEVLDARSKAVRKAKGAMIRFPLREGRTIHHDCFSKLGASKLFIKPAP
RS5_MYCHJ       KKGRVGFGHGKANEVQDAVKKAIKDAQNRLVSVPIYRKSTVPHEIAVKYLASKILIKPAP
RS5_MYCH7       KKGRVGFGHGKANEVQDAVKKAIKDAQNRLVSVPIYRKSTVPHEIAVKYLASKILIKPAP
RS5_MYCMO       KKGRVGYGHGKALEVPDAIKKAVKDAQNNLIRVPIINKSTVPHEQWAKFLASKVMLKPAP
RS5_MYCPU       KKGKVGYGHGKANEVPDAIKKAIKDAQNHLITVPIINESTVPHEMSGKFLSSKVIIKSAP
RS5_LEPIN       QRGKVGIGFGKANEVPDAIRKSIESAKKHLVKINF-KGHTIPHEVIGKFKSARVILKPST
RS5_LEPIC       QRGKVGIGFGKANEVPDAIRKSIESAKKHLVKINF-KGHTIPHEVIGKFKSARVILKPST
RS5_BORBU       GEGHVGWGFGKANDASDAIKKSLTSARKNLRFVPIRKG-TLPHEVIGCFKKAKVLIKPAT
RS5_BORBP       GEGYVGWGFGKANDASDAIKKSLTSARKNLRFVPIRKG-TLPHEVIGCFKKAKVLIKPAT
RS5_TREDE       QKGRVGYGFGKANDVSDAIRKSIEKAKANMVTFPLKNG-TIPHEVQGKFKGSSVLLRPAC
RS5_TREPA       QKGRVGFGFGKAGDVSEAIRKSVERAKRSMVLFPLKDG-TIPHEVQAKFKGSLVLLRPAC
RR5_THAPS       ENGKVGVGVGKAEDVVNAFKKAKTDGRKNLIDVPITKSLSIPHAVIGDLGACKIIMRPSI
RR5_TRICV       ENGQVGVGVGKADDVVNAFKKAKADGRKNLIKIPITKSLSIPHNVIGIFGACKIIMRPSI
RR5_PHATC       ENGKVGVGVAKADDVVNAFKKAKTDGRKNLIELPITKALSIPHNVAGNFGACKVIMRPSI
RR5_CYACA       NQGSVGVGVGKASDVIGAVKKGVSDCKKQIIEFPLTSSSTISHAVEGRFGAASVILKPSV
RR5_CYAM1       LNGCVGVGMGKAADVMSAVTKAVVDAKKQLINITLTPTNSIVHASQGRFSAAVVFLKPAA
RS5_GLOVI       GNGRVGVGVGKANDVIGAVKKGVSDARKALIRVPLNKINSIPHPMSGSSGAANVFLKPAS
RR5_GUITH       ERGQVGVGVGKASDVIGAVKKAVTDGRKNLINIPLTNQNSIPHIVQGYSGAAKVIIKPSA
RS5_PROM9       EKGQVGVGVGKAGDVIGAVRKGVSDGKKNLVRVPLTPNNSIPTLSKGRDGAANVLIRPAA
RS5_PROMP       EKGQVGVGVGKAGDVIGAVRKGVSDGKKHLVRVPLTPNNSIPTLSKGRDGAANVLIRPAA
RS5_PROMA       EKGQVGVGVGKAGDVIGAVRKGVADGKKNLVRVPLTPNSSIPTLSNGRDGAASVLIRPAA
RS5_PROMT       EKGQVGVGVGKAGDVIGAVRKGVADGKKHLVRVPLTRNSSIPTLSNGRDGAASVLIRPAA
RS5_PROMM       ERGQVGVGVGKAGDVIGAVRKGVADGKKHLVKVPLTRHNSIPTLSNGRDGAANVLIRPAA
RS5_SYNPX       EKGQVGVGVGKAGDVIGAVRKGVADGKKHLVKVPLTRHNSIPTLSNGRDGAASVLIRPAA
RS5_SYNP6       ERGQVGVGVGKASDVIGAVRKGVADGKKHLVNVPLTRDQSIPHPSTGEGGAAQVLIRPAA
RS5_SYNY3       ETGQVGVGVGKAGDVIGAVRKGVADGKKQLIEVPLTKSNSITHITNGVSGGAKVVVRPAA
RS5_THEEB       ERGQVGVGVGKAADVIGAVRKGVADGKKHLIDVPITKSNSIPHPTFGEGGAARVMIRPAA
RS5_TRIV2       ERGQVGVGVGKASDVIGAVKKGVADGKKHLIDIPITKSNSIPHPIDGVGGGAKVMMRPAA
RR5_CYAPA       ERGQVGVGIGKASDVINAVKKAAADGKKHVVEVPLTRSNSIPHPIDGIGGAARVIMRPSA
RR5_GRATL       EKGEIGVGIGKASDVIGAVKKGVTDAKKHIINVPLTKSYSIPHPIEGISGAAKVILRPSA
RR5_PORPU       EQGQVGVGVGKASDVIGAVKKGVTDAKKHLVTVPLTKSNSIPHPINGISGAAQVILRPSA
RR5_PYRYE       EQGQVGVGVGKASDVIGAVKKGVTDAKKHLVTVPLTKSNSIPHPINGISGAAKVILRPSA
RS5_MYCGA       RKGRVGFGIAKALEVPNAIKKALKMAENNVQKIAMNKHGTLFHDVLGRSGAAKVLIKPAP
RS5_MYCGE       KKGKVGYGIAKALEVPLAIKKAIKKAHNSIHTVEIHKG-SIYHEVIGRKGASKVLLKPAP
RS5_MYCPN       RKGKIGYGIAKALEVPNAIKKAIKAAHNSLHTIEIHKG-SIYHEVIGRSGASRVLLKPAP
RS5_MYCPE       RKGNVGFGLGKSIEVPVAIRKALKSAKNNMYKVKMNKNFTLYHEVIGKHGAGKVLIKPAP
RS5_LEGPH       GKGKVGFGRGKAREVPIAIQKAMDQAKKNMVYIPL-SGTTIFHEITWNYGASKVFMKPAS
RS5_NEIMB       GDGRIGMGKGKSKEVPVAVQKAMDQARRSMIKVPLKNG-TIHHEVIGRHGATKVFMQPAK
RS5_CHRVO       GDGGIGMGKGRSKEVPVAVQKAMEQARHNMMKIKLYNG-TVKHTVEGRHGATRVLIQPAK
RS5_NITEU       GKGSVGMGKGKSREVPLAVQKAMDEARQRMVRVNLING-TLHHSVIGRHGAARVYMQPAS
RS5_DECAR       GDGSIGMGKGKSREVPVAVQKAMEEARRKMAKVSLKSG-TVHHTVMGRHGATTVMIQPAP
RS5_BORPE       GDGRIGMGKGKAREVPVSVQKAMEQARRGMFKVALKNG-TLHHTVVGKHGASTVLISPAA
RS5_THIDA       GDGGIGMGKGKSREVPVAVQKAMEEARRKLVKISLKNG-TFHHTVVGQHGASRVLIQPAS
RS5_AROAE       GDGGVGMGKGKSREVPVAVQKAMDEARRKLKKISLKNG-TLQHAIVGKHGAASVLMQPAP
RS5_NITMU       GDGGVGMGKGKSREVPVAVQKAMDEARRKMIKVSLKNG-TLQHPVIGRHGAAKVYMQPAS
RS5_BURP1       GDGRVGMGKGKAKEVPVAVQKAMEQARRNMFKVPLKNG-TLQHEVHGKHGASTVLLAPAK
RS5_BURL3       GDGRIGMGKGKAKEVPVAVQKAMEQARRNMFKVPLKNG-TLQHEVHGKHGASAVLLAPAK
RS5_CUPPJ       GDGRIGMGKGKAKEVPVAVQKAMDEARRKMVKVSLKNG-TLQHEVVGKHGAAKVLMMPAK
RS5_RALSO       GDGRIGMGKGKAKEVPVAVQKAMDEARRKMVKVPLKNG-TLQHEVIGKHGAAKVLMAPAK
RS5_HYDCU       GEGRVGYGSGKANEVPVAIKKAMEKARRNMKDVHL-DGGTLQYPINFKQGAANIVMLPAS
RS5_XANC5       GLGKVGFGYGKAREVPVAIQKSMEQARKNLATVDLNNG-TLWHAVKSGHGAARVYMQPAS
RS5_XYLFA       GEGSVGFGYGKAREVPVAIQKSMEYARKTMANVSLNNG-TLWHPVKANHGAACVFMKPAS
RS5_XYLFT       GEGSVGFGYGKAREVPVAIQKSMEYARKRMSNVSLNNG-TLWHPVKANHGAASVFMKPAS
RS5_FRATT       GKGRIGVGRGKSREVPAAIQKAMENAKKNMVSVNLNND-TLWYPVMSNHGASKVFMQPAS
RS5_COXBU       GDGKVGFGLGKAREVPSAIQKATENARRNMISVPL-YGATLHHAIKATHASSTVLMLPAS
RS5_PSEAE       GKGRVGFGRGKAREVPAAIQKAMEAARRNMIQVDL-NGTTLQYPTKSAHGASKVYMQPAS
RS5_PSEPK       GKGRVGFGRGKSREVPAAIQKAMEAARRNMIQVDL-KGTTLQYATKAAHGASKVYMQPAS
RS5_PSEF5       GKGRVGFGRGKSREVPAAIQKAMEAARRNMIQVDL-NGTTLQYAMKSAHGASKVYMQPAS
RS5_PSEPF       GKGRVGFGRGKSREVPAAIQKAMEAARRNMIQVDL-NGTTLQYAMKSAHGASKVYMQPAS
RS5_PSESM       GKGRVGFGRGKSREVPAAIQKAMEAARRNMIQVDL-NGTTLQYAMKSAHGASKVYMQPAS
RS5_PSE14       GKGRVGFGRGKSREVPAAIQKAMEAARRNMIQVDLNCT-TLQYAMKSAHGASKVYMQPAS
RS5_PSYA2       GNGRVGFGRGKAREVPAAIQKALEAAKRNMITVELNDA-TLYHPIKARHGASKVYMQPAS
RS5_ACIAD       GNGRVGFGRGKAREVPAAISKALEAARRNMITVDL-AGTTLQHPVNARHGASRVYMQPAS
RS5_ACIBT       GNGRVGFGRGKAREVPAAISKALEAARRNMITVDL-AGTTLQHPVNARHGASRVYMQPAS
RS5_BLOFL       VNGRVGFGYGKAREVPSAIQKAMEKARHNMIDIPLNPGRTLQHSIIGIYTGARIYMKPAS
RS5_WIGBR       CQGKIGFGYGKSKEVPLAIQKAMDKARKNMIIIPIVCK-TLQHEINGYHTGSRVFMKPAS
RS5_BUCBP       GHGKVGFGYGKAREVPSAIQKAMEKARRNMIQVPLNNG-TLQYSVTGSYTGSYIFMKPAS
RS5_BLOPB       ANGRVGFGYGKAREVPSAIQKSMEKARRNMVIISLYKG-TLQHAVKGVYTGSRIYMQPAS
RS5_COLP3       GNGRVGFGYGKAREVPAAIQKAMEKAHRNIVTIDL-KGTTLQHVITGKHSGSKVFMKPAS
RS5_PSEHT       GAGKVGFGYGKAREVPAAIQKAMEKARRNMINVDL-NGNTLQHPVKGRHAGSQVFMKPAS
RS5_BUCAI       GDGKVGFGYGKAREVPAAIQKAMEQARRNMITIPLVNK-TLQHSLKGSHTGSNVFMKPAS
RS5_BUCAP       GEGRVGFGYGKAREVPAAIQKAMEKARRNMVTIPLVNK-TLQHSLKGSHTGSNIFMKPAS
RS5_PHOLL       GNGRVGFGYGKAREVPAAIQKAMEKARRNMKTVALNSG-TLYHPVKGAHTGSRVFMQPAH
RS5_HAEDU       GNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNEG-TLQHPVKGSHTGSRVFMQPAS
RS5_HAEI8       GNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNEG-TLQHPVKGVHTGSRVFMQPAS
RS5_MANSM       GNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALHEG-TLQHPVKGIHTGSRVFMQPAS
RS5_PASMU       GNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNEG-TLQHPIKGAHTGSRVFMQPAS
RS5_YERPS       GNGRVGFGYGKAREVPAAIQKAMEKARRAMINVALNNG-TLQHPVKGAHTGSRVFMQPAS
RS5_PECAS       GNGRVGFGYGKAREVPAAIQKAMEKARRNMMNVALNNG-TLQHPVKGAHTGSRVFMQPAS
RS5_ECOLI       GNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNG-TLQHPVKGVHTGSRVFMQPAS
RS5_SHIDS       GNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNG-TLQHPVKGAHTGSRVFMQPAS
RS5_PHOPR       GNGRIGFGYGKAREVPAAIQKSMEKARRNMVTVALNEG-TLHHAVKGRHTGSKVYMQPAS
RS5_ALIF1       GNGRVGFGYGKAREVPAAIQKSMEKARRNMFTIALNEG-TLHHAVKGRHTGSKVYMQPAA
RS5_VIBPA       GNGRVGFGYGKAREVPAAIQKAMEKARRNMTTIALNEG-TLHHPVKGRHSGSKVYMQPAA
RS5_VIBVY       GNGRVGFGYGKAREVPAAIQKAMEKARRNMVTIALNEG-TLHHPVKGRHSGSKVYMQPAA
RS5_VIBCH       GNGRVGFGYGKAREVPAAIQKAMEKARRSMVTIALNEG-TLHHPVKGRHSGSKVYMQPAA
RS5_IDILO       GKGKVGFGYGKAREVPAAIQKAMEKARRNMVTVQL-KGDTLQHPVKGRHSGSQVYMQPAS
RS5_SHEON       GNGKVGYGYGKAREVPAAIQKAMEKARRNMVTVELNAG-TLHHPVKGRHTGSRVYMQPAS
RS5_METCA       GNGRVGFGLSKAREVPVAIQKSMEQARKNMRKVAL-NGQTLHHPVTAAAGAAKVHMQPAS
RS5_NITOC       GKGRVGFGRGKAREVPVAIQKAMENARKNMISVPL-EGDTLQHPITARHGAAKVHMQPAS
RS5_RICBR       KAGRVGAGHGKAKEVNEAREKAKQAAKKKMMKVSLYQNRTIHHDVIGRSGAAKVVLRRAK
RS5_RICPR       KAGRVGAGHGKAKEVNEARGKAKQAAKKRMMKVPLYQNRTIHHDVVGKSGAAKVILRRAK
RS5_RICTY       KAGRVGAGHGKAKEVNEARGKAKQAAKKRMMKVPLYQNRTIHHDVVGKSGAAKVILRRAK
RS5_RICCN       KAGRVGAGHGKAKEVNEARGKAKQAAKKRMMKVPLYQNRTIHHDVVGKSGAAKVILRRAK
RS5_RICFE       KAGRVGAGHGKAKEVNEARGKAKQAAKKRMMKVPLYQNRTIHHDVVGKSGAAKVILRRAK
RS5_WOLPM       EKGRVGCGIGKHAEVAEARVKAVNAAKKSMIRVYLREGRTLHHDIKAKFCSGEIVLRTAR
RS5_WOLTR       EKGRVGCGMGKHAEVAEARIKAVNAAKKSMIRVYLREGRTLHHDIKAKFCSGEIVLRAAR
RS5_EHRRW       EKGKVGCGIGKHLEVSEAKVKAVNAARKNMIRVHLRESRTLHHDIQAKFCSSKVMLRSAK
RS5_EHRCJ       EKGKVGCGIGKHLEVSEAKVKAVNAAKKNMIRVHLRESRTLHHDVKAKFCASKVMLRSAK
RS5_EHRCR       EKGKVGCGIGKHLEVSEAKIKAVNAARKNMIRVHLRESRTLHHDVKAKFCSSKVMLRSAK
RS5_ANAMM       EKGRVGCGMGKHAEVSEAKIKAVNAAKKSMIRVYLRESRTLHHDVEAKFCASRVVLRSAR
RS5_ANAPZ       EKGRVGCGMGKHAEVAEAKIKAVNAAKKNMIRVYLRESRTLHHDVTAKFCASRVILRSAK
RS5_PELUB       QAGKIGVAHAKAKQVPDAIKKANETARRVLIHVPLREGRTIHHDVYGKDGAGKIILRSAP
RS5_ZYMMO       GKGRVGFGHGKAREVPEAISKATAAAKKTMIRVPLREGRTLHHDGRGRFGAGLVYLRSAP
RS5_GLUOX       QKGRVGYGAGKAREVPEAIRKATERAKRTMIRVPMKEGRTLHHDTFGHYGAGKVVVRAAE
RS5_RHORT       GKGRVGFGTGKAREVPEAIRKATDQAKRTMIKVPLREGRTLHHDTNGHFGAGWVTLRSAP
RS5_RHOS4       QRGRVGFGKGKAKEVPEAIRKATEQAKRQMIRVALRDGRTLHHDQEGRHGAGKVVMRAAV
RS5_RUEPO       QKGRVGFGKGKAKEVPEAIRKATEQAKRQMIRVQLREGRTLHHDIEGRHGAGKVVMRAAP
RS5_CAUVC       QKGRVGFGHGKAREVPEAIRKATEEAKKTMIRVPLRESRTLHHDGAGRWGAGKVMMRAAP
RS5_BRADU       QKGRAGFGHGKAREVPEAIRKATESAKRNLTRVSLREGRTLHHDIAGRHGAGRVYLRAAP
RS5_NITWN       QKGRVGFGHGKAREVPEAIRKATESAKRNLTRVPLREGRTLHHDIAGRHGAGRVYLRAAP
RS5_RHOPA       QKGRVGFGHGKAREVPEAIRKATESAKRNLTRVALREGRTLHHDIAGRHGAGRVYLRAAP
RS5_RHILO       QKGRVGFGHGKAREVPEAIRKATESAKRDMIFVPLRSGRTLHHDVEGRWGAGRVLLRAAK
RS5_AGRFC       QKGRVGFGHGKAREVPEAIRKATESAKRDLIFVPLRDGRTLHHDVNGRHGAGKVLLRSAK
RS5_RHIME       QKGRVGFGHGKAREVPEAIRKATEAAKRDLIFVPLRGGRTLHHDVHGRHGAGKVLLRSAK
RS5_BRUSU       QKGRVGFGHGKAREVPEAIRKATEAAKRDMIFVPLRSGRTLHHDVEGRHGAGKVLLRAAP
RS5_BARHE       QKGRVGFGHGKAREVPEAVRKATESAKRGMIYVPLRSGRTLHHDLEGHHGAGRVLLRSAS
RS5_BARQU       QKGRVGFGHGKAREVPEAVRKATEAAKRGMIYVPLRSGRTLHHDLEGRHGAGRVLLRSAS
RS5_DEHM1       GKNHVGIGVGKAKEVPSAISKASANAKRNLSRILL-NGTTVPHEIVFKYGAAQVLLKPAA
RS5_DEHMC       GKNHVGIGVGKAKEVPSAISKASANAKRNLSRILL-NGTTVPHEIVFKYGAAQVLLKPAA
RS5_FUSNN       GEGKIGLGLGKANGVPDAIRKAIAAAKKNIVKISLKNN-TIPHEIAGKWGATTLWMAPAY
RS5_PARUW       GKGRIGYGFAKANELTDAIRKGGEAARKNMISCPT-EGTTIPHEVTVQWDGASVLLKPAP
RS5_CHLTA       RKGRLGFGFAKANELTDAIRKGGDAARKNLVSINSLEGGSIPHEVLVNHDGAELLLKPAK
RS5_CHLPN       GKGRLGYGFAKANELTDAIRKGGEAAKKNLMKIEALEDGSIPHEVLVHHDGAQLLLKPAK
RS5_CHLAB       GKGRLGYGFAKANELTDAIRKGGEAARKNLITIESLEGDSIPHEVLVDQDGAQLLLKPAK
RS5_CHLCV       GKGRLGYGFAKANELTDAIRKGGEAARKNLITIESLESGSIPHEVLVDQDGAQLLLKPAK
RS5_RHOBA       GSGQVGWGYGKANEVPPSVQKAQKQASRSMIHVPLVEG-SIPHQVWGRYGAARVVLIPAG
RS5_THEMA       KNGKVGLGIGKAREVPEAIRKAISAAKRNIVEVPVING-TIPHEVIGRQDASKVLLKPAA
RS5_UREPA       KNGTVGFGMGKSIEVPDAIKKAIKNANNNLIKVKQTKKGSIYHDVNGRHGAAKVMLLPAP
RS5_ONYPE       KKGQIGFATAKAKEIVEAIKKALEKAKKQLVRIPI-TGTTIPHDTIGRFGASKFFLKPAS
RS5_PORGI       EDGVIGWGLGKAGEVPAAIAKGVEAAKKNLIRVPVHNG-TIPHEQAASYGGASVFLKPAT
RS5_BACFN       EEGIIGWGLGKAGEVTAAIAKGVESAKKNLTRVPVLKG-TVPHEQSAKFGGAEVFIKPAS
RS5_BACTN       EEGIIGWGLGKAGEVTAAIAKGVESAKKNLVKVPVLKG-TVPHEQSAKFGGAEVFIKPAS
RS5_DEIRA       RNGRVGMGIGKAKEVPVAIEKAKAVARKNMITVPVENG-TIPHEIVGENSTSRVLLKPAG
RS5_THET8       RQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNG-TIPHEIEVEFGASKIVLKPAA
RS5_TROW8       GDGTVGVGYGKAREVPLAISKGIESARKNFFTVPRVAS-TIPHPVQGEAASGVVLLRPAA
RS5_TROWT       GDGTVGVGYGKAREVPLAISKGIESARKNFFTVPRVAS-TIPHPVQGEAASGVVLLRPAA
RS5_BIFLO       GNGTVGVGYGKSREVPAAIAKGQLDAKKHMFSVPRVRG-TITHPVQGHDAAGTVLLRPAA
RS5_LEIXX       GNGLVGVGYGKAREVPLAISKGVEEAKKNFFRVPRVAN-TIPHPVQGEAAAGVVLLRPAA
RS5_CORJK       GQGMVGVGYGKAKEVPAAIQKGAEEARKNFFRVPMING-TITHPVQGEDAAGIVMMKPAA
RS5_CORDI       GKGMVGVGYGKAKEVPAAIQKGAEEARKNFFRVPMVAG-TITHPVQGEAAAGIVMMRPAA
RS5_COREF       GQGMVGVGYGKAKEVPAAIQKGAEEARKNFFRVPMVGG-TITHPVQGEAAAGIVMLKPAA
RS5_CORGL       GKGMVGVGYGKAKEVPAAIQKGAEEARKNFFRVPMVNG-TITHPVQGEKAAGIVMLKPAA
RS5_NOCFA       GNGLVGVGYGKAKEVPAAIQKGVEEARKGFFRVPM-IGSTITHPVQGEAAAGVVMLRPAS
RS5_MYCLE       GHGMVGVGYGKAKEVPAAIAKGVEEARKSFFRVPLIDG-TITHPVQGEAAAGVVLLRPAS
RS5_MYCTU       GNGMVGVGYGKAKEVPAAIAKGVEEARKSFFRVPLIGG-TITHPVQGEAAAGVVLLRPAS
RS5_MYCPA       GNGMVGVGYGKAKEVPAAIAKGVEEARKGFFRVPLIRG-TITHPVQGEAAAGVVLLRPAS
RS5_CUTAK       GEGSVGVGYGKAKEVPAAIAKAVEEAKKHFFKVPL-VGRTITHPVIGEKAAGVVMLRPAS
RS5_THEFY       GNGMVGVGYGKAKEVPAAIAKGVEEAKKNFFRVPRIGG-TIVHQVQGEDAAGVVLLRPAA
RS5_STRAW       GDGTVGVGYGKAKEVPAAIAKGVEEAKKHFFKVPRIQG-TIPHPITGEKAAGVVLLKPAS
RS5_STRCO       GDGTVGVGYGKAKEVPAAIAKGVEEAKKHFFKVPRIQG-TIPHPIQGEKAAGVVLLKPAS
RS5_SOLUE       SAKVVGYGVGKAKEVPSAIRKGIEAAKKNLRRINSLDT-TIPHQVLGVFASSQVLLKPAS
RS5_AQUAE       RKGHVGFGHGKAKEVTLAIAKGIEKAKKNVIRVPIVDG-TVPHDVIGTFGATKIIVLPAR
RS5_PELLD       KEGHVGYGLGKANEVQDAIAKGVEDGKKNVVKVPIIKG-TIPHQIVAKYGSAKVLMKPAT
RS5_CHLCH       KEGHVGYGLGKANEVQDAIAKGIEDGKKNVIKVPIVKG-TIPHQIVVKYGSAKVMMKPAT
RS5_CHLTE       KEGHVGYGLGKANEVQDAIAKGVEDGKKNVIKVPIVKG-TIPHPIVAKYGSAKVLMKPAT
RS5_MESFL       KKGQVGLGTGKANEVPEAIKKAVKEAKKNLIRVPL-RGTTVPHEVIGHFGAGQVLIKPAK
RS5_MYCCT       KKGLVGMGTGKANEVPEAIKKAIKEAKKNLVSVTLRNT-TVPHEVLGTFGAGKILIKPAK
RS5_MYCMS       KKGLVGMGTGKANEVPEAIKKAIKEAKKNLVSVTLRNT-TVPHEVLGTFGAGKILIKPAK
RS5_BDEBA       KAGDVGFGSGKAGEVPEAIGKASRSAKKSAKSVALKEGRTIPHEVIGKFGAAKVIMKPAA
RS5_DESPS       GNGKVGYGLGKANQVPEAIRKGVERARKDMALVSLTDV-SIPHQVIGHYGAGRVFLRPAS
RS5_CAMJR       RKGLVGVGYGKAKEVPDAIRKAVDDAFKNIVEVKT-KGSTIAHDVEVKYNASRILLKPAS
RS5_SULDN       KKGTIGFGAGKAKEVPDAIKKAVDNAFKNLSKVSI-KGTTIAHDIEHKYNASRILLKPAS
RS5_HELPJ       KNGLVGFGLGKAKEVPDAIKKAVDDAFKNLIHVTI-KGTTIAHDIEHKYNASRILLKPAS
RS5_HELHP       KNGLVGFGLGKAKEVPDAIKKAIDDAFKNIIKVNI-KGTTIAHDIEHKYNASRILLKPAS
RS5_WOLSU       KNGLVGFGLGKAKEVPDAIKKAVDDAFKNIIKVNV-KGTTIAHDIEHKYNASKILLKPAS
RS5_DESAG       GNGSVGFGMGKAQEVPEALRKATERAKKGMVQVPLVDG-TLPYEVLGAFGAGRVLLKPAS
RS5_DESVH       GKGSVGFGLGKAQEVPEALRKATERAKKSMIEVPLIDG-TLPYEILGRFGAGHVLLKPAS
RS5_PELCD       GQGIVGYGHGKAKEVPEAIRKGVEQAKKNLIRVPLKDR-SIPFDVIGKFGAGRVLLKPAS
RS5_GEOMG       GSGFVGYGLGKANEVPEAIRKGVEQAKKNLIKVPIVEGQTIPYEVLGHFGAGRVLIKPAS
RS5_GEOSL       GNGCVGYGLGKANEVPEAIRKGVEQAKKNLIKVPIVEGHTIPYEVLGHFGAGRVLIKPAS
RS5_SYMTH       GNGRVGAGLGKAAEIPEAVRKGTEDAKKHMIKIPL-NGTTIPHEVIGRFGAGKVLLKPAS
RS5_CALS4       DKGYVGVGRGKAAEIPDAIRKAIEDAKKHLIKVPV-VGTTIPHEVIGEFGAGKVLLKPAR
RS5_LACAC       KKGRVGFGTGKAQEVPEAIRKAVEDGKKKMINVPK-VGTTIPHEVIGHYGSGNILLKPAE
RS5_LACJO       RKGHVGFGTGKAQEVPEAIRKAVEAGKKRMIKVPT-VGTTIPHEVMGHYGSGNIMLKPAE
RS5_CARHZ       QKGHVGVGLGKAPEVPDAIRKGIEDAKKNLIKVPIVNT-TIPHEIIGEAGAGKVLLKPAA
RS5_CLOAB       ENGHVGVGTGKSAEIPEAIRKGIEDAKKNLVEVAI-VGTTVPHEIYGEFGTGRVLIMPAS
RS5_CLOPE       ENGHVGVGTGKSIEIPEAIRKGIEDAKKNLVEVSI-VGTTVPHEIHGKFGTGDVLIMPAT
RS5_LACSS       KNGHVGFGTGKAQEVPEAIRKAVEDAKKNLINVPK-VGTTLPHEVIGRFGAGRVLLKPAV
RS5_LACPL       HKGHVGFGTGKAQEVPEAIRKASEAAKKNLITVPM-VGTTIPHEALGVYGGGRIMLKPAV
RS5_STAS1       KNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVVPRVEG-TTPHTITGRFSSGSVFMKPAA
RS5_STAAW       KNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVVPRVEG-TTPHTITGRYGSGSVFMKPAA
RS5_STAEQ       KNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVVPRVEG-TTPHTITGQYGSGSVFMKPAA
RS5_STAHJ       KNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVVPRVEG-TTPHTITGRYGSGSVFMKPAA
RS5_LISMF       KNGHVGFGTGKAQEVPDAIRKAVEDAKKNMVLVPTVDT-TIPHTVVGHFGGGEILLKPAS
RS5_LISIN       KNGHVGFGTGKAQEVPDAIRKAVEDAKKNMVFVPTVDT-TIPHTVVGHFGGGEILLKPAS
RS5_OCEIH       KNGHVGFGTGKAQEVPEAIKKAVDDAKKNLISVPI-VGTTIPHEIHGQFGSGNVLMKPAA
RS5_GEOKA       KNGHVGFGTGKAQEVPEAIRKAIEDAKKNLIEVPI-VGTTIPHEVIGHFGAGEIILKPAS
RS5_BACSK       KNGHVGFGMGKAQEVPEAIRKAVEDAKKNLIEVPIVNT-TIPHQIVGRFGAGRVFLKPAS
RS5_BACHD       KNGRVGFGMGKAQEVPEAIRKAVEDAKKNLIEVPIVGT-TIPHEIVGRFGAGRVLLKPAS
RS5_BACHK       KNGHVGFGTGKAQEVPDAIRKAIEDAKKNLIAVPL-VGTTIPHTINGHFGAGEVFLKPAA
RS5_BACLD       KNGHVGFGTGKAQEVPEAIRKAVEDAKKNLIEVPM-VGTTIPHEIIGRFGAGNILLKPAS
RS5_BACSU       KNGHVGFGTGKAQEVPEAIRKAVEDAKKNLIEVPM-VGTTIPHEIIGRFGAGNILLKPAS
RS5_ENTFA       KNGHVGFGTGKAQEVPEAIRKAIEDAKKNLVEVPM-VGSTIPHEVIGVFGGGRILMKPAV
RS5_LACLA       RNGRVGFGTGKAQEVPEAIRKAIEAAKKNLITVPM-VGTTLPHEALGVFGGGKILLKPAV
RS5_STRR6       HNGRVGFGTGKAQEVPEAIRKAVDDAKKNLIEVPM-VGTTIPHEVLSEFGGAKVLLKPAV
RS5_STRT1       RNGRVGFGTGKSQEVPEAIRKAVEAAKKNLIEVPM-VGTTIPHEVRSEFGGAKVLLKPAV
RS5_STRP3       GNGRVGFGTGKAQEVPEAIRKAVEAAKKNMIEVPM-VGTTIPHEVYTNFGGAKVLLKPAV
RS5_STRA5       RNGRVGFGTGKAQEVPEAIRKAVEAAKKNMVEVPM-VGTTIPHEVRSEFGGAKVLLKPAV
RS5_STRMU       RNGRVGFGTGKAQEVPEAIRKAVEAAKKNMIEVPM-VGTTIPHEVRSEFGGARVLLKPAV
                     * . ..      :  *.                 :             . :  : 

RS5_NEOSM       EGTGIVAGG-AMRKFCEMLGVSDIIAKSYGSSTSGIVIRNAIKAFSLVCSPEYVAGKR-N
RS5_MYCHJ       RGKGIVASN-TVRAVVELAGYTDIYTKTYGSRTKINVVRATLKALLKLRTINQVAELR-D
RS5_MYCH7       RGKGIVASN-TVRAVVELAGYTDIYTKTYGSRTKINVVRATLKALLKLRTINQVAELR-D
RS5_MYCMO       KGKGIIASN-SVRAVVELAGYTDIYTKSYGSRSKENVVKAVFDALKKLRYAEDIAKMR-D
RS5_MYCPU       KGKGIIASG-AVRAVMELAGYTDIYAKSYGSRTKMNTVKATVETLKKMRTVEEIAALR-G
RS5_LEPIN       AGTGIIAGA-SVRSIVEKAGIQDVLTKSWGSSNPVNIVKATLDALEQLETPILAAKKR-G
RS5_LEPIC       AGTGIIAGA-SVRSIVEKAGIQDVLTKSWGSSNPVNIVKATLDALEQLETPILAAKKR-G
RS5_BORBU       HGTGVIAGG-PVRAVMEALGVHDILSKSLGSNNSMNVVKATFKAFDLVLNAEKVAEMR-G
RS5_BORBP       HGTGVIAGG-PVRAVMEALGVHDILSKSLGSNNSMNVVKATFKAFDLVLNAEKVAEMRGK
RS5_TREDE       SGTGIIAGG-TIRAIMEAAGATDLLSKSLGSSSAVNVVKATFDAASLLMDGKKIAKSR-G
RS5_TREPA       SGTGIIAGG-TVRAIMEVAGATDVLSKSLGSNSAINVVRATFGAVAQLMDARKLARER-G
RR5_THAPS       EGSGVIAGG-AVRTVLEVAGIKNVIAKQLGSDNLLNNARTAIVALESLTTLDEVKRKR-Y
RR5_TRICV       EGSGVIAGG-SVRTVLEVAGIKNVIAKQLGSNNVLNNARAAVSGLNNLTTKSQVLKKR-D
RR5_PHATC       EGSGVIAGG-AVRIVLEVAGVKNVIAKQLGSNNLLNNARASVCALQNLTTKAQVAKKR-N
RR5_CYACA       QGSGVIAGG-AMRTVIELSGIKNIVAKQLGTKNHLNNAKATINALSKLNS-----KSS-Q
RR5_CYAM1       SGSGVIAGG-AVRSVMELAGIQNVLSKQLGGSNPLNNAKAALLALKS-----SSANAR--
RS5_GLOVI       GGTGVIAGG-AVRTVLELAGIKNVLAKSLGSKSPLNNARAAADALSRLRTLSEVAGER-G
RR5_GUITH       PGSGVIAGG-SVRTILELAGIKNILAKQLGSSNPLNNARAAANALINLRTYTSVLNDR-N
RS5_PROM9       PGTGVIAGG-SIRTVLELAGIKNVLAKRLGSKTPLNNARAAMVALSQLRTHKSASRER-G
RS5_PROMP       PGTGVIAGG-SIRTVLELAGIKNVLAKRLGSKTPLNNARAAMVALSQLRTHKSASRER-G
RS5_PROMA       PGTGVIAGG-SIRTVLELAGIKNVLAKRLGSKTPLNNARAAMVALSLLRTHKATAKER-G
RS5_PROMT       PGTGVIAGG-SIRTVLELAGIKNVLAKRLGSKTPLNNARAAMVALSELRTHKATAKER-G
RS5_PROMM       PGTGVIAGG-SIRTVLELAGIKNVLAKRLGSKTPLNNARAAMVALASLRTHKETAKER-G
RS5_SYNPX       PGTGVIAGG-SIRTVLELAGIKNVLAKRLGSKTPLNNARAAMVALSLLRTHKETAKER-G
RS5_SYNP6       PGTGVIAGG-AVRTVLELAGVKNVLAKRLGSKSPLNNARAALEALSSLRTFQEVAQSR-D
RS5_SYNY3       PGTGVIAGG-AVRTVLELAGVKNILAKQLGSNNPLNNARAAINALETLRTFSEVAEER-G
RS5_THEEB       PGTGVIAGG-SVRTVLELAGVRNVLAKQLGSSNPLNNARAALEALAALRTFQEVAEER-E
RS5_TRIV2       PGTGVIAGG-AVRTVLELAGVRNVLAKQLGSNNPLNNARAAVNALSTLRTLAEVAEDR-G
RR5_CYAPA       EGTGVIAGG-AVRTVLELAGVRNILAKQLGSNNPLNNARAAMNALSRLKTFSQFAKDR-G
RR5_GRATL       IGSGVIAGG-STRTVLELAGVKNILAKQLRSSNTLNNARAVLNALSQLRTFQNTAQNR-D
RR5_PORPU       PGSGVIAGG-SVRTVLELSGVQNILAKQLGSNNTLNNARAVLNGLTQLRTFSEAAKDR-G
RR5_PYRYE       PGSGVIAGG-SVRTVLELSGVQNILAKQLGSNNTLNNARAVLNGLTQLRTFSEAAKDR-G
RS5_MYCGA       SGTGIIAGG-AIRAVVELAGFTDVYTKNMGKNTPINMVRATMDGITSQYTPRQIAKLR-S
RS5_MYCGE       LGTGIIAGG-AIRAIVELAGFSDIYTKNLGRNTPINMIHATMDGILKQLSPKKVALLR-N
RS5_MYCPN       QGTGIIAGG-AIRAIIELAGYSDIYTKNLGRNTPINMIHATMDGILKQLSPRRVAILR-N
RS5_MYCPE       KGTGVIAGG-PIKVVLELCGFKDVYSKNLGKNTSLNMVRATIKGLQMQKSPKEYATLR-D
RS5_LEGPH       EGTGIIAGG-AMRAVLEVLGVQNILAKSIGSTNPSNIVRATIGALTHIGTPDYVAAKR-G
RS5_NEIMB       EGSGVKAGG-PMRLVFDAMGIHNISAKVHGSTNPYNIVRATLDGLSKLHTPADIAAKR-G
RS5_CHRVO       DGTGVKAGG-PMRAIFDAMGIHNVSAKIHGSTNPYNVVRATLDGLSKINTPAQIAAKR-G
RS5_NITEU       EGTGIIAGG-PMRAIFEVMGVHNILAKCLGSTNPYNIVRATLDGLSKVQTPAMIAAKR-G
RS5_DECAR       EGTGIIAGG-AMRAVFEVVGVTNVVAKAHGSTNPYNIVRATIDGLSKVNTPAEIAAKR-G
RS5_BORPE       EGTGVIAGG-PMRAIFEVMGVRNVVAKSLGSSNPYNLVRATLNGLRASLTPAEVAAKR-G
RS5_THIDA       EGTGIIAGG-AMRAVFEVMGVQNVLAKCLGSTNPYNVVRATIDGLMKMSTPSEIAAKR-G
RS5_AROAE       SGTGIIAGG-PMRAVFEVMGVTDVTCKCLGSANPYNVVRATLNGLLAINTPAEIAAKR-G
RS5_NITMU       EGTGIIAGG-PMRAIFEVMGVHNILAKCIGSTNPYNVVRATLNGLQAMSNPAEIAAKR-G
RS5_BURP1       DGTGVIAGG-PMRAVFDVMGVQNVVAKSHGSTNPYNLVRATLDGLRKQSTPADIAAKR-G
RS5_BURL3       AGTGVIAGG-PMRAVFDVMGVQNVVAKSHGSTNPYNLVRATLDGLRKQSTPADIAAKR-G
RS5_CUPPJ       EGTGVIAGG-PMRAIFEVMGVTNVVTKSHGSTNPYNMVRATLDGLQKMSTPSEIAAKR-G
RS5_RALSO       EGTGVIAGG-PMRAIFEVMGVTNIVTKSHGSTNPYNMVRATLDGLRKMSTPAEIAAKR-G
RS5_HYDCU       DGTGIIAGG-AMRAVLEAAGVKDVLAKCVGTTRPVNVVRSTVNALTGMSSPELIAAKR-G
RS5_XANC5       EGTGVIAGG-AMRAVLEAVGVKNVLAKAVGSRNPINLVRATLKGLSEVQSPARVAAKR-G
RS5_XYLFA       EGTGVIAGG-AMRAVLEAVGVKDVLAKAIGSRNPINLVRATLKGLEDMQSPTHIALKR-G
RS5_XYLFT       EGTGVIAGG-AMRAVLEAVGVKNVLAKAIGSRNPINLVRATLKGLEDMQSPTHIALKR-G
RS5_FRATT       AGTGIIAGG-AMRSVFEAVGVHNVLAKTYGSTNPANVVRATIAGLAKIKSPDEIAEKR-G
RS5_COXBU       EGTGVIAGN-AMRAIFEVMGVQNVLAKCIGSSNPINVVRATFKGLKQMETPESVAAKR-G
RS5_PSEAE       EGTGIIAGG-AMRAVLEVAGVQNVLAKCYGSTNPVNVVYATFKGLKNMQAPEAVAAKR-G
RS5_PSEPK       EGTGIIAGG-AMRAVLEVAGVQNVLAKCYGSTNPVNVVYATFKGLKAMQSPESIAAKR-G
RS5_PSEF5       EGTGIIAGG-AMRAVLEVAGVQNVLAKCYGSTNPVNVVHATFKGLKAMQSPESIAAKR-G
RS5_PSEPF       EGTGIIAGG-AMRAVLEVAGVQNVLAKCYGSTNPVNVVHATFKGLKAMQSPESIAAKR-G
RS5_PSESM       EGTGIIAGG-AMRAVLEVAGVQNVLAKCYGSTNPVNVVHATFKGLKGMQSPESIAAKR-G
RS5_PSE14       EGTGIIAGG-AMRAVLEVAGVQNVLAKCYGSTNPVNVVHATFKGLKGMQSPESIAAKR-G
RS5_PSYA2       EGTGVIAGG-AMRAVLEVAGVKDVLTKCYGSTNTANVVRATFNGLRDMSTPEKMAAKR-G
RS5_ACIAD       EGTGVIAGG-AMRAVLEAAGVHNVLAKCYGSTNAANVVNATFKGLRDMTSPEKVAAKR-G
RS5_ACIBT       EGTGVIAGG-AMRAVLEAAGVHNVLAKCYGSTNAANVVNATFKGLRDMTSPEKVAAKR-G
RS5_BLOFL       EGTGIIAGG-AMRAILEVVGIHNVLAKAYGSTNPINIVRATVNALKNMKSPEMVAEKR-G
RS5_WIGBR       EGTGIIAGG-AMRAVLEVAGVHNVLAKVYGSTNPINVVRATVNALKKMRFPMHIAEKR-G
RS5_BUCBP       NGTGIIAGG-AMRSVLEVAGVHNVLAKTYGSTNPINVVRATMLVLESMKSPEMIALKR-N
RS5_BLOPB       EGTGIIAGT-TMRAILEVVGIHNVLAKAYGSTNPINIVRATINALQSMKSPEMIAEKR-G
RS5_COLP3       EGTGIIAGG-AMRAVLEVAGVQNVLSKAYGSTNPINVVRATVSALVNMHSPEGMAAKR-G
RS5_PSEHT       EGTGIIAGG-AMRAVLEVTGVQNVLSKCYGSTNPINVVRATISALENMNSPQSIAAKR-G
RS5_BUCAI       DGTGIIAGG-AMRAVLEVAGIHNVLAKTYGSTNPINVVRATMNGLVNMKSPEMIAAKR-N
RS5_BUCAP       DGTGIIAGG-AMRAVLEVAGIHNVLAKTYGSTNPINVVRATMNGLTNMKSPEMIAAKR-N
RS5_PHOLL       EGTGIIAGG-AMRAVLEVAGVRNVLAKTYGSTNPINVVRATLDALDSMKSPEMVAAKR-G
RS5_HAEDU       EGTGIIAGG-AMRAVLEVAGVHNVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKR-G
RS5_HAEI8       EGTGIIAGG-AMRAVLEVAGVRNVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKR-G
RS5_MANSM       EGTGIIAGG-AMRAVLEVAGVRNVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKR-G
RS5_PASMU       EGTGIIAGG-AMRAVLEVAGVRNVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKR-G
RS5_YERPS       EGTGIIAGG-AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIAALEDMKSPEMVAAKR-G
RS5_PECAS       EGTGIIAGG-AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLANMKSPEMVAAKR-G
RS5_ECOLI       EGTGIIAGG-AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKR-G
RS5_SHIDS       EGTGIIAGG-AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKR-G
RS5_PHOPR       EGTGIIAGG-AMRAVLEVAGIRNVLAKAYGSTNPINVVRATIAGLSGMNSPEMIAAKR-G
RS5_ALIF1       EGTGIIAGG-AMRAVLEVVGVRNVLAKAYGSTNPINVVRATIAGLSSVKSPEMVAAKR-G
RS5_VIBPA       EGTGVIAGG-AMRAVLEVAGVHNVLSKAYGSTNPINIVRATIDALGSMKSPEMVAAKR-G
RS5_VIBVY       EGTGVIAGG-AMRAVLEVAGVHNVLSKAYGSTNPINIVRATIDALVDVKSPEMVAAKR-G
RS5_VIBCH       EGTGVIAGG-AMRAVLEVAGVHNVLSKAYGSTNPINIVRATIDALVDVKSPEMVAAKR-G
RS5_IDILO       EGTGIIAGG-AMRAVLEVSGVHNVLSKAYGSTNPINVVRATIKALNGMKSPEQVAAKR-G
RS5_SHEON       QGTGIIAGG-AMRAVLEVAGVHNVLSKAYGSTNPINIVRATVDALVHMKSPSQIAAKR-G
RS5_METCA       EGTGIIAGG-AMRAVFEVVGVHNVLAKCIGTNNPINVVRATIKGLTALRDPKSVAAKR-G
RS5_NITOC       EGTGIIAGG-AMRAVFEVVGVHNVLAKCIGSANPVNVVQATVKGLVQMSSPEAIAAKR-G
RS5_RICBR       AGTGVIAGG-SMRAIFDSLGVHDIVAKSIGSTNVYTMIAATFDALKKLSSPKSIAARR-D
RS5_RICPR       AGTGVIAGG-SMRAIFDSLGVHDIVAKSIGSTNVYAMISATFDALNKLASPKSIAIRR-D
RS5_RICTY       AGTGVIAGG-SMRAIFDSLGVHDIVAKSIGSTNVYAMISATFDALNKLASPKSIAIRR-G
RS5_RICCN       AGTGIIAGG-SMRAIFDSLGVHDIVAKSIGSTNVYAMISATFDALNKLASPKSIAMRR-D
RS5_RICFE       AGTGVIAGG-SMRAIFDSLGVHDIVAKSIGSTNVYAMISATFDALNKLASPKSIAMRR-D
RS5_WOLPM       AGTGIIAGG-AIRSVFEVLGIKDVVAKSTRSNNPHNVICAVFKAFDSMLSPRQVASKR-G
RS5_WOLTR       AGTGIIAGG-AIRSVFEVLGIKDVVAKSTRSNNPHNVICAVFKAFDNMLSPRQVASKR-G
RS5_EHRRW       VGTGIIAGG-SIRLIFEVLGVQDVVAKSIGSSNPHNVVYAVFTAFRKMLSPKQVASKR-S
RS5_EHRCJ       VGTGIIAGG-SIRLIFEVLGVQDVVAKSIGSSNPHNVVYAVFAAFKKMLSPKQVANKR-S
RS5_EHRCR       VGTGIIAGG-SIRLIFEVLGVQDVVAKSIGSSNPHNVVYAVFAAFRKMLSPKQVANKR-S
RS5_ANAMM       VGTGIIAGG-SVRAVFEVLGVQDVVAKIIGSSNPHSVIYAVFAAFKNMLSPKQVAGKR-S
RS5_ANAPZ       VGTGIIAGG-SVRAVFEVLGVQDVVAKIVGSSNAHTVIYAVFSAFKSMLSPKQVAGKR-G
RS5_PELUB       KGTGIIAGG-PVRAVCEVLGIKDIVAKSMGTSNPHNMIRATMKALSKQNSPKHIATIR-N
RS5_ZYMMO       SGTGIIAGG-PMRAIFESLGVADVVTKSVGTSNPYNMIRATFEALNDQKSPKAVAQRR-G
RS5_GLUOX       AGTGIIAGG-PMRAVFESLGVNDVVAKSLGTRNPHNMIKATFAALEKASSPRHVASRR-G
RS5_RHORT       AGTGIISGG-PMRAVFETMGVQDVVGKCTGTTNPYNMIKATFDALVNSQAPRQVAARR-G
RS5_RHOS4       PGTGIIAGG-PMRAVFEMLGIQDVVAKSLGSQNPYNMIRATMDGLKRESSPRQVAQRR-G
RS5_RUEPO       EGTGIIAGG-PMRAVFEMLGVKDVVSKSLGSANPYNMIRATIDGLKKEQSPRSVAQRR-G
RS5_CAUVC       PGTGVIAGG-PMRAVLETLGVQDVVAKSTGSSNPYNMVRATFEALKVQSSPRQIAAKR-G
RS5_BRADU       AGTGIIAGG-PMRAVFETLGVQDVVAKSIGSSNPYNMVRATFDALKHQDSPRSVAARR-N
RS5_NITWN       AGTGIIAGG-PMRAVFETLGIQDVVAKSVGSSNPYNMVRATFDALKHQDSPRSVSARR-N
RS5_RHOPA       AGTGIIAGG-PMRAVFETLGIADVVAKSVGSSNPYNMVRATFDALKHLDSPRSVAARR-N
RS5_RHILO       QGTGIIAGG-PMRAVFETLGMHDVVAKSMGSSNPYNMVRATFDALKSQMHPKDVAAAR-G
RS5_AGRFC       AGTGIIAGG-PMRAVFETLGVHDVVAKSTGSSNPYNMVRATFDALKHQVHPKDIAAQR-G
RS5_RHIME       PGTGIIAGG-PMRAVFETLGVHDVVAKSTGSSNPYNMVRATFDALKNQMHPKDIAAQR-G
RS5_BRUSU       AGKGIIAGG-PMRAVFETLGVQDVVAKSLGSSNPYNMVRATFDALKHQMHPKDIAAQR-G
RS5_BARHE       AGTGIIAGG-PMRAIFETLGMQDVVAKSLGSSNPYNMVRATFDALKRQMHPRDIAAQR-G
RS5_BARQU       AGTGIIAGG-PMRAIFETLGMQDVVAKSLGSSNPYNMVRATFDALKHQMHPRDIAVQR-G
RS5_DEHM1       PGTGIIAGG-SVRAVLESTGIKDILTKSMGCSNKANVAKATLGGLTAMRDPKTTVTKRRS
RS5_DEHMC       PGTGIIAGG-SVRAVLESTGIKDVLTKSMGCSNKANVAKATLGGLTAMRDPKATVTKRRS
RS5_FUSNN       EGTGVIAGS-ASREILELVGVHDILTKIKGSRNKHNVARATVEALKLLRTAEQIAALR-G
RS5_PARUW       FGTGVIAGS-KVRAVLELAGIKDVMAKNLGSSNPINQVKATFQAIQQLLTRDEIKQRR-G
RS5_CHLTA       PGTGIVAGS-RIRLILEMAGVKDIVAKSLGSNNPMNQVKAAFKALLTLSCKDDIMKRR-A
RS5_CHLPN       PGTGIVAGS-RIRLILEMAGIKDIVAKSFGSNNPMNQVKAAFKALTGLSPRKDLLRR--G
RS5_CHLAB       PGTGIVAGS-RIRLILEMAGVKNIVAKSLGSNNPMNQVKAAFKALLSLSSRKDVLTRR-K
RS5_CHLCV       SGTGIVAGS-RIRLILEMAGVKNIVAKSLGSNNPMNQVKAAFKALLSLSSRKDVLQRR-R
RS5_RHOBA       AGTGIIAGQ-AVRAVCEACGIHDILTKSYGTNNPVTLVKATLDAMSKLRTREQIAALR-G
RS5_THEMA       PGTGIIAGG-TVRAVVELAGIQNILTKSLGSTNPLNLALATMNGLKNLLDPRKVAKLR-D
RS5_UREPA       EGTGIIAGG-PVRAVVELAGFTDIYTKSRGANAPMNVIRATINGLLQQLTPKEIARLR-D
RS5_ONYPE       KGTGIVAGGKAARTILELVGINDVLTKTFGSRTSINVIRAVMDGLQSLRTKEEVAKLR-G
RS5_PORGI       TGTGVKAGG-AMRAVLDSVGVTDVLAKSKGSSNPHNLVKATIQALAEMRSPLMVAQNR-G
RS5_BACFN       HGTGVVAGG-AMRAVLESVGVTDVLAKSKGSSNPHNLVKATIMALGEMRDARMIAQNR-G
RS5_BACTN       HGTGVVAGG-AMRAVLESVGITDVLAKSKGSSNPHNLVKATIEALSEMRDARMIAQNR-G
RS5_DEIRA       PGTGVIAGT-VPRSIAELAGITNMLSKELGSRNKVNVAYAVFDGFKNLRTAKQVRNLR-G
RS5_THET8       PGTGVIAGA-VPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
RS5_TROW8       PGTGVIAGG-PVRAVLECAGVRDVLSKSLGSSNSINVVYATLDALKHLEDPASVARRR-G
RS5_TROWT       PGTGVIAGG-PVRAVLECAGVRDVLSKSLGSSNSINVVYATLDALKHLEDPASVARRR-G
RS5_BIFLO       PGTGVIAGG-SVRAVMECAGITDVLTKSMGSATAVNVVRATVDALKQLEEPEEIAARR-G
RS5_LEIXX       AGTGVIAGG-PVRAVLECAGIHDVLSKSLGSSNTINIVHATVEALQQLEEPRAVAARR-G
RS5_CORJK       PGTGVIAGG-AVRPVLECAGVQDILSKSLGSDNAINIVHATVAGLKQLVRPEEVAARR-G
RS5_CORDI       PGTGVIAGG-AARPVLECAGVQDILCKSLGSDNAINVVHATVAGLKQLNRPEEVAARR-G
RS5_COREF       PGTGVIAGG-AARPVLECAGIQDILSKSLGSDNAINVVHATVDGLKQLVRPEEVAARR-G
RS5_CORGL       PGTGVIAGG-AARPVLECAGIQDILSKSLGSDNAINVVHATVDGLKQLVRPEEVAARR-G
RS5_NOCFA       PGTGVIAGG-AARAVLECAGIHDILAKSLGSDNAINVVHATVAALKQLQRPEEVAARR-G
RS5_MYCLE       PGTGVIAGG-AVRAVLECAGVHDILAKSLGSDNAINVVHATVAALKLLQRPDEVAARR-G
RS5_MYCTU       PGTGVIAGG-AARAVLECAGVHDILAKSLGSDNAINVVHATVAALKLLQRPEEVAARR-G
RS5_MYCPA       PGTGVIAGG-AARAVLECAGVHDILAKSLGSDNAINVVHATVAALKLLQRPEEVAARR-G
RS5_CUTAK       PGTGVIAGG-SARAVLECAGVHDVLAKSLGSSNAINVVHATVDALQQLEEPEEVARRR-G
RS5_THEFY       PGTGVIAGG-PVRAVLECAGIHDVLTKSLGSSNPINIVRATVAALKSLSRPEEIAARR-G
RS5_STRAW       PGTGVIAGG-PVRAVLECAGVHDILSKSLGSSNAINIVHATVAALKGLQRPEEIAARR-G
RS5_STRCO       PGTGVIAGG-PVRAVLECAGIHDVLSKSLGSDNQINIVHATVEALKGLQRPEEIAARR-G
RS5_SOLUE       PGTGVIAGG-AVRAVITACGVPNVLTKSIGRRNPHNVVKATIVALEMLRDRNTVAEMR-G
RS5_AQUAE       RGTGVVAGG-AAKPVFELAGYTDVLTKIIGSTNPDNVVRAVFDALLQLKTPEQIAEER-G
RS5_PELLD       PGTGLIAGG-AVRAVLEMAGVRDVLTKSLGSSNPHNVVKAAILGLKSISDANDVAERR-S
RS5_CHLCH       PGTGLIAGG-AVRAVLEMAGIHDILTKSLGSSNPHNVVKAAIKGLQYISDAYDVGERR-S
RS5_CHLTE       PGTGLIAGG-AVRAVLEMAGIHDILTKSLGSSNPHNVVKAAIKGLQNISDANDVAERR-S
RS5_MESFL       PGTGVIAGG-PARAVIELAGIADVYAKSLGRNNPINMIRATIDGLSSMHTAKKVNDLRFG
RS5_MYCCT       VGTGIIAGG-PARAVIELSGISDVYAKSLGSNNAINMIRATFEGLSSMQTLKRVQELRYG
RS5_MYCMS       VGTGIIAGG-PARAVIELAGISDVYAKSLGSNNAINMIRATFEGLSSMQTLKRVQELRYG
RS5_BDEBA       PGTGVIAGG-AVRAVLESVGVKDILTKCVGTRNPHNAVRATIDGLKQLKQQL--------
RS5_DESPS       AGTGLIAGG-PVRAVLEAAGVSNILTKCLGSHNPHNMVKATIDGLKQLRSAQKIAELR-G
RS5_CAMJR       EGTGVIAGG-STRPIVELAGIKDILTKSLGSNNSANVVRATIKALTMLK----------G
RS5_SULDN       EGTGVIAGG-AVRPVLELAGIKDVLTKSIGSNNPGTLVRATVEALGRLK----------G
RS5_HELPJ       EGTGVIAGG-STRPIVELAGIKDILTKSLGSNNPYNVVRATFDALAKIKA----------
RS5_HELHP       EGTGVIAGG-STRPVIELAGIKDILTKSLGSNNPYNVVRATIDALARIKA----------
RS5_WOLSU       EGTGVIAGG-SARPVIELAGIKDILTKSLGSNNPYNVVRATIDALSRIKA----------
RS5_DESAG       KGTGIIAGG-AVRAIMEAVGIHDVLAKAIGTNNPHNVLRATMAGLTSLRSAEYVSQLR-G
RS5_DESVH       KGTGIIAGG-AVRAVMEAVGVTDVLTKAIGTNNPHNVLRATVAGLASLRSAEEVGQLR-G
RS5_PELCD       AGTGVIAGG-AVRAVLEVSGVGDILSKCIGSNNPHNVVRATIDALSRLKSAEELRALR-G
RS5_GEOMG       AGTGVIAGG-AARAVFESAGLHNVLSKCLGSNNPHNVVKAAFDGLKQLRSPDEIMARR-G
RS5_GEOSL       AGTGVIAGG-AARAVFEAAGLHNVLSKCLGSNNPHNVVKAAFNGLAQLRSPEEIMARR-G
RS5_SYMTH       PGTGVIAGG-AVRAVLEAAGVRDILTKSLGSNNAANQVLATLAGLRQLKSAEEVAKLR-G
RS5_CALS4       EGTGVIAGG-PVRAVLESAGIRDVLSKSLGSSNATNMVYATIEGLKRLKTAEEVARLR-G
RS5_LACAC       AGSGVAAGG-AVRIVMDMAGISDVTSKSLGSNTPINVVRATIDGLKKLRTSEEVSKLR--
RS5_LACJO       AGSGVAAGG-AVRIIMDLAGISDVTSKSLGSNTPINVIRATMDGLSKLKTREDVLKLR--
RS5_CARHZ       PGTGVIAGS-AVRAILEMAGVRDILTKSLGSNNPHNMAHATIEALKSLKTVEMVAKLR-G
RS5_CLOAB       EGTGVIAGG-PVRAVLELAGLNDVRAKSLGSNNPRNMVNATINGLSRLRTVEQIAALR-G
RS5_CLOPE       EGTGVIAGG-PARSVLELAGLKDVRAKSLGSNNPRNMVKATINGLANLRTAEDIAKLR-G
RS5_LACSS       EGSGIAAGG-AVRAVMELAGIDDVTSKTLGSKTAINVIRATIDGLTRMKTAEQIAELR-N
RS5_LACPL       EGSGVAAGG-AVRAVMELAGVDDVTSKRLGSNTPVNVVRATFEGLKSLKTAEQVAALR-G
RS5_STAS1       PGTGVIAGG-PVRAVLELAGITDILSKSLGSNTPINMVRATINGLKNLKNAEDVAKLR-G
RS5_STAAW       PGTGVIAGG-PVRAVLELAGITDILSKSLGSNTPINMVRATIDGLQNLKNAEDVAKLR-G
RS5_STAEQ       PGTGVIAGG-PVRAVLELAGITDILSKSLGSNTPINMVRATINGLQNLKNAEDVAKLR-G
RS5_STAHJ       PGTGVIAGG-PVRAVLELAGITDILSKSLGSNTPINMVRATINGLQNLKNAEDVAKLR-G
RS5_LISMF       AGSGVTAGG-PVRAVLELAGVADVSSKSLGSNTPINMVRATIDGIKQLKNAEDVAKLR-G
RS5_LISIN       AGSGVTAGG-PVRAVLELAGVADVSSKSLGSNTPINMVRATIDGIKQLKNAEDVAKLR-G
RS5_OCEIH       EGTGVISGG-PVRAILELAGVGDILTKSLGSNTPINMIRATLNGLTNLKTAEDVAKLR-G
RS5_GEOKA       EGTGVIAGG-PARAVLELAGISDILSKSIGSNTPINMVRATFDGLKQLKRAEDVARLR-G
RS5_BACSK       EGTGVIAGG-PVRAVLELAGIGDVLSKSLGSSNPINMVRATITGLTNLKRAEEVAKLR-G
RS5_BACHD       EGTGVIAGG-PVRAVLDLAGVGDILSKSLGSNNPINMVRATVKGLQELKRAEDVAKLR-G
RS5_BACHK       EGTGVIAGG-PVRAVLELAGVQDILSKSLGSNTPINMIRATVNGLSELKRAEDVAKLR-G
RS5_BACLD       EGTGVIAGG-PVRAVLELAGVSDILSKSLGSNTPINMIRATVQGLSELKRAEDVAKLR-G
RS5_BACSU       EGTGVIAGG-PVRAVLELAGVADILSKSLGSNTPINMIRATLQGLSELKRAEDVAKLR-G
RS5_ENTFA       EGSGVAAGG-PVRAVLELAGVADITSKSLGSNTPINVVRATVEGLKQLKRAEEVAALR-G
RS5_LACLA       EGAGVAAGG-AVRAVLELAGVADVTSKSLGSNTPINVVRATVDGLNQLKRAEEVAALR-G
RS5_STRR6       EGSGVAAGG-AVRAVVELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEIAALR-G
RS5_STRT1       EGAGVAAGG-AVRAVVELAGVADVTSKSLGSNTPINIVRATVEGLKQLKRAEEVAALR-G
RS5_STRP3       EGSGVAAGG-AVRAVIELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEVAALR-G
RS5_STRA5       EGAGVAAGG-AVRAVIELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEVAALR-G
RS5_STRMU       EGAGVAAGG-AVRAVVELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEVASLR-G
                 * *: :.    . .    *  ::  *                                 

RS5_NEOSM       RKKSKFISKAVTQ---------------------------------------------
RS5_MYCHJ       LSPQQAQAQKV-----------------------------------------------
RS5_MYCH7       LSPQQAQAQKV-----------------------------------------------
RS5_MYCMO       LDIKDL----------------------------------------------------
RS5_MYCPU       LKVQDIIS--------------------------------------------------
RS5_LEPIN       ISLNKLFGKD------------------------------------------------
RS5_LEPIC       ISLNKLFGKD------------------------------------------------
RS5_BORBU       KTLKTLWG--------------------------------------------------
RS5_BORBP       KTLKTLWG--------------------------------------------------
RS5_TREDE       KTLLDVWG--------------------------------------------------
RS5_TREPA       KALVDMWG--------------------------------------------------
RR5_THAPS       HKSVL-----------------------------------------------------
RR5_TRICV       LHSNSSEKINS-----------------------------------------------
RR5_PHATC       LD--------------------------------------------------------
RR5_CYACA       LSLMSFSN--------------------------------------------------
RR5_CYAM1       ----------------------------------------------------------
RS5_GLOVI       VPVSNLWSR-------------------------------------------------
RR5_GUITH       LDLH------------------------------------------------------
RS5_PROM9       ISLEQLYS--------------------------------------------------
RS5_PROMP       ISLEQLYS--------------------------------------------------
RS5_PROMA       ISLEQIYS--------------------------------------------------
RS5_PROMT       ISLEQIYS--------------------------------------------------
RS5_PROMM       ISLEQIYS--------------------------------------------------
RS5_SYNPX       ISLEQIYS--------------------------------------------------
RS5_SYNP6       IPVEQLY---------------------------------------------------
RS5_SYNY3       VSVEHLYT--------------------------------------------------
RS5_THEEB       IPIENLYSK-------------------------------------------------
RS5_TRIV2       IAIEKLYI--------------------------------------------------
RR5_CYAPA       VIAE------------------------------------------------------
RR5_GRATL       INIERLFNM-------------------------------------------------
RR5_PORPU       VPIENLYSK-------------------------------------------------
RR5_PYRYE       VPIESLYST-------------------------------------------------
RS5_MYCGA       KSLKEL----------------------------------------------------
RS5_MYCGE       KPISDL----------------------------------------------------
RS5_MYCPN       KNLNEL----------------------------------------------------
RS5_MYCPE       KTLKDIWE--------------------------------------------------
RS5_LEGPH       KTVEEVMAG-------------------------------------------------
RS5_NEIMB       LTVEDILGVNHG----------------------------------------------
RS5_CHRVO       LSIEDILGVGHE----------------------------------------------
RS5_NITEU       KSIDEITGA-------------------------------------------------
RS5_DECAR       LSVDQIQG--------------------------------------------------
RS5_BORPE       KSVEEILG--------------------------------------------------
RS5_THIDA       KSVEDITG--------------------------------------------------
RS5_AROAE       KSVEEILG--------------------------------------------------
RS5_NITMU       KSVEEILGLEK-----------------------------------------------
RS5_BURP1       KSVEEILG--------------------------------------------------
RS5_BURL3       KSVEEILG--------------------------------------------------
RS5_CUPPJ       KSVEDILG--------------------------------------------------
RS5_RALSO       KSVEEILG--------------------------------------------------
RS5_HYDCU       KSVEEILGE-------------------------------------------------
RS5_XANC5       KKVEELNHG-------------------------------------------------
RS5_XYLFA       KNVRGFSHGS------------------------------------------------
RS5_XYLFT       KNVRDFSHGS------------------------------------------------
RS5_FRATT       LSVEEIQG--------------------------------------------------
RS5_COXBU       KAIEEIVE--------------------------------------------------
RS5_PSEAE       KSVEEIL---------------------------------------------------
RS5_PSEPK       KSVEEIF---------------------------------------------------
RS5_PSEF5       KSVQEII---------------------------------------------------
RS5_PSEPF       LRVEEIK---------------------------------------------------
RS5_PSESM       KRVEEII---------------------------------------------------
RS5_PSE14       KRVEEII---------------------------------------------------
RS5_PSYA2       KSVDEILG--------------------------------------------------
RS5_ACIAD       LSVEQIQG--------------------------------------------------
RS5_ACIBT       KSVEEIQG--------------------------------------------------
RS5_BLOFL       KSLEYILNNYTYNGR-------------------------------------------
RS5_WIGBR       KSIDDILG--------------------------------------------------
RS5_BUCBP       KLVKEILENSYL----------------------------------------------
RS5_BLOPB       KSISEILGYYNYVKHY------------------------------------------
RS5_COLP3       KRVDEILG--------------------------------------------------
RS5_PSEHT       LRIDEILG--------------------------------------------------
RS5_BUCAI       KRIKDILG--------------------------------------------------
RS5_BUCAP       KLIEDILG--------------------------------------------------
RS5_PHOLL       KSVEEILG--------------------------------------------------
RS5_HAEDU       KTVEEIWG--------------------------------------------------
RS5_HAEI8       KTVDEILG--------------------------------------------------
RS5_MANSM       KTVDEILG--------------------------------------------------
RS5_PASMU       KTVDEILG--------------------------------------------------
RS5_YERPS       KSVEEILGK-------------------------------------------------
RS5_PECAS       KSVEEILG--------------------------------------------------
RS5_ECOLI       KSVEEILGK-------------------------------------------------
RS5_SHIDS       KSVEEILGK-------------------------------------------------
RS5_PHOPR       LSVKEILG--------------------------------------------------
RS5_ALIF1       LTVESISE--------------------------------------------------
RS5_VIBPA       LTVEAISE--------------------------------------------------
RS5_VIBVY       LTVEAISE--------------------------------------------------
RS5_VIBCH       LTVEAISE--------------------------------------------------
RS5_IDILO       LRVDEILG--------------------------------------------------
RS5_SHEON       LNVDEIRG--------------------------------------------------
RS5_METCA       MTVEELLG--------------------------------------------------
RS5_NITOC       KNLEEIVGGG------------------------------------------------
RS5_RICBR       KKMNEIFIKSSDIQVNE-----------------------------------------
RS5_RICPR       KKVHEISIKSYIQVNE------------------------------------------
RS5_RICTY       KKVHEISVKSYIQVNK------------------------------------------
RS5_RICCN       KKVNEISVKSAEIQVNE-----------------------------------------
RS5_RICFE       KKVNEISVKSSDIQVNE-----------------------------------------
RS5_WOLPM       KKISEIVGNR------------------------------------------------
RS5_WOLTR       KKISEVVGNR------------------------------------------------
RS5_EHRRW       RKIGEIIENR------------------------------------------------
RS5_EHRCJ       RKIGDIIENR------------------------------------------------
RS5_EHRCR       RKIGDIIENR------------------------------------------------
RS5_ANAMM       RKVGEVIENR------------------------------------------------
RS5_ANAPZ       KKVCDVINR-------------------------------------------------
RS5_PELUB       KKISDVIEKRG-----------------------------------------------
RS5_ZYMMO       KRIADLFGRGGASAAKAEAEAAAVVE--------------------------------
RS5_GLUOX       KKAAELFGKREQGQTEAEVTNG------------------------------------
RS5_RHORT       KKVGDIVARRDGAAAAGATE--------------------------------------
RS5_RHOS4       KKVADILKKPEAEVAEA-----------------------------------------
RS5_RUEPO       KKVADILPKRDEAPAAEAAEA-------------------------------------
RS5_CAUVC       KKVGDILGRRADGASAPEAIEG------------------------------------
RS5_BRADU       IKVSTLQSRRIGGDAEAAAD--------------------------------------
RS5_NITWN       IKVSTLQSRRVGGDAEAVAE--------------------------------------
RS5_RHOPA       IKVSTLQARRVGGDAEVVAE--------------------------------------
RS5_RHILO       IKYSTLQARRGTAVAAEE----------------------------------------
RS5_AGRFC       LKYATLQARRAASGNASEE---------------------------------------
RS5_RHIME       MKYATLQSRRVSAGVASEE---------------------------------------
RS5_BRUSU       IKYSTLQARRHDVVGSEE----------------------------------------
RS5_BARHE       IKYSTLQARRQHLVDAEG----------------------------------------
RS5_BARQU       IKYSILQARRQHLVDAEG----------------------------------------
RS5_DEHM1       SLKEEAAGG-------------------------------------------------
RS5_DEHMC       SLKEEATGG-------------------------------------------------
RS5_FUSNN       LEVKDILS--------------------------------------------------
RS5_PARUW       V---------------------------------------------------------
RS5_CHLTA       VIND------------------------------------------------------
RS5_CHLPN       AAIND-----------------------------------------------------
RS5_CHLAB       VTHD------------------------------------------------------
RS5_CHLCV       VTHD------------------------------------------------------
RS5_RHOBA       LNPDDLIEA-------------------------------------------------
RS5_THEMA       ISVEEVFKGVRRENNA------------------------------------------
RS5_UREPA       KSLREI----------------------------------------------------
RS5_ONYPE       ITLAKKEQ--------------------------------------------------
RS5_PORGI       ISVEKVFKG-------------------------------------------------
RS5_BACFN       ISVEKVFRG-------------------------------------------------
RS5_BACTN       ISVEKVFRG-------------------------------------------------
RS5_DEIRA       TEVRPSLSSDSPAGRSATTEAGEGVADTGGMQ--------------------------
RS5_THET8       EAHAQAQG--------------------------------------------------
RS5_TROW8       LDYYHVVPKRIVRAVNSVGASSDTA---------------------------------
RS5_TROWT       LDYYHVVPKRIVRAVNSVGASSDTA---------------------------------
RS5_BIFLO       LALDEVAPDALLRARAAGIAEARKAREEAAAAKAAEEKDGE-----------------
RS5_LEIXX       LDYDRVAPEKLLQIEARAAEAAAAAKKAGAEKVGA-----------------------
RS5_CORJK       KSLDEVAPAAMLRARAAGQGA-------------------------------------
RS5_CORDI       KTLEEVAPARMLRARAGQEA--------------------------------------
RS5_COREF       KTVEEVAPARILRARAGQEA--------------------------------------
RS5_CORGL       KTIEEVAPARILRARAGQEA--------------------------------------
RS5_NOCFA       LPLEDVAPAGMLRARAQAAGGAR-----------------------------------
RS5_MYCLE       LRSGMLPRSWDPAGVAGERSVDRPVGRVREQA--------------------------
RS5_MYCTU       LPIEDVAPAGMLKARRKSEALAASVLPDRTI---------------------------
RS5_MYCPA       LPIEDVAPAGMLKARRESDALASAAAAREAAAQ-------------------------
RS5_CUTAK       KSVEDIAPAAMLRARKEADEAAAAARMEEKAGVN------------------------
RS5_THEFY       LPLEDVVPAPMLRARAEAKAGV------------------------------------
RS5_STRAW       LPLEDVAPAALLRARAGAGA--------------------------------------
RS5_STRCO       LPLEDVAPAALLRARAGAGA--------------------------------------
RS5_SOLUE       LAVEKL----------------------------------------------------
RS5_AQUAE       LPVEEILRRYRRYALPKMNIKHYYPWRGIYEQT-------------------------
RS5_PELLD       KSLKEVFES-------------------------------------------------
RS5_CHLCH       KSLSDVFES-------------------------------------------------
RS5_CHLTE       KSLKEVFES-------------------------------------------------
RS5_MESFL       KPVIKTEKPKVEETK-------------------------------------------
RS5_MYCCT       KTFDKQKVALVEKTAETKNFEKKPPKSTTKKMASKKIEKEDVIAEPMIKNEAENSAE-
RS5_MYCMS       KTFDTQKVKPVEQKVAEVKGVEKKQPKQAVKKVAVKKAENQENRVEVITNAETESKAE
RS5_BDEBA       ----------------------------------------------------------
RS5_DESPS       KNVEEITA--------------------------------------------------
RS5_CAMJR       ----------------------------------------------------------
RS5_SULDN       ----------------------------------------------------------
RS5_HELPJ       ----------------------------------------------------------
RS5_HELHP       ----------------------------------------------------------
RS5_WOLSU       ----------------------------------------------------------
RS5_DESAG       KKLEAPRK--------------------------------------------------
RS5_DESVH       KKLEAPRK--------------------------------------------------
RS5_PELCD       ADTEE-----------------------------------------------------
RS5_GEOMG       MAE-------------------------------------------------------
RS5_GEOSL       VTE-------------------------------------------------------
RS5_SYMTH       KPVEQILG--------------------------------------------------
RS5_CALS4       IPVHQLFE--------------------------------------------------
RS5_LACAC       QPERA-----------------------------------------------------
RS5_LACJO       ESAKSLED--------------------------------------------------
RS5_CARHZ       KTPAEILKG-------------------------------------------------
RS5_CLOAB       KTVEEILG--------------------------------------------------
RS5_CLOPE       KSVEEIIG--------------------------------------------------
RS5_LACSS       ISVESLQN--------------------------------------------------
RS5_LACPL       VSAEHLAE--------------------------------------------------
RS5_STAS1       KSVEELYN--------------------------------------------------
RS5_STAAW       KTVEELYN--------------------------------------------------
RS5_STAEQ       KSVEELYN--------------------------------------------------
RS5_STAHJ       KSVEELYN--------------------------------------------------
RS5_LISMF       KTVEELLG--------------------------------------------------
RS5_LISIN       KTVEELLG--------------------------------------------------
RS5_OCEIH       KSVEELLG--------------------------------------------------
RS5_GEOKA       KTVEELLG--------------------------------------------------
RS5_BACSK       KSVEELLG--------------------------------------------------
RS5_BACHD       KTVEELLG--------------------------------------------------
RS5_BACHK       KSVEELLG--------------------------------------------------
RS5_BACLD       KSVEELLG--------------------------------------------------
RS5_BACSU       KSVEELLG--------------------------------------------------
RS5_ENTFA       KSVEEIIG--------------------------------------------------
RS5_LACLA       KSVSDFA---------------------------------------------------
RS5_STRR6       ISVSDLA---------------------------------------------------
RS5_STRT1       ISVSDLA---------------------------------------------------
RS5_STRP3       ISVSDLA---------------------------------------------------
RS5_STRA5       ISVSDLA---------------------------------------------------
RS5_STRMU       VSVSDLA---------------------------------------------------