CLUSTAL format seed alignment for MF_01309_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RS3_ACIBT       MGQKVHPIGIRLG-----VVKRHNANWYANPK----QYAEYLLKDLQVREFLTK------
RS3_PSYCK       MGQKVHPIGIRLG-----VVKKHNANWYASPK----QYSEYLINDIQVREYLRK------
RS3_PSEU5       MGQKVHPTGIRLG-----IVKEHTSVWYADGR----TYADYLLADLNVREYLQD------
RS3_SACD2       MGQKVHPTGIRLG-----IVKKHTSTWYAGKA----EYADKLNQDLQVRKYIQN------
RS3_HAHCH       MGQKVNPVGIRLG-----IVKDHNSVWYADKK----NYSDHLLTDIKVREFLMK------
RS3_MARHV       MGHKVNPTGIRLG-----VIKEHNSVWYADKK----DYAKNLLNDIQVREFLDK------
RS3_CHRSD       MGQKVNPTGIRLG-----IVKDHRSVWYAERG----AYADKLNNDLEVRRFLEQ------
RS3_ALCBS       MGQKVHPVGIRLG-----IVKEHNSLWYAGPK----SYSDCLVTDLQVREYLFK------
RS3_BLOFL       MGQKVHPNGMRLG-----IIKSWHSTWYANNK----NFSNNLNNDFEVRKFLLG------
RS3_BLOPB       MGQKVHPNGVRLG-----ITKTWHSTWYANNK----DFSDNLGNDFKVRHFLMQ------
RS3_BUCAP       MGQKVHPNGMRLG-----IIKKWNSVWFANTK----DFADHLDSDYKVRQFLMK------
RS3_BUCBP       MGQKVHPNGMRLG-----IIKHWNSVWFSNSK----DFAKILDSDYQVRLFLRK------
RS3_BUCCC       MGQKVHPNGMRLG-----IIKSWNSIWFASKK----EFSNYLDSDFKVRSYVKK------
RS3_WIGBR       MGQKVNPNGIRLG-----IIKSWSSTWYANTK----EFSKNLISDFKVREFLKK------
RS3_BAUCH       MGQKVHPNGFRLG-----IIKYWNSTWYANKK----EFAQYLNSDFKVRQFLAS------
RS3_ECOLI       MGQKVHPNGIRLG-----IVKPWNSTWFANTK----EFADNLDSDFKVRQYLTK------
RS3_HAES1       MGQKVHPHGIRLG-----IVKPWNSTWFANTQ----DFADNLDGDFKVRQFLNK------
RS3_AERS4       MGQKVHPNGIRLG-----ITKPWNSTWFANTK----DFADNLYSDFQVRQFLTK------
RS3_PHOPR       MGQKVHPNGIRLG-----IVKPWNTTWFANSQ----EFADNLDGDFKVRQFLIK------
RS3_IDILO       MGQKVHPNGIRLG-----ISRPWNATWYANTN----EFADNLHSDFQVRKFLNK------
RS3_PSET1       MGQKVHPTGIRLG-----ISKPWVSTWYASSK----DFSAQLFGDHKVRTFLTK------
RS3_PSEA6       MGQKVHPTGIRLG-----ISKPWTSTWYANTA----DYADNLFNDHQVRQYLTK------
RS3_PSYIN       MGQKVHPNGIRLG-----ITKAFSSTWYAGKK----DFAANLFSDFEIRKFLTE------
RS3_COLP3       MGQKVNPTGIRLG-----ITKPFASTWFASNK----DFASNLDGDHKVREFLKE------
RS3_SHEFN       MGQKVHPNGIRLG-----ITKPWISTWYADKS----DYANNLNSDWEVRQYLTE------
RS3_SHELP       MGQKVHPNGIRLG-----ITKPWISTWYADKS----DYANNLSSDWEVRKFLEK------
RS3_HYDCU       MGQKVHPIGIRLG-----ITKDWNARWYADSK----NYSDFLISDIEIRKELNE------
RS3_AROAE       MGQKIHPTGFRLA-----VTRDWNSRWFASSG----DYSRMLHEDLKVRDFLKK------
RS3_AZOSB       MGQKIHPTGFRLA-----VTRDWGSRWFASSR----DFSKMLHEDLKVRDYLKK------
RS3_DECAR       MGQKIHPTGFRLA-----VTKNWSSRWYANSK----DFPGMLNEDIKVREYLKR------
RS3_NEIG1       MGQKINPTGFRLA-----VTKDWASKWFAKST----DFSTVLKQDIDVRNYLRQ------
RS3_CHRVO       MGQKIHPTGFRLA-----VNKNWSSKWFASSQ----NFPEMLKQDIEVREFLKK------
RS3_BORA1       MGQKIHPTGFRLA-----VTRNWSSRWYADDK----DFGGMLAEDIRVREYLKK------
RS3_METPP       MGQKIHPVGFRLP-----VTRNWSSRWYASNR----NFATMLAEDLKVREYLKA------
RS3_PARXL       MGQKIHPTGFRLA-----VSRNWASRWYANNN----NFAAMLQEDIGVREYLKK------
RS3_RALSO       MGQKIHPTGFRLA-----VSRNWASRWYASNT----QFAGMLKEDIEVREFLKK------
RS3_ACISJ       MGQKIHPTGFRLS-----VSRNWASRWYASNR----DFAGMLAEDIKVREYLKA------
RS3_POLSJ       MGQKINPTGFRLA-----VSRNWASRWYASNR----DFAGMLAEDIKVREYLKA------
RS3_RHOFT       MGQKIHPTGFRLS-----ISRNWASRWYANDR----DFAGMLAEDIKVREYLKA------
RS3_THIDA       MGQKIHPIGFRLG-----VQRIWTAKWYGSNR----NFSDTLLEDIKVRDYLKK------
RS3_NITEC       MGQKINPTGFRLS-----VLKNWSSRWYANTK----KFSVFLNEDINVRQYLQK------
RS3_NITMU       MGQKIHPTGFRLS-----VLKNWSSKWYANGK----SFPGMLNEDIKVREYLKK------
RS3_METFK       MGQKIHPFGFRLS-----VQKNWSSRWYANSN----NFPAMLSSDIKVREFLKK------
RS3_METCA       MGQKVNPTGIRLG-----YIKDWSSRWFADSK----SYPVFLNNDLKVREFLKQ------
RS3_NITOC       MGQKVHPTGIRLG-----IVKDWNSKWYADSG----QFSELLNNDLAVRSYLAK------
RS3_ALKEH       MGHKVHPTGFRLG-----VTEDWRSMWYAGSS----NFGEYLNTDLQVRNFIRK------
RS3_HALHL       MGNKTHPTGFRLG-----VTEDWRSMWYADSS----NFGKYLNTDLEVREFIRE------
RS3_XANOM       MGHKVHPTGIRLG-----ISKDWNSKWYANKG----DFAAYLAADLKVREMLRK------
RS3_XYLFT       MGHKVHPIGIRLG-----ISADWNSKWYANKA----EFARYLAADLKVRQVLRK------
RS3_LEGPL       MGQKVNPIGIRLG-----IIKDWNSKWFAGKR-----YAEFLIQDIKLRSDLKK------
RS3_COXBU       MGQKVNPVGMRIG-----ITRDWTSNWYADKK----DFADRLNEDLNVRQLLQK------
RS3_FRATN       MGQKVNPNGIRLG-----YIRDWRSTWYADSS----SYATKLNEDIKVREFLHK------
RS3_RUTMC       MGQKVNPKGIRLG-----IVKDWDSKWYANSQ----DYSKYLLSDIKVRDYLFD------
RS3_BARQU       MGQKINPIGLRLG-----VNRTWDSRWYADSG----EYGRLLHEDLSIRLYVLE------
RS3_BARBK       MGQKINPIGLRLG-----VNQTWSSRWYADSG----EYGRLLHEDLKIRSYVME------
RS3_BRUME       MGQKINPIGLRLG-----VNRTWDSRWYANTG----EYGKLLHEDVKIREFLTE------
RS3_RHILO       MGQKVNPIGLRLG-----INRTWDSRWFANTG----EYGKLLHEDIKIRKYLEK------
RS3_CHESB       MGQKVNPIGLRLG-----INRTWDSRWFANTN----EYGQLLHEDLKIRTYIEN------
RS3_AGRFC       MGQKINPIGFRLG-----INRTWDSRWYADTA----EYGKLLHEDLKIRAYLIK------
RS3_NITHX       MGQKINPIGLRLG-----INRTWDSRWYAGKN----EYGRLLHEDVRIRELLHK------
RS3_RHORT       MGQKVNPIGLRLG-----INRTWDSRWFAG-R----DYASLLHQDLAIKKYLKS------
RS3_MAGSA       MGQKVNPIGLRVG-----INRTWDSRWFAD-E----TYAKLLHQDLKLRKYLRE------
RS3_GRABC       MGHKVNPIGLRLG-----INRTWDSRWYAG-G----DYSRLLHDDLKLRGHLRK------
RS3_CAUVC       MGQKVNPVGLRLG-----INRTWDSRWFADGN----QYGKLLHQDLAVRAALKK------
RS3_RHOS1       MGQKVNPIGMRLQ-----VNRTWDSRWFAESK----DYGNLLLEDLKMREFIHD------
RS3_PARDP       MGQKVNPIGMRLQ-----VNRTWDSRWYADDK----DYGNLLLEDLKIRDFIKK------
RS3_ROSDO       MGNKVNPIGMRLQ-----VNRTWDSRWYADTK----DYGDLLLEDLAIRDFIKK------
RS3_JANSC       MGHKVNPIGMRLQ-----VNRTWDSRWYADTK----DYGDLLLEDIKIRDYIKKGWWEHV
RS3_ZYMMO       MGHKSNPIGMRLQ-----INRTWDSRWFAQGG----DYGQLLLEDIKIRKFIMK------
RS3_SPHAL       MGQKSNPIGLRLQ-----VNRTWDSRWFAEGE----DYGRMLVEDLKIRQYVFK------
RS3_ERYLH       MGQKSNPIGLRLQ-----INRTWDSRWYAEGN----AYAKLLAEDIEIRKYILE------
RS3_NOVAD       MGHKSNPIGLRLQ-----INRTWDSRWYAEGR----NYAQMLEEDLKIRKYIVE------
RS3_HYPNA       MGQKVNPIGLRLG-----INRTADSRWYADSA----DFGRLLHEDISIRKAIRE------
RS3_MARMM       MGQKVNPIGLRLG-----VNRTWESRWYAGAG----EYAKLLHEDIKIRKMLKE------
RS3_MAGMM       MGQKVHPTGFRLG-----TTKTWDTRWFAD-R----NYADLLLEDIKIRAWLKK------
RS3_DESVV       MGQKVHPFGFRLG-----YNKNWQSRWYSK-K----EYPAFVFEDHNIRKFVKK------
RS3_DESAG       MGQKVHPFGFRLG-----YNKNWQSRWFSK-K----EYASFVFEDHNIRKYVKK------
RS3_LAWIP       MGQKVHPYGFRLG-----YNKNWQSRWFSK-K----DYANFIYEDYKIRSYIKK------
RS3_SYNFM       MGQKVHPTGFRLG-----ILKSWDSRWFAT-K----DYAKLVHEDRKIRDYIKA------
RS3_GEOSL       MGQKVNPVGFRLG-----VIRTWDSRWYAE-A----DYSKLLHEDLKLRNFLKK------
RS3_PELPD       MGQKVNPIGFRLG-----VIKSWDSKWYAE-A----DYAKLLHEDLKIRAFLKK------
RS3_PELCD       MGQKVHPIGFRLG-----VVKTWSSRWYAE-G----EYSQLLHEDIKLRNYLKK------
RS3_SYNAS       MGQKVNPIGLRLG-----INKNWNSRWYAD-K----SYRSMLYEDLKIRGYLKK------
RS3_ANADE       MGQKVHPIGFRLG-----VIRSWDSKWYEE-K----NYAKWLHEDIKLREFVKE------
RS3_MYXXD       MGQKVHPIGFRLG-----VIKTWDSKWFEH-K----NYAQWLHEDIRIREFVKK------
RS3_DESPS       MGQKVNPLGIRLN-----ITRTWDSVWYAD-K----DYSTFLIEDQKIRKFLKK------
RS3_CAMJR       MGQKVNPIGLRLG-----INRNWESRWFPTKA----NLVENIGEDYKIRAFLKR------
RS3_CAMFF       MGQKVNPIGLRLG-----INRNWESRWFPSKA----TLPENIGEDYKIRKFLKT------
RS3_SULDN       MGQKVNPIGLRLG-----INRNWESRWFPNFK----TAAAYLGEDHKIRTYLKK------
RS3_HELHP       MGQKVNPIGLRLG-----INRNWSSRWFSVSQ----TTPSNILEDHKIRKFLKR------
RS3_WOLSU       MGQKVNPIGLRLG-----INRNWASRWFPNYQ----TAPLNISEDHKIRKFLKK------
RS3_HELPY       MGQKVNPVGLRLG-----INRNWTSRWFPSAR----TAPSNIDEDNKIRKFLKK------
RS3_BDEBA       MGQKVNPIGLRVG-----VIRTWDSRWYAKGQ----QYYENLHEDIRLRKFLKD------
RS3_CLOD6       MGQKVNPHGLRVG-----VIKDWDSRWFATDKK---EFGNLLLEDHNIRKFLKK------
RS3_CARHZ       MGQKVHPKGLRIG-----IIKDWDAKWFADKK----HYQELLHEDLKIRKYIKT------
RS3_CALS4       MGQKVHPYGLRVG-----VTKDWLAKWYAKDK----DFPNILVEDIKIRNYIKE------
RS3_CLOPE       MGQKVHPHGLRVG-----VIKDWDAKWYADKK----NFADNLIEDQQIRKFIKK------
RS3_CLONN       MGQKVHPHGLRVG-----VIKDWDAKWYANSQ----NFADNLIEDDKIRKFVKK------
RS3_CLOTE       MGQKVHPHGLRVG-----VIKDWDAKWYADKK----NFSDNLVEDNNIRNFVKK------
RS3_CLOAB       MGQKVNPHGLRVG-----VIKEWNAKWYANSK----NFSSYLVQDNKIRKFVKN------
RS3_ACET2       MGQKVNPHGLRIG-----IIKDWDTKWYANDK----NFSEYLVEDFKIRKFIKN------
RS3_SYMTH       MGQKVHPKGLRIG-----IVKDWDTRWYADKR----NFSDLLVEDVKIRKYIKK------
RS3_DESHY       MGQKVNPKGLRVG-----IIRDWEGRWFAD-K----NYLELLHEDLKVRKFVKT------
RS3_MOOTA       MGQKVHPKGLRLG-----IIRDWDSRWYAG-K----EYKTLLHEDLKIREFIKK------
RS3_SYNWW       MGQKVHPKGFRIG-----IIRDWDSNWYAD-R----DYSELLHEDVKLRKFIKD------
RS3_KORVE       MGQKVHPYGFRLG-----YTKPWKSRWFIERD-----YDKLLLEDVKLKAELKE------
RS3_SOLUE       MGQKVHPYGFRLG-----FNKPWRSRWFAKQG-----YAKLLQEDLELKAALRE------
RS3_THEMA       MGQKVHPRGFRLG-----LSADWQAKWFNEKN-----YKEWLLEDEEIRKIIKN------
RS3_RICBR       MGQKVCAHGFRVGP---TLIKGWDSVFYAEKQ-----YKTLFIQDLKIRELVNK------
RS3_ANAPZ       MGQKSNPIGLRLK----IVG-TWDSLWYANR-----DYATKLHEDLLLRSFVKK------
RS3_EHRRW       MGQKSNPIGLRLK----IIN-TWDSLWYANK-----DYTTKLHEDFLLRKFIKK------
RS3_WOLPM       MG-NVNPKGFRLK----IIN-TWSSIWYAEK-----GYKQGLHQDLSIRSYINE------
RS3_WOLTR       MGQKVNPIGFRLK----INNNTWDSVWYANK-----DYKEKLHQDLFIRSYINE------
RS3_PELUB       MGQKVNPVGFRLG----VNR-GWDSVWYAKKK----DFGNYLIEDFKIRAYIKK------
RS3_TREDE       MGQKVNPTGLRLG-----INKTWSSRWYAGPR----NYADLLLEDLKIRAMIQEIP----
RS3_TREPA       MGQKVSPIGLRLG-----INKVWSSRWYAGPR----EYAALLHEDLRIRSMIRSFP----
RS3_BORBU       MGQKVHPYSLRVK-----INKDWKSKWYFDKK----LYSAILHEDFLIRREIMKFL----
RS3_LEPBL       MGQKVNPIGLRIG-----ITRGWDSIWFS-QS----DYKKNLHEDIKIRKFIQS------
RS3_BACTN       MGQKVNPISNRLGI-----IRGWDSNWYGGN-----DYGDSLLEDSKIRKYLNARLA---
RS3_PORGI       MGQKINPVSNRLGI-----IRGWDSNWYGGR-----KYGETLLEDSRIRQYLNARLA---
RS3_GRAFK       MGQKTNPIGNRLGI-----IRGWESNWYGGN-----DYGDKLAEDDKIRKYIHARLS---
RS3_CYTH3       MGQKVNPIGFRLGV-----VKGWESNWYGGK-----TFADKLVEDEQIRKYVLARIP---
RS3_SALRD       MGQKTHPIGFRLGA-----IRGWDSNWYSET-----NFQDKLVEDEELRRYLHTRLK---
RS3_CHLPD       MGQKVNPNGFRLGI-----IRDWTSRWYDDSP----VIAEKIKQDHVIRNYVQARLKR--
RS3_CHLL3       MGQKVNPTGFRLGI-----IKDWTSRWYDDSP----VISGKIKEDHVIRNYVQTRLKR--
RS3_CHLTE       MGQKVNPTGFRLGI-----IKDWTSRWYDDGP----VIAEKIKQDQVIRNYVHARLKK--
RS3_TROWT       MGQKINPYGLRLGI-----TTDHVSHWYSDSTRPGQRYADYVSEDIKIRSYLTKTLDR--
RS3_LEIXX       MGQKVNPYGFRLGI-----TTDHVSRWFSDSTKKGQRYSDYLAEDVKIRTLLKTSLDR--
RS3_ARTS2       MGQKVNPHGFRLGI-----TTDHVSHWFADSTKAGQRYKDFVREDIRIRQLMSTGMER--
RS3_BIFAA       MGQKINPFGYRLGI-----TENHRSKWFSDSNKVGERYRDFVLEDDAIRKAMSKDLER--
RS3_CORDI       MGQKIHPHGLRLGI-----TSDWKSHWYAD-----KNYAEYLAEDIRVREYLVKTLDR--
RS3_CORJK       MGQKIHPHGLRLGI-----TSEWRSRWYAD-----KQYADYLAEDIKIRDFLSEGLDR--
RS3_MYCVP       MGQKINPHGFRLGI-----TTEWKSRWYAD-----KQYADYIKEDVAIRKLLATGLER--
RS3_RHOJR       MGQKINPHGFRLGI-----TTDWKSRWYAD-----KQYAEYVKEDVAIRKLLATGMER--
RS3_MYCLE       MGQKINPHGFRLGI-----TTGWKSRWYAD-----KQYAEYVKEDVAIRRLLSTGLER--
RS3_SACEN       MGQKINPHGFRLGI-----TTDWKSRWYAD-----KQYSEYVAEDVKIRRRLSRGMER--
RS3_THEFY       MGQKVNPHGFRLGV-----TTDFKSRWFAD-----KLYKDYVKEDVAIRQMLTRGMER--
RS3_FRACC       MGQKVNPHGFRLGI-----TSEFTSRWYAD-----KQYKAYVGEDVKIRKMMSRGMER--
RS3_STRCO       MGQKVNPHGFRLGI-----TTDFKSRWYAD-----KLYKDYVKEDVAIRRMLTSGMER--
RS3_ACIC1       MGQKVNPHGFRLGI-----TTEFSSRWYAD-----RMYRDYVKEDVAIRRMMTRGMER--
RS3_NOCSJ       MGQKINPNGFRLGI-----STDHKSRWYAD-----KLYKSYVGEDVAIRKLLSKGMER--
RS3_CUTAK       MGQKINPHGFRLGV-----TTDHKTRWYAE-----KQYAELVGEDVKIREWLHKNLER--
RS3_RUBXD       MGQKVHPEGFRLGVRRKGEKVDFKSQWYSD-----RDFAELLGEDLKIREHIERKLAR--
RS3_RHOBA       MGQKVNPIAFRTGV-----TRGWGSRWYASK----QDFADLLVEDRKIREFITKHPKKS-
RS3_CHLMU       MGQKGCPVGFRTAV-----TKKWRSLWYGNN----QEFGKFLIEDVRIREFLKKKPSC--
RS3_CHLPN       MGQKGCPIGFRTGV-----TKKWRSLWYGNK----QEFGKFLIEDVRIRQFLRKKPSC--
RS3_PARUW       MGQKVNPISFRLVR-----TRDWRSKWFANK----KEFGDLLVEDQIIRAYLLKKPAL--
RS3_DEHMC       MGRKVHPIGFRLG-----IIKDWSAKWHASDK----NFAECLTEDLKLRKAISK------
RS3_AQUAE       MGQKTHPIGFRLG-----VIKEWPSKWYAPKK----EYSKLLHEDLKIKNYIKE------
RS3_DEIGD       MGNKINPNGFRLG-----ITKGWNSRWYAGKK----QYSQLLKEDEKIRKLVSQ------
RS3_THET8       MGNKIHPIGFRLG-----ITRDWESRWYAGKK----QYRHLLLEDQRIRGLLEK------
RS3_BACCZ       MGQKVNPIGLRVG-----VIRDWESRWFAEK-----DYATLLHEDIKIREYINV------
RS3_ALKHC       MGQKVNPVGLRVG-----VIRDWESKWYAEK-----DYADLLHEDIKIREYIEN------
RS3_BACSU       MGQKVNPVGLRIG-----VIRDWESKWYAGK-----DYADFLHEDLKIREYISK------
RS3_LISW6       MGQKVHPIGMRIG-----VIRDWDSKWYAEK-----DYADFLHEDLRIRDYVAK------
RS3_GEOTN       MGQKVNPIGLRIG-----IIRDWESRWYAEK-----DYADLLHEDLKVREYINK------
RS3_OCEIH       MGQKINPTGLRVG-----IIKDWESKWYAGK-----DYADLLHEDIKIREYLEN------
RS3_STAS1       MGQKINPIGLRVG-----VIRDWEAKWYAEK-----DFASLLHEDLKIRKYIDN------
RS3_LACLA       MGQKVHPIGMRVG-----VIRDWDAKWYAEK-----EYSDYLHEDLAIRQLIQT------
RS3_STRS2       MGQKVHPIGMRVG-----IIRDWDAKWYAEK-----EYADYLHEDLAIRNFIKK------
RS3_ENTFA       MGQKVHPIGMRVG-----IIRDWDAKWYAEK-----EYAEFLHEDLRIRKFIAT------
RS3_LEVBA       MGQKVNPTGLRVG-----IIRDWEAKWYAEK-----DFAAYLKEDLQIRKFIEK------
RS3_PEDPA       MGQKVNPNGFRVG-----VIRDWQAKWYADK-----DFSKFLAEDIKIREFIAK------
RS3_LACS1       MGQKVNPTGLRVG-----IIRDWDAKWYAEK-----DFASNLHEDLRIRKYIES------
RS3_LACSS       MGQKINPTGFRVG-----VIRDWDAKWYAEK-----DFATFLHEDLKIRKYINT------
RS3_LACP3       MGQKINPTGFRVG-----VIRDWDAKWYADK-----DFAAFLHEDIEIRNFINK------
RS3_LACGA       MGQKINPNGFRLG-----VNRDWEAKWYADK-----NYADTLNEDLRIRKFISE------
RS3_LACAC       MGQKINPNGFRLG-----VIRDWESKWYADK-----GYKETLKEDLQIRKFISE------
RS3_LACDB       MGSKINPIGFRLG-----VNRDWEAKWYAAR-----GYKETLNEDLRIRKFLDE------
RS3_LEUMM       MGQKINPTGFRVG-----VIRDWDAKWFADKA----DYANQLHEDLRIRKYIEK------
RS3_OENOB       MGQKINPIGFRVG-----VIRDWDAKWYADKK----EYVPALQEDLRIRKYLET------
RS3_FUSNN       MGQKVDPRGLRLG-----ITRAWDSNWYADKK----EYVKYFHEDVQIKEFIKK------
RS3_NEOSM       MGQKVNPVGFRLW-----THGSHGSVWYSKSC----DYAKTVAEDYFVTKYVES------
RS3_MYCMS       MGQKVSPNVLRLG-----IVRDWENRWYAE-KD---QYVKWLDQDIKIRTALFK------
RS3_MESFL       MGQKVSPNVLRLG-----IVRDWEDTWYAE-KD---QYVKWLDQDIKIREGVLK------
RS3_MYCMO       MGQKVNPNGFRYG-----VTKKHNTLWYAD-KK---DFADILLQDDKIYRFFNK------
RS3_MYCPU       MGQKVNPNGFRYG-----ITKQHNAIWYAE-KK---DFSKFLLEDQKIHQFFEK------
RS3_MYCS5       MGQKVNPNGFRYG-----VTKAHNTTWFAH-KA---TYGSKLVEDVKIYKFFDK------
RS3_MYCH7       MGQKVNPNGFRFG-----ITRNHNAIWYAD-KN---KFSINLLEDVKIHRFFEK------
RS3_MYCGE       MGQKVNSNGLRFG-----INKNWISRWTASSNQ---QTATWLVQDEKIRNLFFI------
RS3_MYCPN       MGQKVNSNGLRFG-----INKNWISRWTANSHA---QTAKWLIEDEKIRNLFFV------
RS3_MYCGA       MGQKVNSNGLRFG-----INKNWQSRWVAKTNQ---QTGDWIVQDEKIRNYLFK------
RS3_UREPA       MGQKVNPNGLRFG-----INKQWLSRWVPTDQL---QMAKWLVEDDKIRKYLST------
RS3_AYWBP       MGQKTNPNGLRLG-----IIRTWESQWCVNDK----EIPNLIKEDFLIRKLINN------
RS3_TRIV2       MGQKIHPVGFRLG-----ITQEHQSRWFAEPS----RYPELLQEDHKLRQYIEQKLGRL-
RS3_TRIEI       MGQKIHPTGFRLG-----ITQEHRSRWYADPK----NYPDTLQEDHKIRQYVKATLA---
RS3_SYNE7       MGQKINPVGFRLG-----VTQEHRSRWFADPN----RYPQLLQEDKKIRDYVRKNLS---
RS3_SYNY3       MGQKIHPVGFRLG-----ITKDHKSCWYADPK----RYPELLQEDHKIRQYIEKTLN---
RR3_CYAPA       MGQKIHPIGFRLG-----ITQKHRSCWFANPK----QYPTLLQEDHLIRQYIEKNLS---
RS3_THEEB       MGQKIHPIGFRLG-----ITQDHRSRWYADSD----RYPELLQEDHRIRTFINQQLA---
RS3_SYNJA       MGQKIHPTGFRLG-----VIKEHRSRWFADPA----RYPALLREDDLIRAYLTKQLS---
RS3_GLOVI       MGQKVHPIGLRLG-----IIRDHRSRWFAKAG----EYPALLAEDHKIRAYIVKKLA---
RS3_PROMA       MGHKIHPNGLRLG-----ITQEHRSRWYASSK----TYPLLLQEDDRIRVFIQKKYG---
RS3_PROM5       MGNKINPTGLRLG-----ITQEHRSKWFATSK----TYPILLQEDYKIRNFIQKKYS---
RS3_SYNS3       MGHKIHPTGLRLG-----ITQEHRSRWYASSK----SYPALLQEDDRIRKFIHKKYG---
RR3_TRICV       MGQKTHPLGFRLG-----ITQEHRSAWYANFN----QYANLLKEDNQIRTYLNKLAK---
RR3_THAPS       MGQKTHPLGFRLG-----ITQEHRSAWYADFK----HYSTLLEEDDKIRTYLNKLAK---
RR3_PHATC       MGQKTHPLGFRLG-----ITQEHKSTWYANFN----QYANILKEDDKIRTYIHTISK---
RR3_PORPU       MGQKIHPLGFRIG-----ITQKHRSSWFASSK----DYSVLLQEDHKIRSFIHGKLS---
RR3_PYRYE       MGQKIHPLGFRIG-----ITQKHRSSWFANSK----DYPVLLQEDHKIRSFIHSKLS---
RR3_GRATL       MGQKTHPLGFRIG-----ITRDHKSSWFSNMK----SYPKLAQEDYKIRSCIEKQLH---
RR3_GUITH       MGQKVNPLGFRLR-----ITSQHRSSWFATKE----SYPQLLEQDFKIRSYINRELE---
RR3_CYACA       MGQKINPLSFRLG-----INKLHHSSWFARPQ----SYTAILQEDKKIRDYIFTNLL---
RR3_EMIHU       MGQKTHPTGFRIG-----INKSHDSTWFANYG----TYGEILKEDYKIRKFFENDWGT--
RR3_CYAM1       MGQKTHPVGFRLG-----ITHTHQSHWFAH------QYSKILQEDHAIRQLLRD------
RR3_OLTVI       MGQKVHPLGFRLG-----VTQKHRSQWFAKPQ----EYSQLVLEDHFLREELNKRFP---
RR3_TUPAK       MGQKIHPLGFRLG-----ITQEHRSKWYAKAS----DYPRLVLEDKKLRDNLFKQYP---
RR3_CHLVU       MGQKVHPIGFRLG-----ITQKHRSYWCTTPQ----KSALWIQDASFLRNFIKKKYI---
RR3_MESVI       MGQKIHPLGFRLG-----VTQEHRAHWFAKPS----EYKFLVEEDNYIRKYLNAKLA---
RR3_CHLAT       MGQKIHPLGFRLG-----ITQDHRSHWFAKPA----QYRQLLQEDNSIRNFLRTKLI---
RR3_NEPOL       MGQKIHPLGFRLG-----ITQQHRSTWFAPRK----LYVSWIHEERQLRDYLKTRLA---
RR3_OSTTA       MGQKVHPIGFRIG-----VTQTHRSQWFAKPK----DYAKLVEEDLLIREFAESRLP---
RR3_EUGGR       MGQKVHPLGFRLG-----ITKSHSSFWYVERR----HYASFVKEDIVIRNFMNK------
RR3_CALFG       MGQKINPLGFRLG-----ENQSHHSLWFAQP----KSYCRGLQEDEKIRDCIKIYVQKNM
RR3_PHAAO       MGQKINPLGFRLG-----TTQSHHSFWFAKP----KNFSIGLQEDERIRNCIKDYVKKNK
RR3_ACOCL       MGQKINPLGFRLG-----ATQSHLSLWFAQP----KSYSMGLQEDEKIRECIKNYVQKNP
RR3_NUPAD       MGQKINPLGFRLG-----TTQSHRSFWFAQP----KNYSKGLQEDEKIRDCIKNYVQKHM
RR3_AMBTC       MGQKINPLGFRLG-----TTQSHRSLWFAQP----KDYSRNLQEDEKIRDCIKNYVQKHM
RR3_PIPCE       MGKKINPLGFRLG-----ANQSHRSIWFAQS----KSYSRGLQEDEKIRDCIQHYVEKNT
RR3_CITSI       MGQKINPLGFRLG-----TTQSHHSLWFAKP----KNYCEGLQEDQKIRNFIKNYIKKNI
RR3_EUCGG       MGQKINPLGFRLG-----TTQGHHSIWFAQA----KNYSDGLQEDQKIRNCIKNYLQKNM
RR3_GOSHI       MGQKINPLGFRLG-----TTQSHHSLWFAQP----KKYSEGLQEDKKIRDCIKNYVQKNT
RR3_CUCSA       MGQKINPLGFRLG-----ATQGHHSLWFAHP----KKYSEGLQEDQKIRDCIQNYVQKNM
RR3_MORIN       MGQKINPLGFRLG-----ATQGHHSLWFAQP----KNYSEDLQEDQKIRDCIKNYIKKNM
RR3_DAUCA       MGQKINPLGFRLG-----TTQSHHSLWFTQP----KNYSEGLQEDQKIRDFIKNYVQKNL
RR3_COFAR       MGQKINPLGFRLG-----TTQGHHSLWFTQA----KNYSEGLQEDQQIRNCIKNYVQKNT
RR3_PLAOC       MGQKINPLGFRLG-----TTQNHHSVWFAQP----KSYSEGLQEDQKIRDCIKNYVQKNK
RR3_SPIOL       MGQKINPLGFRLG-----TTQSHYSLWFSQP----KNYAEGLQEDQKIRDCIKNYVQKNT
RR3_RANMC       MGQKINPLGFRLG-----TTQSHHSVWFAQP----KNYSGGLQEDKKIKDCIKNYVQKNR
RR3_POPTR       MGQKINPLGFRLG-----TTQDHYSLWFAQP----KNFFEGLQEDQKIRNCIKNYVQKNM
RR3_PHAVU       MGQKINPLGFRLG-----TTQSHDSIWFAQP----TKYSENIQEDKKIRDWIKNYIQKNI
RR3_LOTJA       MGQKINPLGFRLG-----TTQSHDSIWFAQP----TNYSENLKEDKKIRDCIKTYIQKTI
RR3_OENEH       MAQKINPLGFRLG-----TTQSHHSIWFAQP----KDYSDGLQEDQKIRDCIQNYIQKNM
RR3_JASNU       MGQKINPLGFRLG-----TTQGHHSLWISQP----KNYSKGLKEDQNIRDFIQNYIQKNM
RR3_EPIVI       MGQKINPLGFRLG-----TTQSHHSFWFAQP----KNYYKGIQEDQKIRDFIKNYVKNNI
RR3_MAIZE       MGQKINPLGFRLG-----TTQNHHSFWFAQP----KNYSEGLQEDKKIRNCIKNYIQKNR
RR3_PELHO       MGQKINPLGFRLG-----TTQTHHSIWFEKR----KDYSEGLQEDHKIREHIQNYIEK-E
RR3_ANTAG       MGQKINPLGFRLG-----VTQNHCSHWFAKP----NNYYKLLEEDEKMRNCIYNYVRKHI
RR3_PHYPA       MGQKINPLGFRLG-----VTQNHHSYWFAQP----KNYSKLLQEDQKMRNCIENYVYKNI
RR3_MARPO       MGQKINPLGFRLG-----ITQNHRSYWFAN-----KKYSKVFEEDKKIRDCIELYVQKHI
RR3_HUPLU       MGQKINPLGFRLG-----ITKNHNSHWFAKP----NNYSEFLQEDRKVRNCIDNYVHRHV
RR3_PINTH       MAQKINPLGFRLG-----VTQNERSHWFAQQ----RNYSKDLREDQKIRTCIENYVRTHI
RR3_ADICA       MGRKIHPLGFRLG-----VSQKHYSYWFAQK----KDYPKFLEEDRKIRNLVEKYIQKHV
RR3_PSINU       MGQKIHPLGFRLG-----TTQNHCSYWFAQSK---KIYSKLVKEDKEIRNCIEKYVQKHT
RR3_STAPU       MGQKIHPLGFRLG-----VTQSHLSNWCVQP----SQYSELLQEDEKLRGCIKEYVRKYV
RR3_ZYGCR       MGQKIHPLGFRLG-----VTQNHHSTWFAPL----NNYSELLKEDERIRNCIQQYVRKYV
RR3_CHAVU       MGQKIHPLGFRLG-----FIQEHYSHWFAKA----NSYSELLQEDKEIRSCIYNHIRNHV
RR3_CHAGL       MGQKVNPLGFRLG-----VTQEHHSYWFATN----KQFAGFLEEDQKIRHYIYQYVQKHI
RR3_EUGLO       MGQKTNPNGLRFG-----KFKKHFSCWYTENK----NYSHFVKQDIFIRKFLME------
RR3_BIGNA       MGQKVHPLGFRVG-----LNGNYKSKWFVKPK----DYSLLLFQDYLIRKNIFNYFNILN
RS3_CARRP       MGKKINPILFRLK-----KNTVYHSLWYTFKK----NFCYYLKCDILIREIIRR------
RR3_HELSJ       MDFISKTIGLRLG-----YNKTHKLIWSLSKN-----NPIFIQTNHFLEYIIKNDP----
                *     .   *               :                    :            

RS3_ACIBT       ------------KLKNAMVSNILIERP-SGA----------AKVTIST-ARPGIVIG---
RS3_PSYCK       ------------KLDSAMISKIMIERP-TGA----------AKITIAT-ARPGIVIG---
RS3_PSEU5       ------------KLKSASVSRIDIHRP-AQT----------ARITIHT-ARPGIVIG---
RS3_SACD2       ------------ALAHASVSRIDIERP-ANT----------ARVTIHT-ARPGIVIG---
RS3_HAHCH       ------------KLEKASVSKVIIERP-PQN----------AKITIHT-ARPGIVIG---
RS3_MARHV       ------------RLVKASVSKIVIERP-AQN----------ARITIHT-ARPGIVIG---
RS3_CHRSD       ------------RLKNASVSDITIERP-ANN----------ARITIHT-ARPGIVIG---
RS3_ALCBS       ------------RLKSASVSRIKIERP-SEN----------VRITIAT-ARPGIVIG---
RS3_BLOFL       ------------QLSKALVSRIIIERP-AKS----------IRVTIYT-ARPGVIIG---
RS3_BLOPB       ------------KLSKALVSRIIIERP-AKS----------IRVTVYT-ARPGLIIG---
RS3_BUCAP       ------------KLVKASVSRIIIERP-AKS----------IRVTIYT-ARPGIVIG---
RS3_BUCBP       ------------ELFKASVSRIVIERP-SKS----------IRVTIYS-ARPGIVIG---
RS3_BUCCC       ------------KLIKASVSKVIIERL-SKN----------IRVTIYT-ARPGIVIG---
RS3_WIGBR       ------------SLSKAYVSKLIIERP-AKS----------IRINIYT-ARPGIVIG---
RS3_BAUCH       ------------ELTKASISRVVIERP-AKS----------IRITIHT-ARPGIIIG---
RS3_ECOLI       ------------ELAKASVSRIVIERP-AKS----------IRVTIHT-ARPGIVIG---
RS3_HAES1       ------------ELANASVSRITIERP-AKS----------IRVTIHT-ARPGIVIG---
RS3_AERS4       ------------ELKNASLSKITIERP-AKS----------IRVTIHT-ARPGVVIG---
RS3_PHOPR       ------------ELKKASLSRVVIERP-AKS----------IRVTIHT-ARPGIVIG---
RS3_IDILO       ------------ELRNASVSRIVIDRP-AKS----------VRVTIHT-ARPGVVIG---
RS3_PSET1       ------------ELKTASVSKIVIERP-AKS----------IRVTIHT-ARPGVVIG---
RS3_PSEA6       ------------ALKTASLSKIVIERP-AKS----------IRVTIHT-ARPGVVIG---
RS3_PSYIN       ------------KLKNASLSKITIERP-AKS----------VRVTIHT-ARPGVVIG---
RS3_COLP3       ------------KLKRASLSKVVIERP-AKS----------IRVTIHT-ARPGVVIG---
RS3_SHEFN       ------------KLKAASVSKIVIERP-AKS----------IRVTIHT-ARPGIVIG---
RS3_SHELP       ------------KLKQASVSKIVIERP-AKS----------VRVTIHT-ARPGVVIG---
RS3_HYDCU       ------------KLKHASVSQINIERV-ANG----------VRVTIHT-ARPGVVIG---
RS3_AROAE       ------------RLAHASVGRVVIERP-AKN----------ARITLFS-ARPGVVIG---
RS3_AZOSB       ------------RLAHASVGRVVIERP-AKN----------ARVTLFS-ARPGVVIG---
RS3_DECAR       ------------KLAHASVGRVLIERP-AKN----------ARVTVYS-ARPGVVIG---
RS3_NEIG1       ------------KLANASVGRVIIERP-AKS----------ARITIHS-ARPGVVIG---
RS3_CHRVO       ------------RLGHASVGRVTIERP-AKS----------ARITIHS-ARPGVVIG---
RS3_BORA1       ------------KLKSASVGRVVIERP-AKN----------ARITVYS-ARPGVVIG---
RS3_METPP       ------------KLKSAAVSRILIERP-AKN----------ARITIYS-ARPGVVIG---
RS3_PARXL       ------------KLKNASVGRVVIERP-AKN----------ARITIYS-SRPGVVIG---
RS3_RALSO       ------------KLKNASVGRVVIERP-AKN----------ARITIYS-SRPGVVIG---
RS3_ACISJ       ------------KLKNAAVSRILIERP-AKN----------ARITIFS-ARPGVVIG---
RS3_POLSJ       ------------KLKNAAVSRVLIERP-AKN----------ARITIFS-ARPGVVIG---
RS3_RHOFT       ------------KLKNASVSRVLIERP-AKN----------ARITIFS-ARPGVVIG---
RS3_THIDA       ------------KLSHASVSKVLIERP-AKN----------ARITIFS-GRPGVVIG---
RS3_NITEC       ------------RLAHASVGSIIIERP-SRN----------AKITIHT-SRPGVVIG---
RS3_NITMU       ------------KLAHASVGRVVIERP-SKN----------ARITIYS-SRPGVVIG---
RS3_METFK       ------------KLAHAAVSKIVIERP-AKN----------AKITIYS-ARPGIVIG---
RS3_METCA       ------------KLKHASVSRIQINRL-ANN----------AQITIHT-ARPGIVIG---
RS3_NITOC       ------------KLSHALVSNIQIDRP-ARN----------ARITIHT-ARPGIVIG---
RS3_ALKEH       ------------KLAHASVSRIRIERP-AKN----------ALVTIHT-ARPGIVIG---
RS3_HALHL       ------------RLKNASVSRIQIERP-AKN----------ALVTIHT-ARPGIVIG---
RS3_XANOM       ------------KLAQAGVSKILIERP-AKT----------ARVTIHT-ARPGVVIG---
RS3_XYLFT       ------------KMSQAGISKILIERP-SNT----------ACVSMHV-ARPGVVIG---
RS3_LEGPL       ------------KLMAAAVSKILIERP-ANN----------AVVTILT-ARPGVIIG---
RS3_COXBU       ------------RLKGAAVSRIQIERP-ARN----------AKIIIHS-ARPGVIIG---
RS3_FRATN       ------------KLAAAAVSKIQIERP-AQN----------AKITIHT-ARPGIVIG---
RS3_RUTMC       ------------KLTNASVSRIQIERL-ANN----------AKITIHT-ARPGIIIG---
RS3_BARQU       ------------ELKQAAISKVIIERP-HKK----------CRVTIYS-ARPGLIIG---
RS3_BARBK       ------------ELKQAAISKVIIERP-HKK----------CRVTIHS-ARPGLIIG---
RS3_BRUME       ------------ELKQAAISKIVIERP-HKK----------CRVTIHS-ARPGIIIG---
RS3_RHILO       ------------ELKQAAISKVVIERP-HKK----------CRVTIHA-ARPGLIIG---
RS3_CHESB       ------------ELKQAAISKVVIERP-HKK----------CRVTIHS-ARPGLIIG---
RS3_AGRFC       ------------ELKQAGIAKVVIERP-HKK----------CRVTIHS-ARPGLIIG---
RS3_NITHX       ------------ELKQAAVARIVIERP-HKK----------CRVTIHS-ARPGVVIG---
RS3_RHORT       ------------KLAQAGVSRIVIERP-AKK----------ARITIHT-ARPGVVIG---
RS3_MAGSA       ------------KLAQAGVSRVVIERP-AKK----------ARITIHT-ARPGVVIG---
RS3_GRABC       ------------KLSGAGVSRVVIERP-AKK----------PRVTIYA-ARPGVVIG---
RS3_CAUVC       ------------RLYQAGVSRIIIERP-HKK----------CRVTIYA-ARPGVIIG---
RS3_RHOS1       ------------YAKQAGVSKVIIERP-HRK----------CRVTIHT-ARPGVIIG---
RS3_PARDP       ------------EAKQAGVSRVVIERP-HKK----------CRVTIYA-ARPGVIIG---
RS3_ROSDO       ------------ECHQAGVARVIIERP-HKK----------CRVTIHT-ARPGVIIG---
RS3_JANSC       A------KRDKRPAGDAGISKIIIERP-HKK----------CRVTIHS-ARPGVIIG---
RS3_ZYMMO       ------------TLPQAAISKVVIERP-AKL----------CRISIYA-ARPGVIIG---
RS3_SPHAL       ------------ALPQAAISKVVIERP-AKL----------CRVSIYA-ARPGVIIG---
RS3_ERYLH       ------------TAAQAAISKVVIERP-AKL----------CRISIYA-ARPGVIIG---
RS3_NOVAD       ------------NLPQAAISKVVIERP-AKL----------CRVSIYA-ARPGVIIG---
RS3_HYPNA       ------------KLKQAGISKIIIERP-HKK----------CLITIHT-ARPGLVIG---
RS3_MARMM       ------------RLKNASVSKIVIERP-HKK----------CRVTVHT-ARPGVVIG---
RS3_MAGMM       ------------RLAHASVSKIVIERP-AQK----------ARINIHT-ARPGIIIG---
RS3_DESVV       ------------TLYHAGLAKIEIERA-GGK----------VRLILST-ARPGIVIG---
RS3_DESAG       ------------TLYHAGLSKIEIERA-GGK----------VRLILST-ARPGIVIG---
RS3_LAWIP       ------------LLYSAGISKMEIERA-GGK----------ICLMLST-ARPGIVIG---
RS3_SYNFM       ------------RLYHAGIAKVEIERA-ANK----------VKIRIFT-ARPGIVIG---
RS3_GEOSL       ------------RLYNSGVSKIEIERA-ANK----------AKINIYT-ARPGLIIG---
RS3_PELPD       ------------RLYSSGISKIEIERA-ANK----------TKINIYT-ARPGLIIG---
RS3_PELCD       ------------RLYHAGVAKIELERA-ASK----------AKINVYA-ARPGIIIG---
RS3_SYNAS       ------------KLYHAGISHIDIERA-VNK----------AKVNIYA-ARPGIIIG---
RS3_ANADE       ------------KLGQAGISRIEIERA-ANK----------VKINVHT-ARPGIVIG---
RS3_MYXXD       ------------SLNHAGVSKVEIERA-ANK----------VKVNVHT-ARPGIVIG---
RS3_DESPS       ------------RLSHAGLSSVKIERT-GEQ----------VRIKLFT-ARPGIVIG---
RS3_CAMJR       ------------KLYYAGISQILVERT-AKK----------LRVTVVA-ARPGIIIG---
RS3_CAMFF       ------------KLYYAGVSQILVERT-AKK----------LRVTVVA-ARPGIIIG---
RS3_SULDN       ------------ELYYAGVSNIVIERT-AKR----------LRVTIIA-ARPGIIIG---
RS3_HELHP       ------------EMYYAGVSEFIIERA-ANK----------IRVTVVA-SRPGLIIG---
RS3_WOLSU       ------------ELYYAGVSEIIIERT-AKK----------LRVTVVA-ARPGIIIG---
RS3_HELPY       ------------ELYYAGVSEIVIERA-AKK----------LRVTVVA-ARPGLIIG---
RS3_BDEBA       ------------KLKNAGVAKIEMERA-AKK----------IKIIIST-ARPGVVIG---
RS3_CLOD6       ------------RLYSAGVAKIEIERS-ANK----------IKMDLHV-AKPGVVIG---
RS3_CARHZ       ------------KFYQAGISRIVIERA-SNR----------VKVTIHT-ARPGMVIG---
RS3_CALS4       ------------KLYAAGIPQIVIERA-SNR----------IKIDIYA-AKPGMVIG---
RS3_CLOPE       ------------ELFSAGIAKIEIERS-AKR----------VKLNIHT-AKPGVIIG---
RS3_CLONN       ------------RSYSAGIAKIEIERT-AKR----------VKINIHT-GKPGMIIG---
RS3_CLOTE       ------------KVYAAGISKIEIERA-GKR----------VKLNIYT-AKPGMVIG---
RS3_CLOAB       ------------KLSSAGVSRIEIERA-AKR----------VKLNIHT-AKPGMVIG---
RS3_ACET2       ------------KLYSAGISRIEIERA-ANK----------VKINVHA-AKPGLIIG---
RS3_SYMTH       ------------TLYAAGISRIEIERA-GGR----------IRIIVHT-AKPGMVIG---
RS3_DESHY       ------------KLQQAGVPKVEIERA-ANR----------VKVSIHA-AKPGIVIG---
RS3_MOOTA       ------------RLYQAGIASVEIERA-ANR----------IKVIVNT-AKPGIVIG---
RS3_SYNWW       ------------RFYAAGISKVEIQRT-GNR----------IRVTIHT-AKPGIIIG---
RS3_KORVE       ------------KLKSAGVSSIEVERP-GNK----------LRIIIRT-ARPGIIIG---
RS3_SOLUE       ------------RLKSAGVSSIEVDRP-GNK----------LRVTIRT-SRPGIIIG---
RS3_THEMA       ------------KYYHAGISEIYVERPDAER----------INITVKT-ARPGIIIG---
RS3_RICBR       ------------SFTQAQVSRILIERPSNKS----------IIININA-KKPNIIIG---
RS3_ANAPZ       ------------TFHHAAVSKVVIARK-VDA----------VIINIHS-ARPGVIIG---
RS3_EHRRW       ------------AFYHASISKVVIARK-VDV----------IMVNVYS-AKPGVIIG---
RS3_WOLPM       ------------SFKHAGVSKVIIERT-IDL----------VSVIIHS-SRPGVIIG---
RS3_WOLTR       ------------SFKHAGLSKIIIERK-VDL----------LSVTIHS-SRPGVIIG---
RS3_PELUB       ------------NVVNSGVSKVMIERT-SNK----------CFVTIYT-SRPGFVIG---
RS3_TREDE       ------------ECKNADIAEVEIIRH-PQR----------ITIMIHT-ARPGVIIG---
RS3_TREPA       ------------ECKNADIAEVEIVRH-PQR----------VTVVMHT-ARPGVVIG---
RS3_BORBU       ------------KGIKFDISDIEIIRNNPQK----------VTVVIVT-PRPGSVIG---
RS3_LEPBL       ------------RFSNAGVVKVVIERF-PEK----------INVNLHT-AKPGIVIG---
RS3_BACTN       ---------------KASVSRIVIERTLKL-----------VTITVCT-ARPGIIIG---
RS3_PORGI       ---------------KASVSRIVIERALKL-----------VTITICT-ARPGMIIG---
RS3_GRAFK       ---------------KASVSRVIIERTLKL-----------VTVTITT-ARPGIIIG---
RS3_CYTH3       ---------------KGGISKIVIERTIKR-----------VTLTINT-ARPGVVIG---
RS3_SALRD       ---------------RAGLSRAVIERTPER-----------VILTLHT-SRPGVVIG---
RS3_CHLPD       --------------EKAGIARIVIERTTKH-----------IKINIYA-ARPGAVVG---
RS3_CHLL3       --------------EKAGIARIIIERTTKH-----------IKINIYA-ARPGAVVG---
RS3_CHLTE       --------------EKAGIAKIVIERTTKH-----------IKINIYA-ARPGAIVG---
RS3_TROWT       ----------------AGIARIEIERTRDR-----------IRVDIYT-ARPGIVIG---
RS3_LEIXX       ----------------AGVSRIEIERTRDR-----------VRVDIHT-ARPGIVIG---
RS3_ARTS2       ----------------AGIAKVEIERTRDR-----------VRVDIHT-ARPGIVIG---
RS3_BIFAA       ----------------AGVSRIVIERTRDR-----------VRVDIHT-ARPGIVIG---
RS3_CORDI       ----------------AGIADVVIERTRER-----------VRVDIHT-ARPGIVIG---
RS3_CORJK       ----------------AGIANVVIERTHDR-----------VRVDIHT-ARPGIVIG---
RS3_MYCVP       ----------------AGIADVEIERTRDR-----------VRVDIHT-ARPGIVIG---
RS3_RHOJR       ----------------AGIAKVEIERTRDR-----------VRVDIHT-ARPGIVIG---
RS3_MYCLE       ----------------AGIADVEIERTRDR-----------VRVDIHT-ARPGIVIG---
RS3_SACEN       ----------------AGISKVEIERTRER-----------VRVDIHT-ARPGIVIG---
RS3_THEFY       ----------------AGISKVEIERTRER-----------VRVDVHT-ARPGIVIG---
RS3_FRACC       ----------------AGISRVDIERTQGR-----------LRVDIHT-ARPGIVIG---
RS3_STRCO       ----------------AGISKVEIERTRDR-----------VRVDIHT-ARPGIVIG---
RS3_ACIC1       ----------------AGISRVEIERTRDR-----------VRVDIHT-ARPGIVIG---
RS3_NOCSJ       ----------------AGIAKVEIERTRDR-----------VRVDIHT-ARPGIVIG---
RS3_CUTAK       ----------------AGLSSIEIERRSER-----------VTIFLYA-ARPGIVIG---
RS3_RUBXD       ----------------AGIAEIEIKKAAEQGE---------VVVDIHT-ARPGIVIG---
RS3_RHOBA       ------------QYKSAGIDRIEIERTRDE-----------VRVMLYV-ARPGLIIG---
RS3_CHLMU       ----------------QGAAGFVVKRMSGK-----------IEVTIHT-ARPGLVIG---
RS3_CHLPN       ----------------QGAAGFVVRRMSGK-----------IEVTIQT-ARPGLVIG---
RS3_PARUW       ----------------VGVSAIKIKRMSGK-----------VEVTIVT-ARPGLVIG---
RS3_DEHMC       ------------KYVDAAISQVDIERQ-S-NK---------VTVSVRT-ARPGIVIG---
RS3_AQUAE       ------------RYKVAGVSKVEIERI-V-DK---------VRVKIHT-ARPAIVIG---
RS3_DEIGD       ------------KLAAAGIARIEIERA-G-QQ---------VNVIISA-AKPGIVIG---
RS3_THET8       ------------ELYSAGLARVDIERA-A-DN---------VAVTVHV-AKPGVVIG---
RS3_BACCZ       ------------RLKDSAVAKVEIERA-A-NR---------VNVTIHT-AKPGMVIG---
RS3_ALKHC       ------------RLKDASVSKIEIERA-A-NR---------VNITIST-AKPGMVIG---
RS3_BACSU       ------------RLSDASVSKVEIERA-A-NR---------VNITIHT-AKPGMVIG---
RS3_LISW6       ------------RLSDASVSRVEIERA-A-NR---------VNITIHT-AKPGMVIG---
RS3_GEOTN       ------------RLQDAAVSRVEIERA-A-NR---------VNVTIHT-AKPGMVIG---
RS3_OCEIH       ------------RLSTAAVSSIEIERA-A-NR---------VNITIHT-GKPGMVIG---
RS3_STAS1       ------------ALQEASVSHVEIERA-A-NR---------INIAIHT-GKPGMVIG---
RS3_LACLA       ------------KLADASVSLIETERA-I-NK---------VIVTLHT-AKPGMVIG---
RS3_STRS2       ------------ELADASTSTIEIERA-V-NK---------VIVSIHT-AKPGMVIG---
RS3_ENTFA       ------------KLADAAVSTIEIERA-A-NR---------VNISIHT-AKPGMVIG---
RS3_LEVBA       ------------RLVDASVSTVEIERA-A-NR---------VNISIHT-AKPGMVIG---
RS3_PEDPA       ------------QLTDASVSTVEIERA-A-NR---------VNISIHT-AKPGMVIG---
RS3_LACS1       ------------KLADASVSTVEIERA-A-KR---------VNISIHT-AKPGMVIG---
RS3_LACSS       ------------KLADASVSTIEIERA-A-NR---------VNVSIHT-AKPGMVIG---
RS3_LACP3       ------------KLQDASVSRIEIERA-A-KR---------VNISIHT-AKPGMVIG---
RS3_LACGA       ------------KLADASVSTVEIERA-A-NR---------INISIHT-AKPGMVIG---
RS3_LACAC       ------------KLKDASVSTVEIERA-A-NR---------INISIHT-AKPGMVIG---
RS3_LACDB       ------------KLKDASVSTVEIERA-A-NR---------VNIAIHT-ARPGMVIG---
RS3_LEUMM       ------------NLADASVDRIEIERT-TKSR---------VDVSIQT-AKPGMVIG---
RS3_OENOB       ------------NLKDAAVDRITIERT-EPTR---------INLTIHT-AKPGIVIG---
RS3_FUSNN       ------------NYFHTGISKVRIERT-SPSQ---------VVVHIHT-GKAGLIIG---
RS3_NEOSM       ------------SFAHIGISKVIIKRK-G-AS---------CDITLHC-MKPGLIIG---
RS3_MYCMS       ------------LLKDAAVSKIDIERT-TKD----------LTLFIKT-ARPAIVLG---
RS3_MESFL       ------------LLKDAAVSKIKIERT-NSN----------ITLIIRT-ARPAIVLG---
RS3_MYCMO       ------------FTREYLIGKVEIRRN-QNGH---------LSVLVHS-AKPGAILG---
RS3_MYCPU       ------------LVRQYLIGKVEIKRD-QKGR---------VFVGVHS-AKRGAMLG---
RS3_MYCS5       ------------FTRKFQIGKVEIQRD-LNNK---------VSVFLHT-SKPAAILG---
RS3_MYCH7       ------------LTREYQIGNTVIRRD-RNNA---------ITVLVYT-AKLGSFLG---
RS3_MYCGE       ------------NYRNAQVSNVEIERT-QTT----------VDVYVYA-AQPALLIG---
RS3_MYCPN       ------------NYRNAQVSNVEIERT-QAT----------VDVFVYA-AQPAFLIG---
RS3_MYCGA       ------------KFHSAFISNVDIERT-QTS----------IRVFIYA-SQPGIILG---
RS3_UREPA       ------------KYKNAGIDHVEIERD-QQR----------VNVYVYA-VQSGLLIG---
RS3_AYWBP       ------------FAKKSAISQIDIERLKEKNKN-------RITISVHT-AKPGVIIG---
RS3_TRIV2       ------------AQNNAGISEVRIERK-----------ADQIDLEVRT-ARPGVVVG---
RS3_TRIEI       ---------------NAGISQIRVERK-----------AEQIDLEVRT-ARPGVVVG---
RS3_SYNE7       ---------------NAGIADIRVERK-----------ADQVELEIRT-ARPGVVVG---
RS3_SYNY3       ---------------NAGISDIRIERK-----------AEQIELGIHT-ARPGVVVG---
RR3_CYAPA       ---------------NAGIAQIYIQRK-----------ADRIELELRT-ARPGVVVG---
RS3_THEEB       ---------------NAGIAEVRIERK-----------ADQVELQIRT-ARPGVVVG---
RS3_SYNJA       ---------------SAGLADIQIERK-----------ADQIDLEIRA-ARPGVVVG---
RS3_GLOVI       ---------------SGGIADVDIERK-----------ADQVEITIRT-ARPGVVVG---
RS3_PROMA       ---------------AAGISDVLIARK-----------ADQLEVELKT-ARPGVIVG---
RS3_PROM5       ---------------SAGISDVLIARK-----------ADQLELELKT-ARPGVIVG---
RS3_SYNS3       ---------------SAGISDVLIARK-----------ADQLEVELKT-ARPGVLVG---
RR3_TRICV       ---------------TASISNIQINRNGL---------SDQIQLNIET-GRPGVLVG---
RR3_THAPS       ---------------LASISDIHINRNGL---------GDQIELNIET-GRPGILVG---
RR3_PHATC       ---------------ANSIANVRINRNGL---------NDQIQLNIET-GKPGILVG---
RR3_PORPU       ---------------NASIAKIEINRK-----------ADQVEVLIAT-ARPGIVLG---
RR3_PYRYE       ---------------NASIAKIEINRK-----------VDQVEILIAT-ARPGIVLG---
RR3_GRATL       ---------------NASISLIYIDRK-----------VDQVQVHIHT-ARPGIILG---
RR3_GUITH       ---------------AAGISKIEISRN-----------ANQLEVSVYT-SRPGIIVG---
RR3_CYACA       ---------------RASISRIQINRQ-----------FNQVELQLHT-SRPGVIIG---
RR3_EMIHU       ------------LYNKAGVSKVEIKRK-----------VNQLELLIHA-ARPKAIAG---
RR3_CYAM1       ------------YVLKAGIARIHILRK-----------SHQIELELHL-ARPGILVG---
RR3_OLTVI       ---------------NSGIIDLFIQR---------KVDRTQVEVEIRT-TRPGLLVG---
RR3_TUPAK       ---------------KANIVDIIIKRRQTTQDLETKESVDVIEVSIYT-AVPGKIIG---
RR3_CHLVU       ---------------GAGITHIEIQRQ--------DVDSPSLGIQIYA-ARLRQIAG---
RR3_MESVI       ---------------NAGVARIDIQRK-----------ADQVEIEIYT-ARPGLVVG---
RR3_CHLAT       ---------------NAGIARIDIQRK-----------ADQVEIEVRT-ARPGLIVG---
RR3_NEPOL       ---------------DAGVANVQLTRQ-----------SDRIEVEIHT-ACPGAIVG---
RR3_OSTTA       ---------------DAGISRINISRQ-----------VDRIEIEFFT-ARPRALVG---
RR3_EUGGR       ------------ELLETLISLIKIERIYEFSEQ-----RNNTIVYIHV-ARPERVIG---
RR3_CALFG       R------ISSGFE--G--IAHIEIQKK-----------MDLIQVIISI-GFPN-FL---I
RR3_PHAAO       K------ISSGFE--G--IAYIGIQKR-----------IDFIQVIIYI-GFPN-LL---I
RR3_ACOCL       R------LSSGFE--G--IARIEIKKR-----------IDLIQVIIYI-GFPN-LF---I
RR3_NUPAD       R------ISSGFE--G--IARIDIKKR-----------IDLIQVIIHI-GFAN-ML---I
RR3_AMBTC       R------ISSGFQ--G--IARLGIQKR-----------IDLIQVTIYI-GSSN-LL---I
RR3_PIPCE       R------ISSGFE--GKGISHIEIQKK-----------IDLIQVIIYM-GSPN-SL---M
RR3_CITSI       R------ISSG----VEGIARIEIQKR-----------IDLIQVIIYI-GFPK-LL---L
RR3_EUCGG       R------ISSG----VEGIARIEIRKR-----------IDLIQVIIYM-GFPK-LL---L
RR3_GOSHI       R------LSSG----VEGIARIEIQKR-----------LDLIQVIIYM-GFPK-LL---I
RR3_CUCSA       R------IFSG----VEGIARIEIQKR-----------IDLIQVIIFM-GFPK-LV---I
RR3_MORIN       K------IFSS----VEGIACIEIQKR-----------IDLIQVIIYM-GFPK-LL---I
RR3_DAUCA       K------ISSG----VEGIARIEIHKR-----------IDLIQVIIYM-GFPK-LL---I
RR3_COFAR       K------ISSG----VEGIARIEIQKR-----------IDLIQVIIFM-GFPK-PL---L
RR3_PLAOC       R------IPL-----VEGIARIEIQKR-----------IDLIQVIIYM-GFPK-LL---I
RR3_SPIOL       K------TSSG----VEGIARIEIQKR-----------IDLIQVIIHM-GFPK-LL---I
RR3_RANMC       K------ISSG----VEGIARIKIKKR-----------IDLIQVIIYM-GFPK-FL---E
RR3_POPTR       K------ISSG----VEGIGHIEIQKR-----------IDVIQVIIYL-GFPK-FL---T
RR3_PHAVU       R------ISSG----VEGIGEIKIQKR-----------IDLIQVIIYM-GFPK-LL---I
RR3_LOTJA       K------ISSG----VEGIGRIKIQKR-----------IDLIQVIIYM-GFPK-LL---I
RR3_OENEH       Q------ISSDSG--VEGIARIEIRKR-----------IDLIQVKIYM-GFPK-LL---I
RR3_JASNU       R------ISSRDR--VEGIARIEIKKT-----------IDLIQIIIFM-GFPIENR---P
RR3_EPIVI       I------ISPD----TEGIAYIEIQKR-----------IDFLKIMIFI-GFKK-FL---I
RR3_MAIZE       KKGSNRKMESDSS--SEVITHIEIQKE-----------IDTIHVIIHI-GFPN------L
RR3_PELHO       R------ISSD----SDVISRIQIDKS-----------IDVVKVIIYM-GFSQ-LL---T
RR3_ANTAG       K------SSSN----YGGIARIEIERK-----------TDLIQIEIYT-GFPALL----V
RR3_PHYPA       R------NSSN----YGGIARIEIKRK-----------TDLIQVEIHT-GFPALL----V
RR3_MARPO       K------NSSN----YGGIARVEIKRK-----------TDLIQVEIYT-GFPALL----V
RR3_HUPLU       K------NSSN----YGGVARVEIQRK-----------TDLILVEIHT-GFPALL----V
RR3_PINTH       K------SSSN----YGGIARVEIRRK-----------IDLIKVKIYI-GFPNLLL---I
RR3_ADICA       K------SVSN----YGGVGHIEIQRK-----------TDLIQINIYT-GFPDLL----I
RR3_PSINU       N------NPFH----YGGIARIEIYRK-----------TDLIRVEIHM-GFTDLL----T
RR3_STAPU       R------TAEN----YGGIDRIEIQRK-----------TSAIKVEIHT-GFPKLF----V
RR3_ZYGCR       R------SSSR----SAEIARVQIQKK-----------TDLVEVQIHT-ASPSLL----V
RR3_CHAVU       R------NSSN----YGGIARINIYRR-----------TDLVQLQIHT-GFPALL----I
RR3_CHAGL       R------ESSNTSYGYSGVSKIEIKRD-----------TELIHVEIHTSGFPALLIKGQI
RR3_EUGLO       ------------KIKNVFISLIEIEKDNKETV---------IFIHYLNFSKFNKVETN--
RR3_BIGNA       NS-----KNKKNLLDSINITDIKINRK-----------FDQVYIDIYVASMNKVIFNTSG
RS3_CARRP       ------------NFLFINLSYIDIIISNKLT----------INLYINNVDQFNIIEN---
RR3_HELSJ       ------FFCGLILIDFQLMQYIVVHKNQLGNF---------SPLKNNLPNSINLFLKLKI
                                                           :                

RS3_ACIBT       ---KKG-----------------------EDIEKLQRELTNIMGV--------------P
RS3_PSYCK       ---KKG-----------------------EDIERLQKELTKIMGV--------------P
RS3_PSEU5       ---KKG-----------------------EDVEKLRQDLTKQMGV--------------P
RS3_SACD2       ---KKG-----------------------EDVEKLRTELTKQMGV--------------P
RS3_HAHCH       ---KKG-----------------------EDVDRLRQEVGELMKV--------------P
RS3_MARHV       ---KKG-----------------------EDVDRLRREVSDMMGV--------------P
RS3_CHRSD       ---KKG-----------------------EDVDRLRRDVSEMMGV--------------P
RS3_ALCBS       ---KKG-----------------------EDVERLRRDVAAKMGV--------------P
RS3_BLOFL       ---RKG-----------------------EDIEKLREKVSKISGV--------------P
RS3_BLOPB       ---KKG-----------------------EDIEKLRKNIARISGV--------------P
RS3_BUCAP       ---KKG-----------------------EDVEKLRINIAKITGV--------------P
RS3_BUCBP       ---KKG-----------------------EDVEKLRLSITNITGV--------------P
RS3_BUCCC       ---KKG-----------------------EDVEKLRIEIAKITGV--------------P
RS3_WIGBR       ---RKG-----------------------EDVDKLRKEISNITGV--------------P
RS3_BAUCH       ---KKG-----------------------EDVEKLRKSISLIAGV--------------P
RS3_ECOLI       ---KKG-----------------------EDVEKLRKVVADIAGV--------------P
RS3_HAES1       ---KKG-----------------------EDVEKLRNAVAAIAGV--------------P
RS3_AERS4       ---KKG-----------------------EDVEKLRKAVAVITGV--------------P
RS3_PHOPR       ---KKG-----------------------EDVEKLRAHISKIAGV--------------P
RS3_IDILO       ---KKG-----------------------EDVEKLRKQVSKLTGA--------------P
RS3_PSET1       ---KKG-----------------------EDVEKLRQAVTKIAGV--------------P
RS3_PSEA6       ---KKG-----------------------EDVEKLRKHVSKLAGV--------------P
RS3_PSYIN       ---KKG-----------------------EDVEKLRTAIAKMAGV--------------P
RS3_COLP3       ---KKG-----------------------EDVEKLRLAVSKIAGV--------------P
RS3_SHEFN       ---KKG-----------------------EDVEVLRAYVSKITGT--------------T
RS3_SHELP       ---KKG-----------------------EDVEKLRNEVAKLTGI--------------P
RS3_HYDCU       ---KKG-----------------------EDIEKLKQALIAKTGM--------------P
RS3_AROAE       ---KKG-----------------------EDIELLKRELQKIMGV--------------P
RS3_AZOSB       ---KKG-----------------------EDIEALKRDLQKIVGV--------------P
RS3_DECAR       ---KKG-----------------------EDIEQLRTDLQRIMGV--------------P
RS3_NEIG1       ---KKG-----------------------EDIEVLKRDLQVLMGV--------------P
RS3_CHRVO       ---KKG-----------------------EDIEVLKQELQKRLGV--------------P
RS3_BORA1       ---KRG-----------------------EDIESLKADLQRLMGV--------------P
RS3_METPP       ---KKG-----------------------EDIENLKAELTRRLGV--------------P
RS3_PARXL       ---KKG-----------------------EDIELLKSELQRRMGV--------------P
RS3_RALSO       ---KKG-----------------------EDIELLKAELQRRMGV--------------P
RS3_ACISJ       ---KKG-----------------------EDIENLKKELATRLGV--------------P
RS3_POLSJ       ---KKG-----------------------EDIENLKKELSRQLGV--------------P
RS3_RHOFT       ---KKG-----------------------EDIENLKRELSRQLGV--------------P
RS3_THIDA       ---KKG-----------------------EDIEVLRGELARLMSV--------------P
RS3_NITEC       ---KKG-----------------------EDIEILRKNVEKLMNV--------------P
RS3_NITMU       ---KKG-----------------------EDIEVLRGALQKLMGV--------------P
RS3_METFK       ---KKG-----------------------EDIESLRSGLQGLMGV--------------P
RS3_METCA       ---KRG-----------------------EDIDALRRDVSRFMGV--------------P
RS3_NITOC       ---KKG-----------------------EDINNLRQEVSRMMGI--------------P
RS3_ALKEH       ---KKG-----------------------EDIDRLRGEVARLMGV--------------P
RS3_HALHL       ---KKG-----------------------EDIDRLRGEVAARMGV--------------P
RS3_XANOM       ---KRG-----------------------EDIEKLRKEVSELMGV--------------P
RS3_XYLFT       ---KRG-----------------------EDIEMLRKQVSDIMGV--------------P
RS3_LEGPL       ---KKG-----------------------GGIETLRKEISDSLGV--------------P
RS3_COXBU       ---KKG-----------------------GEIEALRDEIFKVMKV--------------P
RS3_FRATN       ---KKG-----------------------EDVEKLRAEVHKLMGI--------------P
RS3_RUTMC       ---KKG-----------------------ADIEQLKSIVSKMMGI--------------P
RS3_BARQU       ---KKG-----------------------ADIEKLRRKLSEMTNA--------------E
RS3_BARBK       ---KKG-----------------------ADIEKLRHQLSEMTNA--------------E
RS3_BRUME       ---KKG-----------------------ADIEKLRKKLSEMTNA--------------D
RS3_RHILO       ---KKG-----------------------ADIEKLRKKLMEMTKS--------------E
RS3_CHESB       ---KKG-----------------------ADIEKLRRKITQMTNA--------------E
RS3_AGRFC       ---KKG-----------------------ADIEKLRKKLSEMTNS--------------E
RS3_NITHX       ---KKG-----------------------ADIDKLRKRVADITSS--------------D
RS3_RHORT       ---KKG-----------------------QDIENLRKKLQVMTGN--------------E
RS3_MAGSA       ---KKG-----------------------ADIEVLRKELSKMTGS--------------E
RS3_GRABC       ---KKG-----------------------QDIEALRKGLTGMAGT--------------D
RS3_CAUVC       ---KKG-----------------------ADIDKLRKDLSIMTEG--------------E
RS3_RHOS1       ---KKG-----------------------ADIETLRKKLSAFTKS--------------E
RS3_PARDP       ---KKG-----------------------ADIETLRKKLANFTGS--------------E
RS3_ROSDO       ---KKG-----------------------ADIEGLRQKIAKMTAS--------------E
RS3_JANSC       ---KKG-----------------------ADIEGLRKKLAEITDS--------------E
RS3_ZYMMO       ---KKG-----------------------ADIEKLRKKLDSMTES--------------G
RS3_SPHAL       ---KKG-----------------------ADIEKLRKKLGEMTGS--------------D
RS3_ERYLH       ---KKG-----------------------ADIEKLRQKLSTMTES--------------E
RS3_NOVAD       ---KKG-----------------------ADIEKLRSKLATMTGS--------------D
RS3_HYPNA       ---KKG-----------------------GDIEVLRKELAKMTSD--------------E
RS3_MARMM       ---KKG-----------------------SDIETLRKELSKMIDG--------------E
RS3_MAGMM       ---KKG-----------------------GDIEKLKNDIKAITSS--------------E
RS3_DESVV       ---RKG-----------------------VEIEKLRADLRKKFKR--------------E
RS3_DESAG       ---RKG-----------------------VEIEKLRADLRRKFSR--------------E
RS3_LAWIP       ---RKG-----------------------VEIEKLRLELRKNFGQ--------------E
RS3_SYNFM       ---KKG-----------------------AEIETLRRDLERKFKR--------------E
RS3_GEOSL       ---KKG-----------------------AEVETLKKELAKLTDK--------------E
RS3_PELPD       ---KKG-----------------------SEVETIKKELSNLTSK--------------E
RS3_PELCD       ---KKG-----------------------AEVEALKKDLARLTDK--------------E
RS3_SYNAS       ---KKG-----------------------AEIEKLKKELENVSSS--------------E
RS3_ANADE       ---KRG-----------------------AGIETIKKDLQGLTDN--------------E
RS3_MYXXD       ---KRG-----------------------AGIETVKKDLQQFTKN--------------E
RS3_DESPS       ---KKG-----------------------AEIEILKRELEKLVSR--------------K
RS3_CAMJR       ---KKG-----------------------SDVDNLRKELQDLIGK--------------D
RS3_CAMFF       ---KKG-----------------------GEIENLRSEVTKLVNK--------------D
RS3_SULDN       ---KKG-----------------------SDIEKLKDTLQALVGK--------------P
RS3_HELHP       ---KKG-----------------------VDIDKHKEALKKILHK--------------E
RS3_WOLSU       ---KKG-----------------------ADIEKLKEALKKIVDK--------------E
RS3_HELPY       ---KKG-----------------------VDIEKVKDGLKTLIKK--------------E
RS3_BDEBA       ---KKG-----------------------SGIDALKAEVQKLTPN--------------E
RS3_CLOD6       ---RAG-----------------------AGIEALKAELEKMTKK--------------T
RS3_CARHZ       ---KGG-----------------------TEIEVLRKELEKMTGK--------------Q
RS3_CALS4       ---KGG-----------------------TGVDRLREELEKMTNK--------------T
RS3_CLOPE       ---KGG-----------------------SGIERLKASLKNIIAE-------------KN
RS3_CLONN       ---KGG-----------------------KGIEELKSEILKMIKE-------------KN
RS3_CLOTE       ---KGG-----------------------QGIEALKGELKNIVSDN------------KN
RS3_CLOAB       ---KGG-----------------------QGIEALKKDLVNFVDK-------------EN
RS3_ACET2       ---KGG-----------------------AGIEELRKQLEKMTQK--------------N
RS3_SYMTH       ---RQG-----------------------QGIAELQNQLAQMTGK--------------Q
RS3_DESHY       ---RGG-----------------------TEVENLRKQLEAMTGK--------------Q
RS3_MOOTA       ---RGG-----------------------AEVEALRKDLERLTGK--------------Q
RS3_SYNWW       ---RGG-----------------------IEVERLKVNLAEMTKK--------------N
RS3_KORVE       ---RKG-----------------------AEIDKLKGELQKRTN--------------RE
RS3_SOLUE       ---RKG-----------------------AEIEKLKQDMAKKTK--------------RE
RS3_THEMA       ---RKG-----------------------SEITSLREELERKFN--------------RR
RS3_RICBR       ---KNG-----------------------SEIDKLKKAIEKMTSL-------------SE
RS3_ANAPZ       ---KKG-----------------------VDIDRIKQKIAKMVNH--------------E
RS3_EHRRW       ---KKG-----------------------ADIDKVKQKIVKMINN--------------N
RS3_WOLPM       ---KKG-----------------------SDIEKIKQKIAEKVKN--------------N
RS3_WOLTR       ---KKG-----------------------LDIEKVKQKIAEKVKN--------------S
RS3_PELUB       ---KKG-----------------------SDIDKIKNNLSKFTNN--------------E
RS3_TREDE       ---VKG-----------------------ANIENIGAIIQKKLGK--------------K
RS3_TREPA       ---AKG-----------------------VNIEKIGAEVQKRLNK--------------K
RS3_BORBU       ---LKG-----------------------SNLEKIGQLLTKKISK--------------K
RS3_LEPBL       ---QKG-----------------------SNIEAVKKILKTMTEK--------------P
RS3_BACTN       ---KGG-----------------------QEVDKLKEELKKVTDK--------------D
RS3_PORGI       ---KAG-----------------------QEVDKLKEELKRITKK--------------D
RS3_GRAFK       ---KGG-----------------------QEVDKLKEELKKITDK--------------E
RS3_CYTH3       ---KGG-----------------------AEVDKIKEELKKITGK--------------D
RS3_SALRD       ---RGG-----------------------SEVEKLKGELETLTGK--------------D
RS3_CHLPD       ---RKG-----------------------EEINNLSQELSRITGK--------------E
RS3_CHLL3       ---RKG-----------------------EEINNLSQELGRITGK--------------E
RS3_CHLTE       ---HKG-----------------------EEINNLSQELTRITGK--------------E
RS3_TROWT       ---RRG-----------------------AEADRYRLELEKITSK--------------Q
RS3_LEIXX       ---RRG-----------------------AEAERIRADLEKLSGK--------------Q
RS3_ARTS2       ---RRG-----------------------AEADRIRGELEKLTGK--------------Q
RS3_BIFAA       ---RRG-----------------------AEAERVRAKLEKLTGK--------------Q
RS3_CORDI       ---RRG-----------------------SEADRLRTSLEKLTGK--------------Q
RS3_CORJK       ---RRG-----------------------SEADRIRGQLEKLTGK--------------Q
RS3_MYCVP       ---RRG-----------------------TEADRIRADLEKLTKK--------------Q
RS3_RHOJR       ---RRG-----------------------AEADRIRSELEKLTGK--------------Q
RS3_MYCLE       ---RRG-----------------------TEADRIRADLEKLTCK--------------Q
RS3_SACEN       ---RRG-----------------------AEADRIRGSLEKLTGK--------------Q
RS3_THEFY       ---RRG-----------------------AEADRIRANLEKLTNK--------------Q
RS3_FRACC       ---RRG-----------------------AEADRIRGDLEKLTGK--------------Q
RS3_STRCO       ---RRG-----------------------AEADKIRGQLEKLTGK--------------Q
RS3_ACIC1       ---RRG-----------------------AEADRIRADLEKLTNK--------------Q
RS3_NOCSJ       ---RRG-----------------------AEADRIRGELEKLTGK--------------Q
RS3_CUTAK       ---RNG-----------------------AEAERVRGELEKLTGK--------------Q
RS3_RUBXD       ---KGG-----------------------SEVDALRRDLERLTSK--------------K
RS3_RHOBA       ---KKG-----------------------QEIEILQAELQNLVGR--------------R
RS3_CHLMU       ---KKG-----------------------AEVESLKAELKKLTGK--------------D
RS3_CHLPN       ---KKG-----------------------AEVDLLKEELRALTGK--------------E
RS3_PARUW       ---KKG-----------------------AEIDVLKGELSKLTGK--------------E
RS3_DEHMC       ---RGG-----------------------QRVDEMRHFLEDLI--------------GKK
RS3_AQUAE       ---RRG-----------------------QEVENLKKTLEKML-------------PGKE
RS3_DEIGD       ---KGG-----------------------ESIKQLRGEIERLV-------------SAGT
RS3_THET8       ---RGG-----------------------ERIRVLREELAKL--------------TGKN
RS3_BACCZ       ---KGG-----------------------TEVEALRKALNQL--------------TGKR
RS3_ALKHC       ---KGG-----------------------SEVEALRKALNEL--------------TGKR
RS3_BACSU       ---KGG-----------------------SEVEALRKALNSL--------------TGKR
RS3_LISW6       ---KGG-----------------------SEVEALRKNLNEL--------------TQKR
RS3_GEOTN       ---KGG-----------------------SEVEALRKALAQL--------------TGKR
RS3_OCEIH       ---KGG-----------------------SEVEALRKSLNNL--------------TGKR
RS3_STAS1       ---KGG-----------------------SEIEKLRNKLNSL--------------TNKK
RS3_LACLA       ---KSG-----------------------ANVDALRAELNKL--------------TGKQ
RS3_STRS2       ---KAG-----------------------SNVDALRAQLNKL--------------TGKQ
RS3_ENTFA       ---KGG-----------------------SEVENLRKELNKL--------------TGKR
RS3_LEVBA       ---KGG-----------------------SEVENLRKELNDL--------------TGKR
RS3_PEDPA       ---KGG-----------------------SEVEKLRNQLNQL--------------TGKR
RS3_LACS1       ---KGG-----------------------SEVEKLRKELNNL--------------TGKR
RS3_LACSS       ---KGG-----------------------SEVENLRKALNNL--------------TGKK
RS3_LACP3       ---KGG-----------------------SEVENLRKQLNKL--------------TGRQ
RS3_LACGA       ---KGG-----------------------KEVEALRKQLSAL--------------TKKN
RS3_LACAC       ---KGG-----------------------SEVEALRKQLNAL--------------TGKQ
RS3_LACDB       ---KGG-----------------------AEVEALNKEINAL--------------TNKQ
RS3_LEUMM       ---KGG-----------------------SEVEKLRTQLAKLTDTDEKG-------RSKR
RS3_OENOB       ---RGG-----------------------ADVERLRSELSKIVDTY-KG-------QHKR
RS3_FUSNN       ---RKG-----------------------AEIDALRAKLEKLTGK--------------K
RS3_NEOSM       ---KKG-----------------------ADLESFRLKLNKKFGF--------------V
RS3_MYCMS       ---QEG-----------------------KNIEKIVLAVRKTVKN-----------KKLI
RS3_MESFL       ---QEG-----------------------KNVSNIATAVQKIAKD-----------RNLK
RS3_MYCMO       ---QNG-----------------------ENINKLTQDIQKLLRN-----------KELK
RS3_MYCPU       ---QEG-----------------------KNIQTLTASLQKFLRQ-----------KNKD
RS3_MYCS5       ---ENG-----------------------TNIKNLTVALQKHLKN-----------KKLD
RS3_MYCH7       ---ASG-----------------------ENLKKIVEKLRKTLKN-----------RKIV
RS3_MYCGE       ---SEN-----------------------KNIQKITKMIQIIVG------------RKIK
RS3_MYCPN       ---SEN-----------------------KNIQKITKQIKQIIG------------RTTN
RS3_MYCGA       ---KEA-----------------------ANIKVILLAINKIVG------------RHIK
RS3_UREPA       ---TEA-----------------------SEKKLIELAINKIVG------------RKQL
RS3_AYWBP       ---KDG-----------------------DTRNKLVAKLKELTQK--------------D
RS3_TRIV2       ---RGG-----------------------QGIEALRTGLQTLLG------------GNRQ
RS3_TRIEI       ---RGG-----------------------AGIDSLRVGLQKLLG------------SNRQ
RS3_SYNE7       ---RGG-----------------------AGIDTLREGLQALLKD-----------SSRQ
RS3_SYNY3       ---RGG-----------------------SGIEQLREGLQKLLG------------SARQ
RR3_CYAPA       ---RGG-----------------------RGIEVLRKGLKDLLG------------EQKQ
RS3_THEEB       ---KGG-----------------------QGIEELRKQLRQMLP------------ANRT
RS3_SYNJA       ---RGG-----------------------SGLDALRQGLQKELSSHGS--------PERT
RS3_GLOVI       ---RGG-----------------------AGIDELKANLEKLIG-------------RRQ
RS3_PROMA       ---RQG-----------------------SGIEELRSGIQKTIGD-----------RSRQ
RS3_PROM5       ---RQG-----------------------SGIEELRSGIQKTIGD-----------RTRQ
RS3_SYNS3       ---RQG-----------------------SGIEDLRSGIQKTVGD-----------SSRQ
RR3_TRICV       ---ENG-----------------------TGIKTLLSNIKKILP------------PNRQ
RR3_THAPS       ---DNG-----------------------SGIKTLATNIKKFIP------------NNRQ
RR3_PHATC       ---DLG-----------------------AGLETLLNNVKKFLP------------ANRQ
RR3_PORPU       ---KSG-----------------------AGIESLRNSLTLILD------------PNKQ
RR3_PYRYE       ---KSG-----------------------AGIESLRKSLSLILD------------PSKQ
RR3_GRATL       ---KMG-----------------------RGLEDLRKKLETTLK------------NDTQ
RR3_GUITH       ---RSG-----------------------LGIEKIKTDILRLLK------------QDIS
RR3_CYACA       ---RSG-----------------------TGIDSLKRNVKNLLS------------KQSQ
RR3_EMIHU       ---TADEE---------------------STFSTLRAQIKKLTN------------NPKQ
RR3_CYAM1       ---RSG-----------------------LGLDNLRTQLQTKWP------------HLT-
RR3_OLTVI       ---RKRQNC--------------------DKLKQLRDELQVELNKFRAKNGVS---PTAK
RR3_TUPAK       ---RSK-----------------------ATITELKESLEKLCQLDRMKHNL----PQIR
RR3_CHLVU       ---NDS-----------------------KGLERLQEELVKQLQIFYRKRNLVEP-GTIH
RR3_MESVI       ---RTG-----------------------KGIENLIRDLQDKLRNKR------------K
RR3_CHLAT       ---RSG-----------------------KGVENLLRDLQEQFKNKR------------R
RR3_NEPOL       ---RTG-----------------------QGLEILREDIQKRLPKVR------------R
RR3_OSTTA       ---AKG-----------------------ETLTQLRDEIKAKLPDTR------------N
RR3_EUGGR       ---RDG-----------------------QGLSRIRDILIDRMNYLLGK-------TPRI
RR3_CALFG       EGGTRGIEE-------------------------LQMNVQKRFHSA-----------NRR
RR3_PHAAO       EGRTRGVEE-------------------------LQMNVQKEFHSV-----------NRR
RR3_ACOCL       EGRTQGIKE-------------------------LQMSVQKRLNSV-----------NQR
RR3_NUPAD       EGRARGIEE-------------------------LQTNVQKSFHSV-----------NRR
RR3_AMBTC       EGPTRGIEE-------------------------LRTDVQKKLNSM-----------NRR
RR3_PIPCE       EGRTRGIDE-------------------------LQTNVQKEFLSV-----------NRR
RR3_CITSI       ENRPRRIEE-------------------------LQMNVQKELNCV-----------NRK
RR3_EUCGG       EGKTRRIEE-------------------------LQMNVQKELNCV-----------NRK
RR3_GOSHI       EDKPRKLEE-------------------------LQMNVQKELNCM-----------NRK
RR3_CUCSA       DDGSRKIEE-------------------------LQINVQKEFNSG-----------NRK
RR3_MORIN       EH--QKIEE-------------------------LQMNIQKELNSV-----------NRK
RR3_DAUCA       ENRPGGIEK-------------------------LQMNLQKEFNCV-----------NRK
RR3_COFAR       ENQPRGIEE-------------------------LQTNLQKKCNSV-----------NRK
RR3_PLAOC       EDRPRGIEE-------------------------LQINLQKEFNSM-----------NRK
RR3_SPIOL       ENRPQGVED-------------------------LKINVQKELNCV-----------NRK
RR3_RANMC       GN-PQGIEE-------------------------LQSNIQKEFNSV-----------NQK
RR3_POPTR       EGKPKRIKE-------------------------LQINVQKELNCM-----------NRK
RR3_PHAVU       EGKPHKIEE-------------------------FQTNMHKKLNCV-----------NKK
RR3_LOTJA       DGKPRRIEE-------------------------LQINVQKKMNYV-----------NRK
RR3_OENEH       EDGTRRIEE-------------------------LQRIVQKEINSV-----------NRK
RR3_JASNU       RKVKEKIKE-------------------------LQIHLEKEFHYV-----------KKK
RR3_EPIVI       ENRQLGIIKE-----------------------ALHIDLKKNFHYV-----------NRK
RR3_MAIZE       LKKKGAIEE-------------------------LEKDLQKEVNSV-----------NQR
RR3_PELHO       EDEPPKTKIK-----------------------ELQVSLKKAIHFIQ----------NRK
RR3_ANTAG       ESRGRG-------------------------IEELKADVQ-TVLNLG----------NRK
RR3_PHYPA       ENRKRG-------------------------IEQLKTDVQ-SILTSG----------DRK
RR3_MARPO       ESRGQG-------------------------IEQLKLNVQ-NILSSE----------DRR
RR3_HUPLU       ESHGQG-------------------------IEQIRKDVQQNLLDSK----------IRR
RR3_PINTH       EGRGQG-------------------------IEKLRNDVL-NMLDSV----------DRK
RR3_ADICA       EEQSLG-------------------------ISQMKQDLR-NLLGLE----------SQN
RR3_PSINU       ENGGIR-------------------------FEQLKSNIE-KIVNSK----------NQK
RR3_STAPU       EKLGPR-------------------------LKEIRREMQNTLQKSK----------HLK
RR3_ZYGCR       QTRVPNRSTNTQE----------------IGIEYLRRNIQNTLNPG-----------NRK
RR3_CHAVU       ENRIRG-------------------------LEHLRRDIQEKIDHK-----------KRK
RR3_CHAGL       KEKNRDKNKSNKNSALDQSVNKNQNKNTGQELEKMWRYVQRSLTLS-----------NGK
RR3_EUGLO       --SEKNE----------------------INLFKLKNLLLKSLNSFFNVKI-----NFNE
RR3_BIGNA       SNSDPLIKIQSN-----------------KIVDQLQRVLLKQVSSFNLGNKKVN--NSSK
RS3_CARRP       ------------------------------YLDVFVFQISKILKK---------------
RR3_HELSJ       ATEIQSNF---------------------NSVFILEERLHFLFFKYLNKMKNLKMLNNLK
                                                      :                     

RS3_ACIBT       AQVSINEIDRPDLDARLVAEAIASQLEKRVMFRRAMKRAVQNTMRA-GAKGIKVEVSGRL
RS3_PSYCK       AQVNIEEITSPDLDAHLVAEGIASQLERRVMFRRAMKRAVQNSMRS-GAKGIKVELSGRL
RS3_PSEU5       VHINIEEIRKPELDAMLVAQSVAQQLERRVMFRRAMKRAVQNAMRI-GAKGIKIQVSGRL
RS3_SACD2       VHINIEEIRKPDLDAALAAQSVAQQLERRVMFRRAMKRTVQNAMRQ-GAEGVKVQVGGRL
RS3_HAHCH       VHINIEEIRKPDLDAKLVASGVAGQLERRVMFRRAMKRAVQNAMRQ-GAKGIKIQVGGRL
RS3_MARHV       VHINIEEVRKPDLDARLVAQNVAGQLERRVMFRRAMKRAVQNAMRQ-GAKGIKIQVGGRL
RS3_CHRSD       VHVNIEEVRKPELDAQLVAQNVCGQLERRVMFRRAMKRAVQNAMRL-GAGGIKIQLSGRL
RS3_ALCBS       VHINIEEVRKPDLDARLVGDNVAGQLERRVMFRRAMKRAVQNAMKS-GAEGIRIQLSGRL
RS3_BLOFL       TKLNISEIRKPELEAKLLADNIASQLERRVIFRRAIKRVVQSAMRL-GAKGIKVEVSGRL
RS3_BLOPB       TQLNIAEVRKPELDAKLLADNIASQLERRVVFRRAMKRVVQNAMRL-GAKGIKVEVSGRL
RS3_BUCAP       AQINISEVRKPELDAKLVSESITSQLERRVMFRRAMKRSVQNAMRQ-GAKGIKVEVSGRL
RS3_BUCBP       TQINIAEIRKPELDAKLVADNIVSQLERRIMFRRAMKRAVQNAMRQ-GAKGIKVEISGRL
RS3_BUCCC       AQVNISEIRKPELDAKLVADNISSQLERRVMFRRAIKRSVQNAMRQ-GAKGIKIEVSGRL
RS3_WIGBR       AQISITEIKRPELDAKLVSENIASQLERRIMFRRAMKRAVQNAIRL-GAKGIKVEVSGRL
RS3_BAUCH       SQINIAEVRKPELNAKLVAESIVSQIERRVIFRRAMKRAVQNTIRL-GAKGIKVEVSGRL
RS3_ECOLI       AQINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRL-GAKGIKVEVSGRL
RS3_HAES1       AQINIAEVKKPELDAKLVAGSIASQLERRVMFRRAMKKAVQNAMRL-GAKGIKVEVSGRL
RS3_AERS4       AQINISEVRKPELDGKLVADSITSQLERRVMFRRAMKRAVQNAMRL-GAKGIKVEVSGRL
RS3_PHOPR       AQINISEVRKPELDAQLVGDSIASQLERRVMFRRAMKRAVQNAMRL-GAKGIKVQVGGRL
RS3_IDILO       AQINISEVRKPELDSQLVADNIAGQLERRVMFRRAMKRAVQNAIRL-GAKGIKVEVSGRL
RS3_PSET1       AQINISEVRKPELDAQLVADGIASQLERRVMFRRAMKRSVQNAMRI-GSKGIKVEVSGRL
RS3_PSEA6       AQINIAEVRKPELDGQLVADSIASQLERRVMFRRAMKRAVQNAMRI-GAKGIKVQVSGRL
RS3_PSYIN       AQINISEVRKPELDAKLVADSISSQLERRVMFRRAMKRAVQNAMRL-GAKGIKVQVGGRL
RS3_COLP3       AQINIAEVRKPEMDAQLVADSIASQLERRVMFRRAMKRAVQNAMRL-GAKGIKVQVSGRL
RS3_SHEFN       AQINIAEIRKPELDAKLVADSIAQQLERRVMFRRAMKRAVQNAMRI-GAQGIKVQVSGRL
RS3_SHELP       AQINIAEIRKPELDAKLVAEGIASQLERRVMFRRAMKRAVQNAMRL-GAKGIKVEVSGRL
RS3_HYDCU       VNINIEEIKKPELDAKLVAEGIAQQLEKRIQFRRAMKRAVSNAMRL-GAQGIKVNVSGRL
RS3_AROAE       VHVNIEEVRKPEVDAKLIADSIAQQLEKRIMFRRAMKRAMQNAMRL-GAQGIKIMSAGRL
RS3_AZOSB       VHVNIEEVRKPEIDAKLIADSIAQQLEKRIMFRRAMKRAMQNAMRL-GAQGIKIMSSGRL
RS3_DECAR       VHVSIEEIRKPEIDAQLIADSIAQQLEKRIMFRRAMKRAMQNAMRL-GAQGIKVMSAGRL
RS3_NEIG1       IHVNIEEIRRPELDAQIIADGIAQQLEKRVQFRRAMKRAMQNAMRS-GAKGIKIMTSGRL
RS3_CHRVO       VHVNIEEVRKPELDAQIIADGIASQLEKRVMFRRAMKRAMQNAMRL-GAEGIKIMSSGRL
RS3_BORA1       VHVNIEEIRKPETDAQLIADSISQQLEKRIMFRRAMKRAMQNAMRL-GAQGIKIMSSGRL
RS3_METPP       VAVNIEEVRKPEIDAQLIADSITQQLEKRIMFRRAMKRAMQNAMRL-GAQGIKIMSAGRL
RS3_PARXL       VHVNIEEIRKPETDAQLIADSITQQLERRIMFRRAMKRAMQNAMRL-GAQGIKIMSAGRL
RS3_RALSO       VHVNIEEIRKPEVDAQLIADSITQQLERRIMFRRAMKRAMQNAMRL-GAQGIKIMSSGRL
RS3_ACISJ       VAVNIEEVRKPEIDAKLIADSITQQLEKRIMFRRAMKRAMQNAMRL-GAQGIKIMSSGRL
RS3_POLSJ       VAVNIEEVRKPEIDAKLIADSITQQLEKRIMFRRAMKRAMQNAMRL-GALGIKIMSSGRL
RS3_RHOFT       VAVNIEEVRKPEIDAKLIADSITQQLEKRIMFRRAMKRAMQNAMRL-GALGIKIMSSGRL
RS3_THIDA       VHVNIEEVRKPETDAQIVADGIAQQLEKRVMFRRAMKRAMQNAMRL-GAQGIKIMSSGRL
RS3_NITEC       VHINIEEIRKPEIDAQLIAASITQQLEKRIMFRRAMKRAIQNAMRL-GAQGIKIMSSGRL
RS3_NITMU       VHVNIEEIRKPEIDAQLIADNIAQQLEKRIMFRRAMKRAMQNAMRL-GAQGIKIMSSGRL
RS3_METFK       VHLNIEEVRKPEIDATLIAESIAQQLEKRVMFRRAMKRAMQNAMRL-GAQGIKIMSSGRL
RS3_METCA       VQVSVEEIRKPELDAQLVAEGVAQQLEKRIMFRRAMKRAVQNTLRV-GAEGIKISVAGRL
RS3_NITOC       VHINIQEIRKPELDATLVAANVAQQLERRIMFRRAMKRAVTNAMRV-GAQGIRIKVSGRL
RS3_ALKEH       VHINIEEIRKPELDAKLVAESVAQQLERRIMFRRAMKRAVGNAMRL-GAQGIKVHVSGRL
RS3_HALHL       VHINIEEIRKPEADSKLVAESIAGQLERRVMFRRALKRAVGNAQRV-GAQGIKVQVSGRL
RS3_XANOM       AHINVTEVRKPELDAQLVAESIAQQLERRIMFRRAMKRSVGNAMRL-GALGIKVNVAGRL
RS3_XYLFT       VHINVIEVRKPELDAQLVAESVAQQLERRIMFRRAMKRSVSNAIRL-GALGIKISVAGRL
RS3_LEGPL       VHLNIEEVKKPELDATLVAEGIAQQLEQRVMFRRAMKRAVTSALKA-GAKGIKICVSGRL
RS3_COXBU       VHITIEEVRKPELDAKLVAENIAQQLERRVMFRRAMKRAVQNTLRQ-GALGVKISVSGRL
RS3_FRATN       VQINIEEVRKPEIDAKLVAESVAQQLEKRVMFRRAMKKAMQAAMKS-GAKGIKIMVSGRL
RS3_RUTMC       VHINIEEIKKPELDARLVAENIAQQLEKRVMYRRAVKRVLGNTTRL-GAKGIKVMVNGRL
RS3_BARQU       TSLNIVEIHKPEIDATIIAQSIAQQLERRVAFRRAMKRAVQSAMRL-GAEGIRINCSGRL
RS3_BARBK       TSLNIVEIRKPEIDATIIAQSVAQQLERRVAFRRAMKRAVQSAMRL-GAEGIRINCSGRL
RS3_BRUME       TSLNIVEVRKPEVDATLIAQSIAQQLERRVAFRRAMKRAVQSAMRL-GAEGIRINCSGRL
RS3_RHILO       THLNIVEVRKPEIDATLVAQSIAQQLERRIAFRRAMKRAVQSAMRL-GAEGIRINCSGRL
RS3_CHESB       THLNIVEVRKPEIDARLIAQSIAQQLERRVAFRRAMKRAVQSAMRL-GAEGIRINCTGRL
RS3_AGRFC       THLNIVEVRKPEIDATLVAQSIAQQLERRVAFRRAMKRAVQSAMRL-GAEGIKITCGGRL
RS3_NITHX       VVINIVEIRKPELDATLVAESIAQQLERRVAFRRAMKRAVQSAMRL-GAEGIRINCSGRL
RS3_RHORT       VHLNIVEIRKPELDAQLVAENIAQQLERRVAFRRAMKRAVQSAMRL-GALGIRINCGGRL
RS3_MAGSA       VHLNIVEIRKPELDAQLVAESIAQQLERRVAFRRAMKRAVQSAMRL-GAQGIRINCSGRL
RS3_GRABC       VALNIVEIRKPEIDATLVAENIAQQLERRVAFRRAMKRAVQSAMRL-GAQGIRINCSGRL
RS3_CAUVC       VHLNIVEIRKPETDAQLVAESIAQQLERRIAFRRAMKRSIQSAVRL-GAKGIRINVSGRL
RS3_RHOS1       LHLNIVEIRKPELDAQLVAESIAQQMERRVSFRRAMKRGVQNAMRI-GALGIRVNVSGRL
RS3_PARDP       LHLNIVEVRKPELDAQLVAESIAQQLERRVSFRRAMKRAVQNAMRM-GALGIRVNVSGRL
RS3_ROSDO       LHLNIVEVRKPELDAALVGESIAQQLERRVSFRRAMKRAVQNAMRM-GALGIRVNVAGRL
RS3_JANSC       LHLNIVEIRKPELDARLVAESIAQQLERRVSFRRAMKRAVQNAMRM-GSLGIRVNVAGRL
RS3_ZYMMO       VSLNIVEIRKPEIDAQLVAQGIADQLERRVAFRRAMKRAVQSALRL-GAQGVRITCGGRL
RS3_SPHAL       VSLNIVEIRKPEVDAKLVAQGIADQLERRVAFRRAMKRAVQSAMRL-GAEGIRINCAGRL
RS3_ERYLH       VKLNIVEIRKPEIDAKLVAQGIADQLIRRVAFRRAMKRAMQSAMRL-GAEGIKIVCGGRL
RS3_NOVAD       VKLNIVEIRKPEIDSKLVAQGVADQLVRRVAFRRAMKRAVQSALRL-GAEGIKITCGGRL
RS3_HYPNA       VRVNLVEIRKPEIDATLIADDIARQLERRASFRRAMKRSIQSAMRL-GAEGVKVVVSGRL
RS3_MARMM       VHLNLVEVRKPEIDAALVAESIAQQLERRVAFRRAMKRSMQSAMRM-GAKGCKIVCGGRL
RS3_MAGMM       VQINIVEIRKPEADAQLVAENVAQQLERRVAFRRSMKRAVTSAMRL-GAEGIRINCAGRL
RS3_DESVV       FAIEVNEIRRPEVESQLVAENIALQLERRVAFRRAMKRTVSMARKF-GAEGIKVTCSGRL
RS3_DESAG       FSIEVNEIRRPETDAQLVAENIAMQLERRVAFRRAMKRTVSMSRKF-GAEGIKVACAGRL
RS3_LAWIP       FSLEVTEVRRPEVDAQLVAENIAMQLERRVAFRRAMKRTVSMARKF-GAEGIKITCSGRL
RS3_SYNFM       ILIDIQEVRRPELDATLVGENISLQLVRRVAFRRAMKRAVSAALKF-GAKGVRVASAGRL
RS3_GEOSL       IYLNIQEVRKPELDAQLVAENVALQLERRVAFRRAMKKSVTSSLKF-GAKGIRITCSGRL
RS3_PELPD       IFINIIEVRKPELDAQLVAENVALQLERRIAFRRAMKKSVTSALKF-GAKGIRITCSGRL
RS3_PELCD       VFINIQEVRKPEIDAQLVAENVATQLERRVAFRRAMKKSVSMALKF-GAQGIKITCSGRL
RS3_SYNAS       IIINILEVRKPEIDAQLVAENIATQLERRVAFRRAMKKCVLTALKF-GAKGIRVSCSGRL
RS3_ANADE       VYLNVVEVRKAETDAQLVAENIATQLERRIAFRRAMKKSVQTALKF-GAKGIRVACSGRL
RS3_MYXXD       VFLNIVEVRKAETDAQLVAENIATQLERRIAFRRAMKKALQTAMKF-GAKGIRVACSGRL
RS3_DESPS       VTLDIQEVRRPEADAQLVADNIAQQLARRVAFRRAMKKAVSSALRF-GVQGIKIACSGRL
RS3_CAMJR       VNINIKEERKAGASAQLAAESVATQLEKRIAFRRAMKKVIQGAQKA-GAKGIKVSVSGRL
RS3_CAMFF       IAINIKEERKAGSSAQLAAENVAMQLERRVAFRRAMKKVIQGAQKA-GAKGIKVSVAGRL
RS3_SULDN       LSVNIKEEKKAQISSQLVAENVATQLERRVAFRRAMKKVMQNAQRG-GAKGIKVSVSGRL
RS3_HELHP       VFINIKEAKRPQANAQLAAENIATQLEKRVAFRRAMKKVMQAAMKA-GAKGIKVKVSGRL
RS3_WOLSU       ISINIKEVKRPQANAQLAAENVTMQLERRVAFRRAMKKVMQAAMKA-GAKGIKIKVSGRL
RS3_HELPY       VSINIKEVKHPQADAQLAAENVATQLEKRVAFRRAMKKVMQAALKS-GAKGIKVCVSGRL
RS3_BDEBA       VFLSIQEVRKPDLDAQLVAESIAQQLEKRISWRRALKKSIAAAIKG-GVRGIKIRVSGRL
RS3_CLOD6       IIVNIVEVRSTDKNAQLVAENIALAIERRVAFRRAMKQAIQRAMKS-GAKGIKVSASGRL
RS3_CARHZ       ININIAEIKVPEIDAQLVAENIAAQIEKRISYKRAMKQAVSRALKM-GAQGIKVACSGRL
RS3_CALS4       VILNIIEVKTPELSAQLVAENIAAQIEKRISYRRAMKQAIARAMKL-GAKGIKIACSGRL
RS3_CLOPE       VLINIVEVKNAETNAQLMAENIAAQLEKRISFRRAMKQTIQRAMKA-GTLGVKTACSGRL
RS3_CLONN       VIINIVEVKRPETDAQLMAENVAQQLEKRISFRRAMKQTIQRAMRS-GAKGVKTACSGRL
RS3_CLOTE       ILINIVEVKSAETDAQLMAENVAQQLEKRISFRRAMKQTIQRAMKS-GIKGVKTACSGRL
RS3_CLOAB       VLINIVEVKNSDANAQLMAENIAQQLERRISFRRAMKQTIQRAMRT-GAKGVKTACAGRL
RS3_ACET2       ILINITEIKVPELDAQIVAENIASQLEKRISFRRAMKQAMARAMRL-GAKGIKTAVSGRI
RS3_SYMTH       ISLDVKEIRLPELDAQLVAESIAQQLEKRMSHRRAMKQAIQRAMRL-GAQGVRIIVSGRI
RS3_DESHY       VAVNIVEVKKPELDAQLVAESVAQQLEKRVSFRRAMKQTVQRTMRQ-GGQGIKISCSGRL
RS3_MOOTA       VNLNIAEIKKPELNAQLVAENVAAQLEKRIAFRRAMKQAVGRAMRL-GAQGIKIACGGRL
RS3_SYNWW       VNINIQEIRRPEMDAQIVAENVAQQLEKRISFRRAMKQTVGRTMRS-GGIGIKIAISGRL
RS3_KORVE       VYIDIQEVHKPELDAQLVAESIALQLEKRVGFRRAMRKSVDSALRF-GCKGIKVRVSGRL
RS3_SOLUE       VFIDIQEVHKPELDAQLVSESIALQLEKRVAFRRAMRKAVDSALRF-GCKGIKVRVSGRL
RS3_THEMA       VVINIEEIKTPELDAQLVAESIASRIEKRASYKVAMKRAIMNAMRK-GAQGIKVMVAGRL
RS3_RICBR       VYINIHEVRKFNIDAAIVAQTIASQLEKRVSFRKAMKTAIQASFKQ-GGQGIRVSCSGRL
RS3_ANAPZ       VELHIVEVKKPDLKAVLIAENIAQQLEKRVSFRRAMKRGVQNCLKM-GAKGVKVSCAGRL
RS3_EHRRW       IELNIIEVKKPELKAILIAENIAQQLERRVSFRRAMKRSVQNCLKI-GAKGIKVSCAGRL
RS3_WOLPM       VEVNVVGVKRSEIDAVLISNSIAQQLEKRVSFRRAMKKAIQSCLRM-GARGIKVSCSGRL
RS3_WOLTR       VEVNVVGIKRPEIDAALISSSIAQQLEKRVSFRRAMKKAIQSCLRM-GGGGIKVGCSGRL
RS3_PELUB       VTLNIKEVKKPETNAYLVAENIAQQLVKRISYRRAMKRAMQSCLRL-GAKGIKVSISGRL
RS3_TREDE       VQIKIKEVKRAELRAALVAQNVARQLAGRASFRKVLKQACFNTMRS-GAQGIKIRISGRL
RS3_TREPA       VQIKVKEIKRMELNAYLVAQNVARQLTARVSFRKCLRQACAGTMKS-GAQGVKIRVSGRL
RS3_BORBU       ISIKIKEVKRPELDAQIIANGIAKQVENRASYRKVLKSSLSTSMLK-GAQGLKIKIAGRL
RS3_LEPBL       VNLNIIEVKKPETVAQCIAESIALQIEQRQPFRRVMKQELRRAMRG-GVEGIKILISGRL
RS3_BACTN       IQINIFEVKRPELDAVIVANNIARQVEGKIAYRRAIKMAIANTMRM-GAEGIKIQISGRL
RS3_PORGI       VQINIYEIRKPELDAAIVAENIARQLEGKIAYRRAVKMAIASAMRM-GAEGIKIQVSGRL
RS3_GRAFK       VQINIFEIKRPELDAHLVGASVARQIENRISYRRAIKMAIAAAMRM-NAEGIKIEISGRL
RS3_CYTH3       VQINIFEIKRPEMEALLVGESIAQQLKARISYRRAMKQAIAGTMRV-GALGIKIKLSGRL
RS3_SALRD       IQINISEIKRPELDATLVAKNIVQQLEGRISFRRAMKQAMQAAMRM-GAEGVRIRAAGRL
RS3_CHLPD       VKIDVVEVIKPETEAQLIGENIAYQLENRVSFRRAMKQAIQQAMRA-GAEGIRIRCAGRL
RS3_CHLL3       VKIDVVEVVKPEIESQLIGESIAYQLENRVSFRRAMKMAIQQAMRA-GAEGVRIRCAGRL
RS3_CHLTE       VKIDVIEVIKPEIEAQLIGENIAYQLENRVSFRRAMKMAIQQAMRA-GAEGVRIRCAGRL
RS3_TROWT       VQLNILEVKNPETTARLVAQGIAEQLAARVAFRRAMRKGLQSATSA-GVRGIRIRLAGRL
RS3_LEIXX       IQLNILEVKNPEADAQLVAQGIAEQLAARVAFRRAMRKGLQGAQRA-GSKGVRIQVSGRL
RS3_ARTS2       VQLNILEVKNPEMEAQLVAQGVAEQLTSRVAFRRAMKKAMQSAQRA-GAKGIRIACSGRL
RS3_BIFAA       VQLNIFEVKNAALDAQLVAQGIAEQLTNRVTFRRAMRKAQQDAMRA-GAKGIRIKLSGRL
RS3_CORDI       VALNILEVKNIDANAQLVAQSIAEQLTNRVAFRRAMRKAIQGAMRQPQVKGIKVVCSGRL
RS3_CORJK       VQLNILEVKNIDANAQLVAQSIAEQLTNRVAFRRAMRKAIQGAMRQPQVKGIKVVCSGRL
RS3_MYCVP       VQLNILEVKNPESVAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRL
RS3_RHOJR       VQLNILEVKNAEAEAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRL
RS3_MYCLE       VQLNILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRL
RS3_SACEN       VQLNILEVKNAEADAQLVAQGVAEQLSNRVSFRRAMRKAIQSAMRSPQVKGIRVQCGGRL
RS3_THEFY       VQLNILEVKNPEIDAQLVAQGVAEQLSSRVAFRRAMRKAIQSAMKS-GAKGIRVQCSGRL
RS3_FRACC       VQLNILEVKNPEVDAQLVAQGVAEQLSSRVSFRRAMRKAMQTAMKG-GAKGIRVQCSGRL
RS3_STRCO       VQLNILEVKSPETDAQLVAQAVAEQLSSRVSFRRAMRKSMQGTMKA-GAKGIKIQCGGRL
RS3_ACIC1       VQLNILEVKNPEIDAQLVAQGVAEQLSQRVSFRRAMRKALQSALKA-GAKGVRVQVAGRL
RS3_NOCSJ       VQLNILEVKNPEVDAQLVAQGVAEQLSGRVQFRRAMRKAMQTSMRS-GAKGIRIQCSGRL
RS3_CUTAK       IQLNILEVKSPETDAQLVAQGIAEQLAARVAFRRAMRKAQQSAMNA-GALGIRIKCSGRL
RS3_RUBXD       VQVNVREVSRPELNAKLVAESIAEQLEGRAAFRRTMKRALTSAMRS-GAVGARIQCSGRL
RS3_RHOBA       INLKVEEVGRPELQAQLVAEDISQQLAKRSSFRRTMKRMLEQTMDA-GAKGIKIQMAGRL
RS3_CHLMU       VWVEIAEVKRPELNAQLVADGIAKQIERRVSFRRAMKKALQSVMDA-GALGVKVQVSGRL
RS3_CHLPN       VWLEIAEIKRPELNAKLVADNIARQIERRVSFRRAMKKAMQSVMDA-GAVGVKIQVSGRL
RS3_PARUW       VWVAVEEVKRPDMDAKIVADSIAKQLERRIPFRRAMKKAMQSSIDA-GAFGIKVQLSGRI
RS3_DEHMC       VQLNIVEISQAELDAFLVARSVAEQIERRVAYRRAMKQAIFRSMQA-GAKGIKICASGRL
RS3_AQUAE       ITISVVEVRVPELDAQLVAQDIATQIERRVSHRRAMKRAIDNALKA-GAKGVKVQVKGRI
RS3_DEIGD       VAVNVAEIPNPNISAPLVALRIAEQIERRFAFRRAMKQAAQRVMES-GARGVKVILSGRL
RS3_THET8       VALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMES-GAKGAKVIVSGRI
RS3_BACCZ       VHINILEVKRADLNAKLVGENIARQLENRVSFRRAQKQVIQRAMRA-GAKGIKTQVSGRL
RS3_ALKHC       VHINIFEVKQADLDAKLVAENIARQLENRISFRRAMKQAIQRTMRA-GAQGIKTQVSGRL
RS3_BACSU       VHINILEIKRADLDAQLVADNIARQLENRVSFRRAQKQQIQRTMRA-GAQGVKTMVSGRL
RS3_LISW6       VHINIVEIKRADLDAKLVAENIARQLEGRVSFRRAQKQAIQRTMRA-GAKGIKTQVSGRL
RS3_GEOTN       VHINIVEIKKPDLDAKLVAENIARQLENRVSFRRAQKQAIQRAMRA-GAKGIKTMVSGRL
RS3_OCEIH       VHINIVEIKKVDLDATLVADSIARQLENRISFRRAQKQAIQRAMRG-GAKGIKTQVSGRL
RS3_STAS1       VHINVIEIKKVDLDAKLVAENIARQLENRASFRRVQKQAITRAMKI-GAKGIKTQVSGRL
RS3_LACLA       VHINIVEIKKPDLDAHLVGEGIAKQLEARIAFRRAQKQAIQRAMRA-GAKGIKTQVSGRL
RS3_STRS2       VHINIIEIKQPDLDAHLVGESIARQLEQRVAFRRAQKQAIQRAMRA-GAKGIKTQVSGRL
RS3_ENTFA       VHINIVEIKKPDLDAKLVGEGIARQLENRVAFRRAQKQAIQRAMRA-GAKGIKTQVSGRL
RS3_LEVBA       VHINIVEIKKPDLDAKLVGENIARQLEGRVAFRRAMRGTMQRTMRS-GAKGIKTQVAGRL
RS3_PEDPA       VHINIVEIKKPDLEAKLVGENIAAQLEGRVAFRRAMKQAMQRSMRS-GAKGIKTQVAGRL
RS3_LACS1       VHINIVEIKKPDLDAKLVGESIAEQLENRVAFRRAMKQAIQRTMRA-GAKGIKVQVAGRL
RS3_LACSS       VHINIVEIKKPDLDAHLVGEGIARQLEARVAFRRAQRQAMQRTMRA-GAKGIKTQVAGRL
RS3_LACP3       VHINIVEIKKPDLDAKLVGENIARQLEQRIAFRRAMRQAMQRTMRA-GAKGIKTQASGRL
RS3_LACGA       VHINIVEIKKPDLDAKLVGEGIARQLEARIAFRRATRQATQRSMRS-GAKGIKVQTAGRL
RS3_LACAC       VHINIVEIKKPDLDAELVADSIARQLEARIAFRRAMRQATQRAMLA-GAKGIKVQTSGRL
RS3_LACDB       VHINIVEIKKPDLEAKLVADGIARQLEARIAFRRASRQAAQRSMRA-GAKGIKVQIAGRL
RS3_LEUMM       VFINIVEIKKPDLSAHLVGQQIAGDLERRVAFRRAMRGAIQRATRS-GAKGIKVMVSGRL
RS3_OENOB       VNINIVEIRKPDLNAHLVGQQIAADLERRVAFRRAMRGAIQRVQRA-GAKGVRTMVSGRL
RS3_FUSNN       VTVKVQEIKDLNGDAVLVAESIAAQIEKRIAYKKAMTQAISRSMKSPEVKGIKVMISGRL
RS3_NEOSM       PSLNVVEVKKPNSSAVLVAKSIAFQLEKRSSFRRVIKKAIATVMRESDVKGVKVACSGRL
RS3_MYCMS       VNVRVIEIKSPDADATLVARWIGEQISNRASFRTVQKLAIKKALKA-GAKGIKTAVSGRL
RS3_MESFL       VEVKVIEVKNPDADATLVARWIGEQITNRASFRTVQKLAIRKALKA-GVKGIKTSVSGRL
RS3_MYCMO       LNIEVVNIKNPDLNAIILAEQIAIKLENRAPFRVAQKFAIRNAMKS-GAKGIKTQVSGRL
RS3_MYCPU       IKIDVINIDQPELNARLLAEQIAVDLENRKPFRIAQKFAIRNSLKA-GAKGIKTAVSGRL
RS3_MYCS5       VNLKVLTIKEPDLNARLLAEMIATKLENRESFRSAQKIAIRSALKA-GAKGIKTAVSGRL
RS3_MYCH7       INVDAVDIQSPELNAKLMAELIAEKLEQRKSYRIAQKFAIRTALKN-GATGVKTIVCGRL
RS3_MYCGE       LDLTINEIGSPMLSSRIIARDIANAIENRVPLRSAMRQALTKVLKA-GANGIKVLVSGRL
RS3_MYCPN       LDLTINEIGSPMLSARIIARDLANAIEARVPLRTAMRQSLIKVLKA-GANGIKVLVSGRL
RS3_MYCGA       VDVDVLEVGNPSLSAKIVARELADAIENRTPLRTAMRQALKRVLKA-GAKGIKVLVSGRL
RS3_UREPA       VSLKVVEVQIPELQASLMAREIADAIENRVSFRIAQKMVIKKVLKA-GARGIKTHVSGRL
RS3_AYWBP       VNLNVLEVKNSDKVALLIAQNMAEKLENRMFFRRVQKMAIQKAIKA-GAKGVKTLISGRL
RS3_TRIV2       IRINVVEVQRVDADAYLIAEFIAQQLERRVSFRRVVRQAIQRAQKA-GIQGIKVQVSGRL
RS3_TRIEI       IRINVVEVTKVDTDAMLIGEYIAQQLEKRVSFRRVVRQAITRAQKA-GVEGIKIQVSGRV
RS3_SYNE7       IRINVIEVERVDADAALLGEYIAQQLERRVAFRRCVRQAIQRAQRA-GVQGIKIQVAGRL
RS3_SYNY3       IRVNVIEVPNADADAALMAEYIGQQLERRVSFRRVVRQALQRAERA-EVKGIKIQVSGRL
RR3_CYAPA       IRINVIEVKQIDAEAALIGEFITQQLERRVAFRRIVRKAITRAQRR-GIEGIKIQISGRL
RS3_THEEB       IKVNVVEVNRVDAEASLLAEYITQQLERRVAFRRAVRQAIQRAQRA-GIEGIKVQVAGRL
RS3_SYNJA       IRINVVEVTRADAEAVLLAENIAQQLERRIAFRRIVRQVIQRAQRA-GVQGIKIQIAGRL
RS3_GLOVI       IRINVVEVQRVDAEAALIAEYIVGQLERRVAFRRAVRQAIQRAQRA-GVQGIKVMVAGRL
RS3_PROMA       VRINVVEIERVDADAHLLAEYIAQQLEKRVAFRRTIRMAVQRAQRA-GVLGLKIQVGGRL
RS3_PROM5       VRINVVEVERVDADAYLLAEYIAQQLEKRVAFRRTIRMALQRAQRA-GVLGLKIQVGGRL
RS3_SYNS3       VRINVVEVERVDADAFLLAEYIAQQLEKRVAFRRTIRMAVQRAQRA-GVLGLKIQVSGRL
RR3_TRICV       LTINIIEVEKVNLNASLIGDLVVEQLEDRVAFRKAIRKAMQSALDE-NVNGIKIQVSGRL
RR3_THAPS       ITINVVEVENVNANASLIADLVVQQLEDRVAFRRAIREALQCLQDN-QVNGIKVEVSGRL
RR3_PHATC       LTINVLEVEKVDLDASLLADLVAEQLEKRIAFRRAIREALQRAQKQ-NVNGIKIQVSGRL
RR3_PORPU       IRVNVVEISDPDSEATLVAEFITQQLEKRVAFRRAVRQAVQRAQRA-NTQGVKIQVSGRL
RR3_PYRYE       LRVNVVEIADPDSEATLVAEFITQQLEKRVAFRRAVRQAVQRAQRA-NTQGVKIQVSGRL
RR3_GRATL       IRINLIEITDPDKEATLIAEFIVQQLEKRIAFRRVIRQAMQRSQKA-KNQGIKIQVSGRL
RR3_GUITH       IRINVIELTNPDADANLIGEFIAQQLEKRVAFRRATRQAIQKAQRA-NVQGIKVQVSGRL
RR3_CYACA       LKINIIDVTNPDIDAVLLACFISQQLESRTTFKRAVRQAIQRAQKS-DIPGIKIQVSGRL
RR3_EMIHU       TRIKVIQVNKMETESVLVARALAEQLEKRVAFKRAIRLVAQRLQKS-GTKGFKIQVSGRL
RR3_CYAM1       WRISLVEVSNPDANAVLLAQWLAQQLEKRIAFRRAIRQAMARAQKV-GVKGIKIQVSGRL
RR3_OLTVI       VALQVTTVQNKSSEAIVIAEFLVNQLERRIAFRRALRRVLSIIQRD-RVQGAKIQVSGRL
RR3_TUPAK       IILTILKVQNPYSSASVIADYLIEQLEQRIPFRAALKKALERIRLA-KLEGIKIEISGRL
RR3_CHLVU       LRLSVKPLRAPEAYAEVLAEKLVEELEQRKPFRRAMRQTVQRALRA-GVKGIKVQISGRL
RR3_MESVI       FRITITYLQEPDLESTLIGEFIAQRLQERKPFRRAIRQAVQRAKRA-GVQGIKIQVAGRL
RR3_CHLAT       FRITITYIPEPDLESTLIAEFIAQRLEARAPFRRAMRQAIQRATRA-GVEGIKIQVAGRL
RR3_NEPOL       VIVHVVEIANPDAQAVLIGGIIAKQLEERIPFRRAVRQAVQRAMRAPGVEGIKIEVSGRL
RR3_OSTTA       VALYVTKTQQPEMEAICIAENIAEQLEKRTPFRRTMRQAIMRARKA-GAEGIKIQISGRL
RR3_EUGGR       ITCKVVGVTSPNLDARLLADSVRRELEKRTPFIRAMKTVMLQAMKA-GAEGIKVQVSGRL
RR3_CALFG       LNIAITRVAKPYGQPNILAEYIARQLKNRVSFRKAMKKVIELTEQA-DTKGIQVQIAGRI
RR3_PHAAO       LNIAITRIEKPYGQPNILAEYIALQLKNRVSFRKAMKKAIELTEQT-GTKGIQVQIAGRI
RR3_ACOCL       LNIAIARISKPYGQPNILAEYIALQLKNRVSFRKAMKKAIELTEQA-DTKGIQIQIAGRI
RR3_NUPAD       LNIAIARVPRPYGQPNILAEYIALQLKNRVSFRKAMKKAIELAEQA-DAKGIQVQIAGRL
RR3_AMBTC       LNITITRIARPYEQPNILAEYIALQLKNRVSFRKAMKKAIELAEQA-NTKGIRVQIAGRL
RR3_PIPCE       LNIAIIRVAKPYAQPTILAEHIALQLKNRVSFRKAMKSAIELTEQA-DTKGIQIQIAGRI
RR3_CITSI       INIAITRITNPYGHPNILAEFIAGQLKNRVSFRKAMKKAIELTEQA-DTKGIQVQIAGRL
RR3_EUCGG       LNIAITRITNPYGHPNILAEFIAGQLKNRVSFRKAIKKAIELTEQA-DTKGIQVQIAGRL
RR3_GOSHI       LNIAITRIGNPYGHPNILAEFIAGQLKNRVSFRKAMKKAIELTEQA-DTKGIQIQIAGRI
RR3_CUCSA       LNIAITRIGNPYGHPNILAEFIAGQLKNRVSFRKAMKKAIELTEQA-GTKGIQVQIAGRI
RR3_MORIN       LNMAITRIANPYGHPNILAEFIAGQLKNRVSFRKAMKKAIELTEQA-GTKGIQIQIAGRI
RR3_DAUCA       LNITITRIAKPYGSPNILAEFIAGQLKNRVSFRKAMKKAIELTEQA-DTKGIQVQISGRI
RR3_COFAR       FNIAITKIAKPYGNPNILAEYIAGQLKNRVSFRKAMKKAIELTEQA-NTKGIQVQIAGRI
RR3_PLAOC       LNIAITRIAKPYGQPNILAEYIAGQLKSRVSFRKAMKKAIELTEQT-DTKGIQVQIAGRI
RR3_SPIOL       LNIAITRIAKPYGDPNILAEFIAGQLKSRVSFRKAMKKAIELTEQA-DTKGIQIQIAGRI
RR3_RANMC       LNIAITRIAKPYGQPNILAEFIAGQLKNRVSFRKAMKKAIELTEQA-DTKGIQIQIAGRI
RR3_POPTR       LNISITRIENPYMHPNVLAEFIAGQLKNRVSFRKAMKKAIELTEQS-NTKGIQVQIAGRL
RR3_PHAVU       LNIAIVKITNAYKHPNILAEFIAGQLKNRVSFRKAMKKAIELTEQA-GTKGVQVQIAGRI
RR3_LOTJA       LNIAITRIANAYRDPNILAEFIAGQLKNRVSFRKAMKKAIELTEQA-GTKGVQVQIAGRI
RR3_OENEH       INITITKITKPYGDPNILAEFIAGQLNNRVSFRKAIQKAIELAEQA-DTKGIRVQIGGRI
RR3_JASNU       LKIAITKIAKPYQNPKILAEFLAGQLKDRVSFRKAMKKAIELAEQA-DTEGIRVQMAGRI
RR3_EPIVI       LIIDIIRITKPYRNPNILAEFIADQLKNRVSFRKTMKKAIELTESE-DTKGIQVQISGRI
RR3_MAIZE       LNIAIEKVKEPYRQPNILAEYIAFQLKNRVSFRKAMKKAIELTKKA-DIKGIKIQIAGRL
RR3_PELHO       LNLAVRKMKKPYGDPTILGKYIANQLKNRVSFRKVMKKAVELVEKA-YKKGIQVQIAGCI
RR3_ANTAG       LRMALTEVEEPYTEPNILAEYIALQLENRVAFRRTMKKAIELTRKT-SVKGIKIQIAGRL
RR3_PHYPA       LRMTLTEVTKPYGEPNILAEYIALQLESRVAFRRTMKKAIELAKKT-NIKGIKIQIAGRL
RR3_MARPO       LRMTLIEIAKPYGEPKILAKKIALKLESRVAFRRTMKKAIELAKKG-NIKGIKIQIAGRL
RR3_HUPLU       VHVTSTEIAKPYGEPNILAEYIAIQLENRVAFRRTIRKAIELAKET-DIKGIKIQIAGRL
RR3_PINTH       LHIAIEKVAKPYRKPNILAEYIALQLEKRVPFRKTMKKAIELAERE-EVEGIQIQIAGRL
RR3_ADICA       LRVTLTGVIQPYGEPKILAEHVASQLKNRVPFRRTMKKTIEMAGRT-NGGGIKIQIAGRL
RR3_PSINU       LCLILIKIDKPYTEPKVLAEYIALQLENRVVFRKAVKKALELAGNFKNKGGIKIQIAGRL
RR3_STAPU       FIISLAEVEKPYAKATILAEYIAVQVERRVAFRKTIKKAIQLAKEQGNVKGIKIQIAGRL
RR3_ZYGCR       LNMTLSQVAKPYGEAIILAEYIALQLESRVAFRKTMKQAIKLANKSGNARGIKIQIAGRL
RR3_CHAVU       LRMTLVEVLKPYTEPTILAEYIALQLENRVAFRRVMKKAIQLAKIS-DIKGIKIQIAGRL
RR3_CHAGL       FRMTLSKVSNPYKEANIVAEYIARQLENRVAFRRAMKQAIKDAKENGQVKGIKIQISGRL
RR3_EUGLO       FIIKLIEIENPILDVRFIANDIRYKLEKRMNFRKIVNSTIANIINK-GIKGIKIKLSGRL
RR3_BIGNA       IIVNIIESPDINTNAVFIAKCLIDDLENRVPFRRALKTILDTTQKQKNLAGVKIQISGRL
RS3_CARRP       -NVILNFVFNHVLNAKNIAYNVVNQILNKNSIKKIIKEELLKNRKN---FGCKIQISGRL
RR3_HELSJ       IKVKIKFLNNPILEPQWIFYKLHQDLYKGINIRRALAKISSNVIKK-GAEGVKIQIKGRI
                                     :   :                        * :    * :

RS3_ACIBT       GGA--EIARTEWYREGRVPLHTLRADIDYATMRAETTYGTIGVKVWIF-RGEILGGMKQV
RS3_PSYCK       GGA--EIARTEWYREGRVPLHTLRADIDYSSVRAETTYGTIGVKVWIF-RGEILDGMNSV
RS3_PSEU5       GGA--EIARTEWYREGRVPLHTLRADIDYNTYEAHTTYGVIGVKVWIF-KGEVIGGRHEE
RS3_SACD2       GGA--EIARSEWYREGRVPLHTLRADIDYATAEASTTYGIIGVKVWIF-KGEIIGGIEEV
RS3_HAHCH       GGA--EIARTEWYREGRVPLHTLRADIDYATHEAHTTYGVIGVKVWIF-KGEILGGIEQV
RS3_MARHV       GGA--EIARSEWYREGRVPLHTLRADIDYATYEAHTTYGVIGVKVWIF-KGEILGGMEQV
RS3_CHRSD       GGA--EIARTEWYREGRVPLHTLRADIDYATYEAHTTYGVIGVKVWVF-KGEILGGIEEV
RS3_ALCBS       GGA--EIARTEWYREGRVPLHTLRADIDYASVRAETTYGTIGVKVWIF-RGEVLGGMEQV
RS3_BLOFL       SGA--EIARTEWYREGRVPLHTFRADIDYSLSEAHTSYGVVGVKVWVF-KGEIL-DKVLF
RS3_BLOPB       SGA--EIARTEWYREGRVPLHTLRADIDYSLSEARTTYGIIGIKVWVF-KGEILGDVLLL
RS3_BUCAP       GGA--EIARREWYREGRVPLHTLRANIDYSISEAHTTYGVIGVKVWIF-KGEILGGMSTI
RS3_BUCBP       GGT--EIARREWYREGRVPLHTLRADIEYNVSEAHTTYGVIGVKVWIF-KGEILGGIGSI
RS3_BUCCC       GGV--EIARREWYREGRVPLHTLRANIEYNTSEAHTTYGIIGVKVWIF-KGEILDGMLVV
RS3_WIGBR       GGA--EIARKEWYREGRVPLHTFRADIDYNTSEAHTTYGIIGVKVTIF-KGEILGNSSPY
RS3_BAUCH       SGV--EIARTEWYREGRVPLHTLRADIDYHVSEAHTTYGVIGVKVWIF-KGEILDGMMAV
RS3_ECOLI       GGA--EIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIF-KGEILGGMAAV
RS3_HAES1       GGA--EIARSEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIF-KGEILGGMAAI
RS3_AERS4       GGA--EIARTEWYREGRVPLHTLRADIDYATSEAHTTYGVIGVKVWIF-KGEVLGGLAAV
RS3_PHOPR       GGA--EIARSEWYREGRVPLHTLRADIDYATSSAHTQYGVIGVKVWIF-KGEVLGGMPIE
RS3_IDILO       GGA--EIARTEWYREGRVPLHTLRADIDYSTSEANTTYGIIGVKVWIF-RGEVLGGLPTE
RS3_PSET1       GGA--EIARTEWYREGRVPLHTLRADIDYATSEALTTYGIIGVKVWIF-KGEVIGGLPLV
RS3_PSEA6       GGA--EIARAEWYREGRVPLHTFRADIDYATSEANTTYGIIGVKVWIF-KGEVLGGLPLT
RS3_PSYIN       GGA--EIARSEWYREGRVPLHTLRADIDYSTSEAHTVYGIIGVKVWIF-KGEVLGGLPLQ
RS3_COLP3       GGA--DIARAEWYREGRVPLHTLRADIDYAIARGNTTYGVIGIKVWIF-KGEIIGNMPLQ
RS3_SHEFN       GGA--EIARAEWYREGRVPLHTLRADIDYSTAESHTQYGVIGIKVWIF-KGEVLDGLVPA
RS3_SHELP       GGA--EIARSEWYREGRVPLHTLRADIDYSTAESHTQYGVIGVKVWVF-KGEVLDGVVPA
RS3_HYDCU       NGA--EIARAEWYREGRVPLHTLRADIDYATFEADTTYGKIGVKVWIF-KGEKLEKISMV
RS3_AROAE       NGA--EIARTEWYREGRVPLHTLRADIDYGVSEAKTTYGIIGIKVWVY-KGEMLGRNERP
RS3_AZOSB       NGA--EIARTEWYREGRVPLHTLRANIDYGVSEAQTTYGVIGIKVWVF-KGEMLGRNEQP
RS3_DECAR       NGA--EIARSEWYREGRVPLHTLRADIDYATSEALTTYGIIGIKVWVY-KGDMLDRNEQP
RS3_NEIG1       NGA--DIARSEWYREGRVPLHTLRANVDYATSEAHTTYGVLGLKVWVYTEGNIKS----S
RS3_CHRVO       NGI--DIARSEWYREGRVPLHTLRADVDYATSEAKTTYGIIGIKVWVY-KGELKPGQVQA
RS3_BORA1       NGI--EIARTEWYREGRVPLHTLKANIDYGTSEAHTTYGVIGIKVWVY-KGDMLANGELP
RS3_METPP       NGI--EIARTEWYREGRVPLHTLRADIDYGFSEAKTTYGIIGVKVWVY-RGDRLANGEAP
RS3_PARXL       NGI--EIARTEWYREGRVPLHTLRADIDYATSEAKTTYGIIGVKVWVY-KGDTLGRNDAP
RS3_RALSO       NGI--EIARTEWYREGRVPLHTLRADIDYGFSEAETTYGIIGVKVWVY-KGDHLGRNDAP
RS3_ACISJ       NGI--EIARTEWYREGRVPLHTLRADIDYGTSEAKTTYGVIGVKVWVY-KGDTLGRNDLP
RS3_POLSJ       NGI--EIARCEWYREGRVPLHTLRADIDYGTSEAKTTYGVIGVKVWVY-KGDTLGRGESP
RS3_RHOFT       NGI--EIARCEWYREGRVPLHTLRADIDYGTSEAQTTYGIIGVKVWVY-KGDTLGRNDLP
RS3_THIDA       NGA--EIARTEWYREGRVPLHTLRAEIDYGFAEAKTTYGIIGIKVWVY-KGDALTRGEQP
RS3_NITEC       NGI--EIARTEWYREGRVPLHTLRAEVDYGTSEAKTTYGVIGVKVWVF-KGEQLSVRDRQ
RS3_NITMU       NGI--EIARTEWYREGRVPLHTLRADLDYGVSEAKTTYGVIGIKVWVF-KGEVIGRGEQA
RS3_METFK       NGI--EIARTEWYREGRVPLHTLRADIDYGVAEAKTTYGIIGIKVWVF-KGEVFGNKIEQ
RS3_METCA       NGA--EIARTEWYREGRVPLHTFRADIDYGFAEAVTTYGVIGVKVWIF-KGEVFEPVHT-
RS3_NITOC       NGA--EIARNEWYREGRVPLHTLRADIDYGFAEAKTTYGILGVKVWIF-KGEVFEQPEP-
RS3_ALKEH       NGA--EIARSEWYREGRVPLHTLRANIDYGVAEAHTTYGVIGVKVWVF-KGEIIDSDAQ-
RS3_HALHL       NGS--EIARTEWYREGRVPLHTLRADIDYGFAEAKTTYGVIGVKVWIF-KGEIIDTENEG
RS3_XANOM       NGA--EIARSEWYREGRVPLHTLRADIDYGFAEASTTYGIIGIKVWIY-KGEVFDFSQVG
RS3_XYLFT       NGA--EIARSEWYREGRVPLQTLRADIGYGFSEAYTNYGVTGVKVLMY-HGDIFSFSSVS
RS3_LEGPL       GGA--EIARSEWYREGRVPLHTFRADIDYGTAESKTTYGIIGVKVWIF-KGEILPQKKRS
RS3_COXBU       GGA--EIARTEWYREGRVPLHTFRADIDYATASAKTTYGIIGVKVWIF-KGEVHAPKPQA
RS3_FRATN       GGA--EIARSEWARDGRVPLQTFRADVDYATAEALTTYGVIGVKVWIY-KGEILPGQIAE
RS3_RUTMC       NGA--EIARSEWYREGRVPLHTFRADVDYSSYGANTQYGVIGIKVWIF-KGEILNHKKGT
RS3_BARQU       GGA--EIARMEWYREGRVPLHTLRSDVDYGTAEAKTAYGICGVKVWVF-KGEILEYDPIA
RS3_BARBK       GGA--EIARMEWYREGRVPLHTLRADVDYSTAEARTAYGVCGVKVWVF-KGEILEHDPMA
RS3_BRUME       GGA--EIARMEWYREGRVPLHTLRADIDYGTAEAKTAYGICGVKVWVF-KGEILEHDPMA
RS3_RHILO       GGA--EIARMEWYREGRVPLHTLRADVDYGTAEANTAYGICGVKVWVF-KGEILEHDPMA
RS3_CHESB       GGA--EIARIEWYREGRVPLHTLRADIDYGTAEAKTAYGVCGVKVWVF-KGEILEHDPMA
RS3_AGRFC       GGA--EIARTEWYREGRVPLHTLRADIDYGTAEAETAFGICGIKVWIF-KGEILEHDPMA
RS3_NITHX       GGA--EIARMEWYREGRVPLHTLRADVDYGVATAFTTFGTCGVKVWIF-KGEILEHDPMA
RS3_RHORT       GGA--EIARTEWYREGRVPLHTLRADVDYGTAAAHTTYGVCGVKVWVF-KGEIMEHDPMA
RS3_MAGSA       GGA--EIARMEWYREGRVPLHTLRADVDYGVGTAHTTYGSCGVKVWVF-KGEILAHDPMA
RS3_GRABC       GGA--EIARIEWYREGRVPLHTLRADIDYGVATAKTTYGTCGVKVWIF-KGEILAQDPMA
RS3_CAUVC       GGA--EIARMEWYREGRVPLHTLRADIDFGFAEAKTTYGIIGVKTWIF-KGEVLEHDPMA
RS3_RHOS1       GGA--EIARTEWYREGRVPLHTLRADIDYATSEATTPYGIIGVKVWIF-KGEILEHDPQA
RS3_PARDP       GGA--EIARTEWYREGRVPLHTLRADIDYALSEASTPYGIIGVKVWIF-KGEIMEHDPQA
RS3_ROSDO       GGA--EIARTEWYREGRVPLHTLRADIDYAHVEAATAYGIIGIKTWIF-KGEIMEHDPAA
RS3_JANSC       GGA--EIARTEWYREGRVPLHTLRADIDYAHAEAETAYGIIGIKTWIF-KGEIMEHDPSA
RS3_ZYMMO       GGA--EIARTEWYREGRVPLHTLRANVDYAEAEAHTAYGVCGIKVWIF-KGEIMAHDPLA
RS3_SPHAL       GGA--EIARTEWYREGRVPLHTLRANVDYAEAEAHTAYGVCGIKVWIF-KGEILGHDPMA
RS3_ERYLH       GGA--EIARVEQYREGRVPLHTLRANIDYAEAEALTAYGIIGIKVWVF-KGEILGHDPTA
RS3_NOVAD       GGA--EIARVEWYREGRVPLHTLRANIDYAEAEAHTAYGVIGIKVWIF-KGEILGHDPMA
RS3_HYPNA       GGA--EIARTEKYAEGSVPLHTLRADIDYGTAEATTTYGIIGVKVWVY-KGEILEHDPMA
RS3_MARMM       GGA--EIARTEQYNEGSVPLHTLRADIDYGTCEAKTAMGIIGIKVWIY-KGEIMEHDPNA
RS3_MAGMM       GGA--EIARTEWYREGRVPLHTLRADIDYGFAEAHTTYGIIGVKVWVY-KGMLIEKK---
RS3_DESVV       AGA--EIARTEWYRDGRVPLQTLRADIDFGFAEARTTYGVIGVKVWIF-KGELLDNEVA-
RS3_DESAG       AGA--EIARSEWYRDGRVPLQTLRADIDYGYAEAHTTYGIIGVKVWIF-KGEILDNEVEQ
RS3_LAWIP       AGA--EIARTEWYRDGRVPLQTLRADIDYGFAEAHTTYGIIGVKVWIY-KGEVLDKEVEK
RS3_SYNFM       GGA--EMARREWYREGRVPLHTLRADIDYGTAIARTTYGAIGVKVWIF-KGEVLP-----
RS3_GEOSL       GGA--EMSRTEWYREGRVPLHTLRADIDYGFAEAKTTYGIIGVKVLIF-KGEVLPGQK--
RS3_PELPD       GGA--EMSRTEWYREGRVPLHTLRADIDYGCAEAKTTYGLIGIKVLIF-KGEVLPGH---
RS3_PELCD       GGA--EMSRTEWYREGRVPLHTLRADIDYGFAEAKTTYGIIGVKVLIF-KGEVLSQD---
RS3_SYNAS       GGA--EMSRTEWYREGRVPLHTLRADIDSGFTEAKTAYGQIGIKVLIF-HGEVLPGRKEL
RS3_ANADE       GGS--EMARYEWYREGRVPLHTLRADIDYGFAEAKTTYGKIGCKVWIM-RGEVLPQSAGA
RS3_MYXXD       GGA--EMARYEWYREGRVPLHTLRADIDYGFAEAKTTYGKIGCKVWVC-KGEVLP-GKGG
RS3_DESPS       GGA--EMSRCEWVREGRVPLHTLRADVDYALSESHTTYGIIGVKVWIF-KGEVLSDKDKG
RS3_CAMJR       GGA--EMARTEWYLEGRVPLHTLRAKIDYGFAEARTTYGNIGVKVWIF-KGEVLHKGMQP
RS3_CAMFF       GGA--EMARTEWYLEGRVPLHTLRARIDYGFAEAHTTYGNIGVKVWIF-KGEVLQKGIQA
RS3_SULDN       GGA--EMARTEWYLEGRVPLHTLRAKIDYGFAEAHTTYGCIGVKVWIF-KGEVLTKGIPA
RS3_HELHP       AGA--EMARTEWYMEGRVPLHTLRAKIDYGFAEAMTTYGIIGVKVWIF-KGEVLHKGILP
RS3_WOLSU       AGA--EMARTEWYMEGRVPLHTLRAKIDYGFAEAMTTYGIIGAKVWIF-KGEVLQKGIQP
RS3_HELPY       AGA--EIARTEWYMEGRVPLHTLRAKIDYGFAEAMTVYGIIGVKVWIF-KGEVLQKGIQF
RS3_BDEBA       DGA--EIARSEWYNEKSVPLHTLRADIDYGTAESLTAYGIIGLKVWIY-KGDILSARE--
RS3_CLOD6       GGA--EMARTEGYSEGNVPLQTLRADIDYGFAEADTTYGKIGIKVWIC-NGEVLPTRDGV
RS3_CARHZ       AGA--EIARSEWYSEGKVPLTTLRADIDYGFAEALTTYGKIGVKVWIY-KGEVLPEV---
RS3_CALS4       AGA--EIARTERYHEGVVPLQTLRADIDYGFAEANTTYGKIGVKVWIN-KGEILPQP---
RS3_CLOPE       GGA--EIARTEQYNEGTIPLQTIRADIDYGFAEADTTYGKIGVKVWVY-NGEVLPTK---
RS3_CLONN       GGA--EIARTEQYHEGTIPLQTLRADIDYGFAEADTTYGKIGVKVWLY-KGEVLPTK---
RS3_CLOTE       GGA--DIARTEFYHEGTIPLQTLRADIDYGFAEADTTYGKIGVKVWVY-KGEVLPAK---
RS3_CLOAB       AGA--EIARTEQYHEGTIPLQTLRADIDYGFAEADTTYGKIGVKVWVY-NGEILPTK---
RS3_ACET2       AGA--EIARTEHYHEGTIPLQTLRADIDYGFAEANTTYGKLGVKVWIY-KGEVLPAV---
RS3_SYMTH       GGA--EIARSERAWEGTVPLHTLRADIDYGFAEADTTFGKIGVKVWIY-AGEAAQKAAAG
RS3_DESHY       GGA--EIARTEWYSEGKVPLHTLRADIDYGFAEANTTYGKIGVKVWIY-KGEVLPAKK--
RS3_MOOTA       AGA--EIARTEWYSEGKVPLHTLRADIDYGFAEANTTYGKIGVKVWIY-KGEVLPERA--
RS3_SYNWW       GGA--EIARTEWYAEGKVPLHTLRADIDYGFAEANTTYGKIGIKVWIN-RGEILPEAK--
RS3_KORVE       NGN--EIARSEWYLQGRLPLHTLRADIDYGFAEARTTYGVIGVKAWVY-KGEILPAAKKR
RS3_SOLUE       NGA--EIARSEWYLQGQLPLHTLRADIDYGFAEAHTTYGVIGIKAWLY-KGEILDLTKRR
RS3_THEMA       GGA--EIARREWYLRGRLPLQKIKAIIDYGTATAWTKYGTIGIKVWIY-KGDADI-----
RS3_RICBR       GGA--EIARTEWYIEGRMPLHTLRADIDYSTAEAITTYGVIGVKVWIY-KGEYTENKRYN
RS3_ANAPZ       GGA--EIARTEWYKEGSVPLHTFRANIDYSCVEAKTIYGIVGVKVWVY-VGDSRAVVE--
RS3_EHRRW       GGA--EIARTEWYKEGSVPLHTFRANIDYGFSEAKTIYGIIGVKVWVY-LGETKSSNE--
RS3_WOLPM       GGA--EIARTEWYKEGRLPLHTLRANIDYAFAEAKTIYGIIGVKVWVY-IGN--------
RS3_WOLTR       GGA--EIARTEWYKEGRLPLHTLRANIDYAFCEAKTIYGIIGVKVWVY-IVN--------
RS3_PELUB       GGN--EIARTEWLREGSIPSHTLRADIDYAEAEALTTFGIIGIKIWIY-KGEVFAKEFSQ
RS3_TREDE       GGA--EMSRTEEMKEGRVPLHTLRADIDYGFAEADTTYGKIGVKVWLY-SGMMFGGEQKE
RS3_TREPA       GGA--EMSRTEEIKEGRTPLHTLRADIDYGFAEAHTTYGSIGVKVWLY-SGMMYGNECRK
RS3_BORBU       GGA--EIARSFEVKEGRVPLHTLRANIDYGFSEAQTTYGIIGVKVWLF-KGEVLGRQTNS
RS3_LEPBL       NGA--DMARRENYKEGRIPLHTLRAKIDLGFKEAKTTFGQIGVKVWTY-SGDFIQSKEES
RS3_BACTN       NGA--EMARSEMYKEGRTPLHTFRADIDYCHAEALTKVGLLGIKVWICRGEVFGKK-ELA
RS3_PORGI       NGA--EMARSEMFKEGRTPLHTLRADIDYALAEALTKVGLLGIKVWICKGEVYEKR-DLA
RS3_GRAFK       NGA--EMARSESYKDGRIPLSTFRADIDYALVEAHTTYGRLGVKVWIMKGEVYGKR-ELS
RS3_CYTH3       GGA--EMARTDQYKEGRIPLHTLRADIDYAVSEALTVYGKIGIKVWIFKGEVYGKR-DLS
RS3_SALRD       GGA--EMGRTEEYMEGRVPLHTIRADIDFAQETALTIYGTIGVKVWIHRGEILGKP-DLS
RS3_CHLPD       GGA--EIARAEQYKEGKIPLHTIRANVDYASVTAHTIAGTIGIKVWVYKGEVLVQRIDAI
RS3_CHLL3       GGA--EIARAEQYKEGKIPLHTIRANVDYASVTAHTIAGTIGIKVWVYKGEVLNQRIDAI
RS3_CHLTE       GGA--EIARAEQYKEGKIPLHTLRANVDYASVTAHTIAGAIGIKVWVYKGEVLVQRLDAI
RS3_TROWT       GGA--EISRSEFYIEGQVPLQTLRASIDYGFYEARTPYGHIGVKVWIYK-----------
RS3_LEIXX       GGA--EMSRSEFYREGRVPLHTLRANIDYGFYEAKTTFGRLGVKVWMYKGDITNKELARV
RS3_ARTS2       GGA--EMSRSEFYREGRVPLHTLRANIDYGFYEAKTTFGRIGVKVWIYKGDVTSKELAQ-
RS3_BIFAA       GGA--EMSRSEFYREGCVPLQTLRALIDYGFFEAKTTYGRIGVKVWIYKGDMTEREFEEQ
RS3_CORDI       GGA--EMSRTERYHEGRVPLHTLRAEIDYGTYEAHTTFGRIGVKVWIYKGDVVGGRRE--
RS3_CORJK       GGA--EMGRTERYHEGRVPLHTLRAEIDYGTYEAHTTFGRIGVKVWIYKGDVVGGRRE--
RS3_MYCVP       GGA--EMSRSEFYREGRVPLHTLRADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRE--
RS3_RHOJR       GGA--EMSRSEFYREGRVPLHTLRADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRE--
RS3_MYCLE       GGA--EMSRSEFYREGRVPLHTLRADIDYGLHEAKTTFGRIGVKVWIYKGDIVGGKRE--
RS3_SACEN       GGA--EMSRSEFYREGRVPLHTLRADIDYGFFEARTTFGRIGVKVWIYKGELVGGLKQKQ
RS3_THEFY       GGA--EMSRSEFYREGRVPLHTLRADIDYGFFEARTTFGRIGVKVWIYKGEAPMTRAE--
RS3_FRACC       GGA--EMSRSEFYREGRVPLHTLRADIDYGFYEARTNFGRIGVKVWIYKGDIVQSRAE--
RS3_STRCO       GGA--EMSRSEFYREGRVPLHTLRANVDYGFFEAKTTFGRIGVKVWIYKGDVKNIAEV--
RS3_ACIC1       GGA--EMSRTEFYREGRVPLHTLRADIDYGFYEARTTFGRIGVKVWIYKGDVVAGRDH--
RS3_NOCSJ       NGA--EMSRTEFYREGRVPLHTLRADIDYGFYEARTTFGRIGVKVWIYKGEVAGTRAE--
RS3_CUTAK       GGA--EMSRSEGYREGRVPLHTLRADIDYGFFEARTTFGRIGVKVWIYKGDVTGTRAE--
RS3_RUBXD       GGI--EMSRSETVSEGKVPLHTLDADIDYGFKEANTQMGQIGVKVWINHGIHTDEER---
RS3_RHOBA       GGA--EMARREKQSAGSIPLSTLQAKIDYGFTEAMTPQGHIGIQVWINQGTYGDDNDG--
RS3_CHLMU       AGA--EIARSEWYKNGRVPLHTLRADIDYATASAETTYGIIGIKVWINLGEKKAVPAANH
RS3_CHLPN       AGA--EIARSEWYKNGRVPLHTLRADIDYATACAETTYGIIGIKVWINLGENSSSTTPNN
RS3_PARUW       GGA--EIARTEWYKEGSTPLHTLRADIDYATGRAETTYGSIGVKVWIYRGEDNLAKKEA-
RS3_DEHMC       GGV--EIARREVMHEGRVPLHTLRADIDYGCTRAHTALGDVGIKVWVY-RGDILPEAKEK
RS3_AQUAE       GGA--ELARKEWFLVGRMPLQTLRADIDYGFATAYTKYGILSVKVWIY-KGDVLNGR---
RS3_DEIGD       GGA--EQARTEKVLEGRVPLHTLRADIDYGTARAETTYGSLGIKVLVF-NGEVIGGKTET
RS3_THET8       GGA--EQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIF-LGEVIGGQKPK
RS3_BACCZ       GGA--DIARAESYSEGTVPLHTLRADIDYAAVEADTTYGKLGVKVWIY-RGEVLPTK---
RS3_ALKHC       GGA--DIARAEHYSEGTVPLHTLRADIDYGTAEADTTYGKLGVKIWIY-RGEVLPTK---
RS3_BACSU       GGA--DIARSEYYSEGTVPLHTLRADIDYATSEADTTYGKLGVKVWIY-RGEVLPTK---
RS3_LISW6       GGA--DIARAEHYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIY-RGEVLPTK---
RS3_GEOTN       GGA--DIARSEHYSEGTVPLHTLRADIDYATAEADTTYGKIGVKVWIY-RGEVLPTK---
RS3_OCEIH       GGA--DIARAEHYSEGTVPLHTLRADIDYGTAEADTTYGKLGVKVWIY-RGEVLPTK---
RS3_STAS1       GGA--DIARAEQYSEGTVPLHTLRADIGYAHAEADTTYGKLGVKVWIY-RGEVLPTK---
RS3_LACLA       NGA--DIARAEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIY-RGEVLPTK---
RS3_STRS2       NGA--DIARAEGYSEGTVPLHTLRADIDYAWEEALTTYGKLGVKVWIY-RGEVLPAR---
RS3_ENTFA       NGA--DIARSEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIY-RGEILPTK---
RS3_LEVBA       NGA--DMSRVESYAEGTVPLHTLRADIDYAWVEAHTTYGSLGVKTWIY-RGEILPE----
RS3_PEDPA       NGA--DMSRVERYSEGKVPLHTLRADVDYAWVEARTTYGQLGVKTWIY-RGEILPEVKDA
RS3_LACS1       NGA--DMSRVERFSEGTVPLHTLRADIDYSWVEAHTTYGKLGVKTWIY-RGEVLPAK---
RS3_LACSS       NGA--DMSRIETHAQGTVPLHTLRADIDYSWDEAMTTYGKLGVKTWIY-RGEVLPAKA--
RS3_LACP3       NGA--DIARREHYNEGLVPLHTLRADIDYAWEEAATTYGRIGIKTWIN-RGEILPEKP--
RS3_LACGA       NGA--DMARREWHTEGSVPLHTLRADIDYAWVEAATTYGQIGVKVWIN-RGEILPQRKNK
RS3_LACAC       NGA--DMARREWHTEGRVPLQTLRADIDYAWVNAFTTYGEIGVQVWIN-RGEILPTRKNK
RS3_LACDB       NGA--DIARREWHTEGSVPLHTLRADIDYAWVNAFTTYGEIGVKVWIN-RGEILPGRKNQ
RS3_LEUMM       NGA--DIARIEQYTEGTVPLHTLRADIDYSWDEAMTAYGNLGIKTWIY-RGDVLPQ----
RS3_OENOB       NGA--DIARKEQYTEGTVPLHTLRADIDYSWDEAMTSYGNLGIKTWIY-RGDAENGQFIK
RS3_FUSNN       NGA--EIARSEWAVEGKVPLHTLRADIDYAVATAHTTYGALGIKVWIF-HGEVLPSKKEG
RS3_NEOSM       SGA--EIARTEVFKEGSIPLHTMRADIDYWVAEAHTTYGVIGVKVWIY-RGNIFRV----
RS3_MYCMS       GGV--EMARTEGYLEGSVPLSTLRNNIDYALYEAPTTYGQIGVKVWIN-HGEVFK-----
RS3_MESFL       GGV--EMARTEGYIEGSVPLSTLRADIDYALYEAPTTYGQIGVKVWIN-HGEVIGGQSQR
RS3_MYCMO       NGV--DMARSEGYSEGEMKLHTLRQDVDFAMATARTTYGAIGVKVWVS-KGEFLDGN---
RS3_MYCPU       NGV--DMARTEGYTEGEMKLHTLRQKVDYAQATARTTYGAIGIKVWVS-LGEILDG----
RS3_MYCS5       NGV--DMARTEGYSEGEMKLHTLRQDVSYATATARTTYGAIGVKVWVS-LGEILQGD---
RS3_MYCH7       NGV--EMARCEGYAEGEMKLHTLRQNVEYATAIAKTTYGILGVKVWVS-LGEIKEKN---
RS3_MYCGE       NGA--EIARDKMYIEGNMPLSTLRADIDYAFEKAKTTYGIIGVKVWIN-RGMIYAKGLNR
RS3_MYCPN       NGA--EIARDKMYIEGNMPLSTLRADIDYALEKAQTTYGVIGVKVWIN-RGMIYTKGLNR
RS3_MYCGA       NGV--EIARDKMYIEGNVTLSTLRTDIDYALEEAQMSYGVIGVKVWIN-RGEIFGKDFYK
RS3_UREPA       GGV--EMAREEGYTQGVMTLHTLRADIDYSMQEAHTTYGIIGVKVWIN-RGELFGNKLVN
RS3_AYWBP       GGA--EIARSEGHAEGRVPLHTLRADIDYAAVEAHTTYGVLGIKVWIF-HGEVLPGQTIL
RS3_TRIV2       NGA--EIARTEWTREGRVPLHTLRADIDYSYCTAKTVYGILGIKVWVF-KGEIIPGQ-EV
RS3_TRIEI       NGA--EIARTEVTREGSVPLHTLRANIDYAYCTAKTIYGILGIKIWVF-KGEIIPGQ-EE
RS3_SYNE7       NGA--EIARTEWTREGRVPLHTLRADIDYAYTTATTTYGILGIKVWVF-RGEIIPGQ-ED
RS3_SYNY3       NGA--EIARTEWVREGRVPLHTLRADIDYAYRTALTTYGILGIKVWIF-KGEVIPGQ-EA
RR3_CYAPA       NGA--EIARSEWSREGRVPLQTLRAEIDYSYKRAQTIYGVLGVKVWIF-KGEVIPGN-PT
RS3_THEEB       NGA--EIARTEWTREGRVPLHTLRADIDYAYRTARTIYGILGVKVWIF-KGEVLPGQ-TE
RS3_SYNJA       NGA--EIARTEWTREGRIPLHTLRADIDYADHIAQTTFGVIGVKVWVF-KGEVLPGQ-ER
RS3_GLOVI       NGA--EIARSEWTREGRIPLHTLRADIDYAYKIAQTTYGTLGVKVWIF-RGEILPGA-GG
RS3_PROMA       NGA--EIARSEWTREGRVPLHTLRAEIDYANKTANTTYGVLGIKVWVF-KGEVLSKE-EQ
RS3_PROM5       NGA--EIARSEWTREGRVPLHTLRAEVDYALREANTTYGVLGIKVWVF-KGEVLPKE-EQ
RS3_SYNS3       NGA--EIARTEWTREGRVPLHTLRAEIDYATKVASTTYGVLGIKVWVF-KGEVLSDDSQQ
RR3_TRICV       NGA--EIARSEWIREGRVPLQTLRADIDYATKEAHTIYGVLGVKVWLF-KSEILAK----
RR3_THAPS       NGA--EMARSEWIREGRVPLQTLRADIDYATKEANTIYGVLGVKVWLF-KNEILKK----
RR3_PHATC       NGA--EIARSEWIREGRVPLQTLRADIDYATQEANTIYGVLGIKVWLF-KSEILSK----
RR3_PORPU       NGA--EIARSEWVREGRVPLQTLRADIDYCHRQAHTTYGVLGVKVWLF-KGELLPDSKVV
RR3_PYRYE       NGA--EIARSEWVREGRVPLQTLRADIDYCHRQAHTTYGVLGVKVWLF-KGEILPESKSL
RR3_GRATL       NGA--EIARSEWVREGRVPLQTLRAHIDYSYKTAHTIYGILGVKVWLF-KGEKIITDKVD
RR3_GUITH       NGA--EIARSEWVREGRVPLQTLRANIDYATKEAHTTYGILGIKVWVF-NGEQTPTYAVI
RR3_CYACA       NGA--EIARTEWIREGRVPLQTLKADLDYATSSAYTSFGVVGVKVWIF-KG---------
RR3_EMIHU       NGA--EMARDEWVREGRVPLQTLRADISYATARAYTTYGVLGIKVWIF-NKEII------
RR3_CYAM1       NGA--EIARSEWVRHGQIPLQTLRAPINYAIANAYTTYGVIGVKVWIN-PKH--------
RR3_OLTVI       NGA--EIARSEWIRTGRVPLQTLRADVDYCHREAKTIYGILGIKVWTF-KGEIKPVRKAV
RR3_TUPAK       NGA--EIARSEWVRKGRVPLQTLRADIDYSAKTAKTIYGILGIKVWAF-KGERT------
RR3_CHLVU       NGA--DIARSEDVREGPVPLQTLRADIDYSSKPAKTIFGLLGIKIWVF-RGERLTRISNV
RR3_MESVI       NGA--EIARSEWVREGRVPLQTLRADIDYSHCQAKTIYGIIGIKVWIF-KGEKISIN---
RR3_CHLAT       NGA--EIARSEWVREGRVPLQTLRANIDYSYCQAKTIYGILGIKVWMF-KGEKFSSKAVT
RR3_NEPOL       NGA--EIARSEWVREGRVPLHTLRADVDYCDCTAQTIYGVLGIKVWIF-RGEIRPVRQVL
RR3_OSTTA       NGA--EIARHEWAREGRVPLHTIRADIDYATARAQTIYGILGIKVWVC-KGEKSC-----
RR3_EUGGR       NGI--EIARTEWFREGRVPLHTLRADIDYFNDIAHTIYGVLGIKVWVY---KV-------
RR3_CALFG       DGK--EIARVEWIREGRVPLQTIRAKIDHCSYTVRTIYGVLGIKIWIFVDEQ--------
RR3_PHAAO       DGK--EIARVEWIREGRVPLQTIRAKIDHCSHTVRTIYGILGIKIWIFVNQE--------
RR3_ACOCL       DGK--EIARVEWIREGRVPLQTIRAKIDHCFHKVQTIYGVLGIKIWIFVDEE--------
RR3_NUPAD       NGN--EIARVEWIREGRVPLQTIRVKIDHCSYPVRTIYGVLGIKIWIFLDEE--------
RR3_AMBTC       NGK--EIARVEWIREGRVPLHTIRAKIDYCSYMVQTIYGVLGIKIWIFVDEE--------
RR3_PIPCE       DGK--EIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGILGIKIWIFLDEK--------
RR3_CITSI       DGK--EIARAEWIREGRVPLQTIGAKIDYCSYTVRTIYGVLGIKIWIFVDEKK-------
RR3_EUCGG       DGK--EIARVEWMREGRVPLQTIRAKIDYCSYGVRTVYGVLGIKIWIFWE----------
RR3_GOSHI       DGK--EIARVEWIREGRVPLQTIGAKIEYCSYRVRTIYGVLGIKIWIFIDEE--------
RR3_CUCSA       DGK--EIARVEWIREGRVPLQTIRAKIDYCCYPVRTIYGILGIKIWIFVDEQ--------
RR3_MORIN       DGK--EIARVEWIREGRVPLQTIKAKIDYCSYTVRTIYGALGIKIWIFVDE---------
RR3_DAUCA       DGK--EIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFLDGE--------
RR3_COFAR       DGK--EIARVEWIRRGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDEE--------
RR3_PLAOC       DGK--EIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFVDEE--------
RR3_SPIOL       DGK--EIARIEWIREGRVPLQTIRAKIDYCAYTVRTIYGVLGIKIWIFMGEE--------
RR3_RANMC       DGK--EIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGALGIKIWIFAGEE--------
RR3_POPTR       DGK--EIARAEWVREGRVPLQTLRAKINYCSYTVRTIYGVLGIKIWIFVDEE--------
RR3_PHAVU       DGK--EIARVEWIREGRVPLQTIRAKIEYCCYTVRTIYGILGIKVWIFSK----------
RR3_LOTJA       DGK--EIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKVWIFLNKE--------
RR3_OENEH       NGG--EIARVLWMKEGRVPLQTIRAKIDYCVYTVRTIHGLLGIKIWIFRED---------
RR3_JASNU       NGK--DIARVEWIRRGRLPLQTIRTKIDYCCYTIRTIYGVLGIKIWIFIDEK--------
RR3_EPIVI       DGK--EIARVEWIREGRVPLQTIQAKINYCSYMVRTTHGVLGIKIWIFIEKE--------
RR3_MAIZE       AGK--EIARAECIKKGRLPLQTIRAKIDYCCYPIRTIYGVLGVKIWIFVEEE--------
RR3_PELHO       GGKAQEMARVEWLRKGRVPLQTVTAKIDFCSTQVITIRGVLGIKVWIF------------
RR3_ANTAG       NGA--EIARVEWAREGRVPLQTIRAQINYCYYPAQTIYGVLGIKVWIFQTEE--------
RR3_PHYPA       NGA--EIARVEWAREGRVPLQTLRAKIDYCYYPAQTIYGVLGIKIWIFQDEK--------
RR3_MARPO       NGA--EIARVEWAREGRVPLQTIRARINYCYYAAQTIYGVLGIKVWIFQDEE--------
RR3_HUPLU       NGT--EIARVEWAREGRVPLQTLRAQIDYCYYPAQTIYGVLGIKIWIFRDEE--------
RR3_PINTH       DGK--EIARVEWDRGGRVPLQTIRARIDYCYYPVKTIYGVLGIKIWILEE----------
RR3_ADICA       NGS--EMARVEWAREGRVPLQTVEANISYCYHPAQTIYGVLGIKIWVFRDT---------
RR3_PSINU       NGI--EIARVEWTREGRVPLQTIRAHINYYYYPAKTIYGILGIKVWIYQNDE--------
RR3_STAPU       NGA--EIARSEWAREGRVPLQTLRAQIDYCHYPAHTIYGVLGIRVWIFQEK---------
RR3_ZYGCR       NGA--EIARVEWAREGRVPLHTLRAQIDYCHYPAQTIYGVLGIKVWVFQNKSLISNNQQM
RR3_CHAVU       NGA--EIARNEWIQKGRLPLQMLRANIHYCHYPAHTIYGVLGIKVWIFREKII-------
RR3_CHAGL       NGA--EIARVEWAREGRVPLQTLRAKIDYCHYPAQTKYGVLGIKVWIFQGEGWT------
RR3_EUGLO       NDA--EMAREESFREGKVPLNTLKANIDYFHCTAKTLSGSLGIKVWLNK-----------
RR3_BIGNA       NGI--EMARSEWVREGRIPLQTLTANIGYYNDVAETKYGLLGVKVWVYKNKS--------
RS3_CARRP       EGV--DIARKEWSLIGRIPLHTIKYNLEYYQCETLTQYGILGVKIWLFKKNNEK------
RR3_HELSJ       NGV--DKATVIVEEKGKMPLQNLSSEINYYSRALKTVYGLLGVKIWVF-KGFLLK-----
                 .   : .              .   :           *  . :                

RS3_ACIBT       MNPAPAEE----------------------------------RPAKRGRGRGEGQERRGR
RS3_PSYCK       YNPVKEEQ----------------------------------TRAPKRRGRGNGNRRNTD
RS3_PSEU5       LKPQAP--------------------------------------APRKKAAK--------
RS3_SACD2       EANQ------------------------------------------KKKGSK--------
RS3_HAHCH       RAEKK---------------------------------------AAKKKSSK--------
RS3_MARHV       RADKK---------------------------------------ASGKKGSK--------
RS3_CHRSD       RAKQKQAQ----------------------------------APAPKKKGSR--------
RS3_ALCBS       QEEQKQSK------------------------------------GAKKRGRG--------
RS3_BLOFL       HIDKSKDS----------------------------------LINDFSKKKRKSRV----
RS3_BLOPB       NTGYSSDQ----------------------------------TINNSSKKKHKTRI----
RS3_BUCAP       EK-LEKSS------------------------------------IQIKKQHRKNRK----
RS3_BUCBP       PK-IEKQK----------------------------------PMSQLKKHQRRYRK----
RS3_BUCCC       SN-KKDKK----------------------------------PFISVKKVSQKYRK----
RS3_WIGBR       IN-EKKYM----------------------------------PTKKGNKKIRKYTKE---
RS3_BAUCH       EP-TIESI------------------------------------TPPKTQQRKGRK----
RS3_ECOLI       EQ---PEK----------------------------------PAAQPKKQQR-KGRK---
RS3_HAES1       AQQ--PEQ----------------------------------QPATPKKAPRGKGRK---
RS3_AERS4       NAAAAQEQ----------------------------------APAKPKRDNKRRGK----
RS3_PHOPR       EP----------------------------------------KADKPKKQRKSRK-----
RS3_IDILO       EK------------------------------------------PAPKRGKNRK------
RS3_PSET1       QE----------------------------------------QEKPAKRAPKKAKKSAK-
RS3_PSEA6       QE----------------------------------------QPAQPKKKGRSPKREG--
RS3_PSYIN       VE----EQ----------------------------------QPSKPKRKSRGK------
RS3_COLP3       AEV---------------------------------------PAAKPKRKTNRKPK----
RS3_SHEFN       IEE---------------------------------------PKQQPKRKPRGK------
RS3_SHELP       LEE---------------------------------------PKQQPKRKPRGK------
RS3_HYDCU       SD------------------------------------------DKKQSKGKKGRK----
RS3_AROAE       AVVENEN--------------------------------------EARRGRR--------
RS3_AZOSB       VVAEPEA--------------------------------------DNRRGRRG-------
RS3_DECAR       VAEEPAA--------------------------------------DDRRPRRT-------
RS3_NEIG1       KPEHESK--------------------------------------QRKAGRRN-------
RS3_CHRVO       TPAAPEK--------------------------------------KMRKGARN-------
RS3_BORA1       VETAAPR-------------------------------------EEERRPRRAPRG---D
RS3_METPP       VIKTDER-------------------------------------EDDRRNRRGPRS---D
RS3_PARXL       VVEEVAE---------------------------------------EKRPRRN------A
RS3_RALSO       VVEEPQE---------------------------------------ERR-KRP------G
RS3_ACISJ       AAETPRP-------------------------------------EEERRPRGPRRD---G
RS3_POLSJ       GAKLDAAP-----------------------------------SDEERKPRGPRRD---A
RS3_RHOFT       AAVEART-------------------------------------DEERRPRGPRRDDRGA
RS3_THIDA       AAAEQEK-----------------------------------------RGKKS-------
RS3_NITEC       N-----------------------------------------------------------
RS3_NITMU       GAGTAAPQVL-----------------------------PPAGEPETRRPPRRPAGRADA
RS3_METFK       AAQPAEPE----------------------------------------------------
RS3_METCA       --EPKTR---------------------------------------SAVEA---------
RS3_NITOC       --QVAAG---------------------------------------SSAIS---------
RS3_ALKEH       -PAAGGE---------------------------------------GARQGKG-------
RS3_HALHL       APAERVK---------------------------------------RAAAAQG-------
RS3_XANOM       -QEKQDD---------------------------------------SPRNDRNDRGDRGD
RS3_XYLFT       -QEKQDD---------------------------------------GSRGDRN-----AD
RS3_LEGPL       -TESAQ------------------------------------------------------
RS3_COXBU       -EEAAPQ---------------------------------------ETEEEVK-------
RS3_FRATN       -KKNNKK---------------------------------------GAK-----------
RS3_RUTMC       LDEVARR---------------------------------------GATNQIAQKIK---
RS3_BARQU       SERRSVEID-----------------------------------HSGSSSN---------
RS3_BARBK       SEHRATRND-----------------------------------NSSSSLN---------
RS3_BRUME       SERRAVEGD-----------------------------------NQGSSSN---------
RS3_RHILO       SERRATEGD-----------------------------------AAHGGGGDR-------
RS3_CHESB       SERRAVEGA-----------------------------------GDGGGQ----------
RS3_AGRFC       SERRGLEGD-----------------------------------AQGPASRERG------
RS3_NITHX       QDKRLAGDD-----------------------------------NR--------------
RS3_RHORT       QDKRSQDQ---------------------------------------GR-----------
RS3_MAGSA       QDKRAAGET-----------------------------------APAGR-----------
RS3_GRABC       QDRRAAEQA-----------------------------------P--QR-----------
RS3_CAUVC       LDKRLATES-----------------------------------GPAGEGGGRERGDRPD
RS3_RHOS1       HDRRHSEAQ-----------------------------------E-GAAPRP--------
RS3_PARDP       RDRRATEAQ-----------------------------------D-GPSPRG--------
RS3_ROSDO       RDRKAQELQ-----------------------------------D-GPAPR---------
RS3_JANSC       HDRRQQELQ-----------------------------------ESGGASR---------
RS3_ZYMMO       QDRLMVEAQ-----------------------------------TSGVRPTR--------
RS3_SPHAL       TDRLMLDAQ-----------------------------------TTGVRPAR--------
RS3_ERYLH       QDRLMMEAQ-----------------------------------TSGVRPAR--------
RS3_NOVAD       QDRLMMEAQ-----------------------------------TSGVRPAR--------
RS3_HYPNA       QDKRLETSG-----------------------------------QSRARANTNQR-----
RS3_MARMM       QERRLQESG-----------------------------------EQRAR-----------
RS3_MAGMM       ------------------------------------------------------------
RS3_DESVV       ------------------------------------------------------------
RS3_DESAG       ------------------------------------------------------------
RS3_LAWIP       ------------------------------------------------------------
RS3_SYNFM       ------------------------------------------------------------
RS3_GEOSL       ------------------------------------------------------------
RS3_PELPD       ------------------------------------------------------------
RS3_PELCD       ------------------------------------------------------------
RS3_SYNAS       EKP---------------------------------------------------------
RS3_ANADE       RAPRTTGGAR-----------------------------P--------------------
RS3_MYXXD       QAPMPSNR----------------------------------------------------
RS3_DESPS       AVAQ--------------------------------------------------------
RS3_CAMJR       EKTEE-----------------------------------SAPAKKPR-RTRRGK-----
RS3_CAMFF       DKNED-----------------------------------TSP-KKPR-RARRGK-----
RS3_SULDN       EVKEEQQKEG-----------------------------ARRPKRAPK-RENSGKAE---
RS3_HELHP       EKKEE----------------------------------SKSGDKEVRSKSRRGRQ----
RS3_WOLSU       EKKEE----------------------------------APARDKEGRGTRRRGRQ----
RS3_HELPY       EKKEE----------------------------------AKE-EREPR-RSRRGRQ----
RS3_BDEBA       --VEEAG-------------------------------------RVKS------------
RS3_CLOD6       NPREESR-------------------------------------KSDRRDNKRDNRRNDR
RS3_CARHZ       -KKES---------------------------------------VSTEGGE---------
RS3_CALS4       -KKQ----------------------------------------VTAEGGK---------
RS3_CLOPE       -KVEK-----------------------------------------KEEANA--------
RS3_CLONN       -KVRT-----------------------------------------EEISQ---------
RS3_CLOTE       -KEVK-----------------------------------------EEVNA---------
RS3_CLOAB       -KIEK-----------------------------------------KEEANA--------
RS3_ACET2       -KKDKG--------------------------------------RKEEISNVNA------
RS3_SYMTH       DRRERG--------------------------------------ERRERGGRRGGRGRGQ
RS3_DESHY       -VAQ------------------------------------------VEGGK---------
RS3_MOOTA       -RVR------------------------------------------EGGSK---------
RS3_SYNWW       -QRPKEPKQ----------------------------------KEMEEAGR---------
RS3_KORVE       ------------------------------------------------------------
RS3_SOLUE       NLLPEPEPRR-----------------------------EQRRDRPDRRDRDGRGGDRDR
RS3_THEMA       ------------------------------------------------------------
RS3_RICBR       ------------------------------------------------------------
RS3_ANAPZ       ------------------------------------------------------------
RS3_EHRRW       ------------------------------------------------------------
RS3_WOLPM       ------------------------------------------------------------
RS3_WOLTR       ------------------------------------------------------------
RS3_PELUB       ETNKIVPKEV-----------------------------KE-------------------
RS3_TREDE       DAGALLKK--------------------------------------QRRPRT--------
RS3_TREPA       DVGSLLRR--------------------------------------SRRESG--------
RS3_BORBU       DAGQVINKKPFRERGDA---------------------VKNFDKTLNNREKANEKQTRLL
RS3_LEPBL       EEDKYAVK---------------------------------------RRTS---------
RS3_BACTN       PNFTQSK-ESGRGNN-------------------------GGNN-GGKNFKR--------
RS3_PORGI       PNFAVAKNQSRRPNAQ------------------------GGNNRGGDRNRR--------
RS3_GRAFK       PLVGLAKNQGKK----------------------------SGAGRGGNKSRR--------
RS3_CYTH3       PNVGNAASGASSSSNND----------------------NASPNQGGPRRKRG-----GE
RS3_SALRD       PNVQAQQRKMKE----------------------------------SPQQRR--------
RS3_CHLPD       EEDELKRINERRGDSKS----------------------RPR-DPRNKRRRR--------
RS3_CHLL3       EEEEMKRIKERRSDSGP----------------------RSR-NDRSQKRRR--------
RS3_CHLTE       EEEEMKKMQERRGDSRG----------------------RGRGDGRGAKRRR--------
RS3_TROWT       ----KPS-------------------------------------VRGRTEGG--------
RS3_LEIXX       QANVKPSRER---------------------------------NDRPRRGGR--------
RS3_ARTS2       QAAAAPSRGRGA-------------------------------SDRPGRPGG--------
RS3_BIFAA       QAQQSNNRQGRR-------------------------------GDRRPRRGQ--------
RS3_CORDI       SEINAPAERRGR------GDRNGRPRRG-----------------GQRRQRS--------
RS3_CORJK       SLMNARDERPSR------GRRE-RPRRG-----------------GARRQRA--------
RS3_MYCVP       LTA--AAPAADR------PRRD-RPSGT-----------------RPRRSGA--------
RS3_RHOJR       LAANVAAPAGDR------PRRE-RPS-------------------RPRRSGA--------
RS3_MYCLE       VTA-VAPAGAER------ARRE-RPSGT-----------------RPRRSGA--------
RS3_SACEN       QESEVRPPRGER------GERGGRPERG-----------------GRRRSGA--------
RS3_THEFY       REAAQAAQRAAG------PQRRERPG-------------------RRRRGGG-----GGG
RS3_FRACC       REAQEALQRQTRRER---PRRGPRSGSSGTTQGGTEAGRAAARGERRGRGGG-----GGN
RS3_STRCO       RAENAAARAGNR------PARGGGND-------------------RPARGGR-----GGE
RS3_ACIC1       EAARVAARVQQRAVRGRSARREQPAAESPALETAAPAVAEPGAAAAPAAAGADVPVVADT
RS3_NOCSJ       RQAQAAARAGVPGR----GGRPQRGGE------------------RPSRGSR------GD
RS3_CUTAK       RAAQKAARQAAQ------GGRGGRGGN------------------RRGRGDR--------
RS3_RUBXD       ------------------------------------------------------------
RS3_RHOBA       --ADAQTGQASK---------------------------------KPKRSYKR-------
RS3_CHLMU       AGAASTAAA---------------------------------------------------
RS3_CHLPN       PAAPSAAA----------------------------------------------------
RS3_PARUW       ------------------------------------------------------------
RS3_DEHMC       SESEVTEMAAVMADAPA------------------AVVTETKVADIAAKPKRVVKKAEAE
RS3_AQUAE       ------------------------------------------------------------
RS3_DEIGD       L-------------------------------------------ARPPRKSDERRREDGE
RS3_THET8       --------------------------------------------ARPELPKAE------E
RS3_BACCZ       ---------------------------------------------KKASEEGGK------
RS3_ALKHC       ---------------------------------------------GKNKKEGGN------
RS3_BACSU       ---------------------------------------------KKN-EEGGK------
RS3_LISW6       ---------------------------------------------KNN-VEGGK------
RS3_GEOTN       ---------------------------------------------KKA-EEGGK------
RS3_OCEIH       ---------------------------------------------TDK------------
RS3_STAS1       ---------------------------------------------NTS--EGGK------
RS3_LACLA       ----------------------------------------------KSV-KGEK------
RS3_STRS2       ----------------------------------------------KNT-KGGK------
RS3_ENTFA       ----------------------------------------------KNTEKGGK------
RS3_LEVBA       --------------------------------------------KKQSNGQGGK------
RS3_PEDPA       --------------------------------------------KKNSKEQGGK------
RS3_LACS1       ----------------------------------------------KENSKGGK------
RS3_LACSS       ----------------------------------------------NNNTKGGK------
RS3_LACP3       ---------------------------------------------KQNSVKGGK------
RS3_LACGA       --------------------------------------------P-SKKTKGGN------
RS3_LACAC       --------------------------------------------PASKPAKGGNR-----
RS3_LACDB       --------------------------------------------P-AKRSKGGKK-----
RS3_LEUMM       --------------------------------------------KKNSK-----------
RS3_OENOB       DED--------VAAAAN------------------NRGRGNNRGRGNSRQNGGRSRRPRQ
RS3_FUSNN       GEA---------------------------------------------------------
RS3_NEOSM       ------------------------------------------------------------
RS3_MYCMS       ---KERMN------------------------------------NSQIMAKPRTNKGGKR
RS3_MESFL       VSEKAPMN------------------------------------NDRRFNNKNNNRGGRK
RS3_MYCMO       --------------------------------------------GEKNVTTEKN------
RS3_MYCPU       --------------------------------------------GKQ-------------
RS3_MYCS5       --------------------------------------------RTFHHASTKKN-----
RS3_MYCH7       --------------------------------------------DIDAIIRADKRR----
RS3_MYCGE       TPAHILHPQKKQ-------------------------LKTPTIKKTNSVIAKQKLTGSDI
RS3_MYCPN       TPAHILHPQKKQPNRQ---------------------NQQPRHFNQGQVLSANKLTGSDV
RS3_MYCGA       KQAHIVKPKGSE----------------------------ANHQRRNSNKSKDYRDNKNK
RS3_UREPA       SVAHAANKEFSR----------------------------SSKPKKGSFNRSSR--SKNT
RS3_AYWBP       DTRKLFAS------------------------------------QSSNNPNRRPRNFKGG
RS3_TRIV2       AAPPPSTRDRDRDRGDRDREPRRRQQQRRRQQFEDRSNEG--------------------
RS3_TRIEI       IANAKVN------------QPKRRQQ-KRRQQYDDRSNEG--------------------
RS3_SYNE7       AAPSNVG------------QPRRRNQQRRRQQFEDRSNEG--------------------
RS3_SYNY3       AIVAPPS------------QPRRKSR---RQQFDDRSQDG--------------------
RR3_CYAPA       EISE--------------------------------------------------------
RS3_THEEB       AVPREAT---------------RRSPQRRLPQFENRSN----------------------
RS3_SYNJA       PEQKVPLQ-----------QPKRRQQ-RRRPTFEDRSAVEA-------------------
RS3_GLOVI       PAAAPEEVAAQP-------KPDQRPRRRKKIQYEERTDEQ--------------------
RS3_PROMA       PLPVGAS--------------PRRKGNRRPQQFEDRSNDGK-------------------
RS3_PROM5       TIPVGAI--------------PRRKGSRKPQQFEDRSSNENS------------------
RS3_SYNS3       QIPVGAN--------------PRRRAGRRPQQFEDRSNEG--------------------
RR3_TRICV       ------------------------------------------------------------
RR3_THAPS       ------------------------------------------------------------
RR3_PHATC       ------------------------------------------------------------
RR3_PORPU       ELAPSQDQINPDVS----------------------------------------------
RR3_PYRYE       ESAYNQETPDSTAS----------------------------------------------
RR3_GRATL       N-----------------------------------------------------------
RR3_GUITH       ------------------------------------------------------------
RR3_CYACA       ------------------------------------------------------------
RR3_EMIHU       ------------------------------------------------------------
RR3_CYAM1       ------------------------------------------------------------
RR3_OLTVI       EVPVA-------------------------------------------------------
RR3_TUPAK       ------------------------------------------------------------
RR3_CHLVU       R-----------------------------------------------------------
RR3_MESVI       ------------------------------------------------------------
RR3_CHLAT       T-----------------------------------------------------------
RR3_NEPOL       APGT--------------------------------------------------------
RR3_OSTTA       ------------------------------------------------------------
RR3_EUGGR       ------------------------------------------------------------
RR3_CALFG       ------------------------------------------------------------
RR3_PHAAO       ------------------------------------------------------------
RR3_ACOCL       ------------------------------------------------------------
RR3_NUPAD       ------------------------------------------------------------
RR3_AMBTC       ------------------------------------------------------------
RR3_PIPCE       ------------------------------------------------------------
RR3_CITSI       ------------------------------------------------------------
RR3_EUCGG       ------------------------------------------------------------
RR3_GOSHI       ------------------------------------------------------------
RR3_CUCSA       ------------------------------------------------------------
RR3_MORIN       ------------------------------------------------------------
RR3_DAUCA       ------------------------------------------------------------
RR3_COFAR       ------------------------------------------------------------
RR3_PLAOC       ------------------------------------------------------------
RR3_SPIOL       ------------------------------------------------------------
RR3_RANMC       ------------------------------------------------------------
RR3_POPTR       ------------------------------------------------------------
RR3_PHAVU       ------------------------------------------------------------
RR3_LOTJA       ------------------------------------------------------------
RR3_OENEH       ------------------------------------------------------------
RR3_JASNU       ------------------------------------------------------------
RR3_EPIVI       ------------------------------------------------------------
RR3_MAIZE       ------------------------------------------------------------
RR3_PELHO       ------------------------------------------------------------
RR3_ANTAG       ------------------------------------------------------------
RR3_PHYPA       ------------------------------------------------------------
RR3_MARPO       ------------------------------------------------------------
RR3_HUPLU       ------------------------------------------------------------
RR3_PINTH       ------------------------------------------------------------
RR3_ADICA       ------------------------------------------------------------
RR3_PSINU       ------------------------------------------------------------
RR3_STAPU       ------------------------------------------------------------
RR3_ZYGCR       ------------------------------------------------------------
RR3_CHAVU       ------------------------------------------------------------
RR3_CHAGL       ------------------------------------------------------------
RR3_EUGLO       ------------------------------------------------------------
RR3_BIGNA       ------------------------------------------------------------
RS3_CARRP       ------------------------------------------------------------
RR3_HELSJ       ------------------------------------------------------------
                                                                            

RS3_ACIBT       RGDRAADKGE--------------------------------------------------
RS3_PSYCK       RG----------------------------------------------------------
RS3_PSEU5       ------------------------------------------------------------
RS3_SACD2       ------------------------------------------------------------
RS3_HAHCH       ------------------------------------------------------------
RS3_MARHV       ------------------------------------------------------------
RS3_CHRSD       ------------------------------------------------------------
RS3_ALCBS       ------------------------------------------------------------
RS3_BLOFL       ------------------------------------------------------------
RS3_BLOPB       ------------------------------------------------------------
RS3_BUCAP       ------------------------------------------------------------
RS3_BUCBP       ------------------------------------------------------------
RS3_BUCCC       ------------------------------------------------------------
RS3_WIGBR       ------------------------------------------------------------
RS3_BAUCH       ------------------------------------------------------------
RS3_ECOLI       ------------------------------------------------------------
RS3_HAES1       ------------------------------------------------------------
RS3_AERS4       ------------------------------------------------------------
RS3_PHOPR       ------------------------------------------------------------
RS3_IDILO       ------------------------------------------------------------
RS3_PSET1       ------------------------------------------------------------
RS3_PSEA6       ------------------------------------------------------------
RS3_PSYIN       ------------------------------------------------------------
RS3_COLP3       ------------------------------------------------------------
RS3_SHEFN       ------------------------------------------------------------
RS3_SHELP       ------------------------------------------------------------
RS3_HYDCU       ------------------------------------------------------------
RS3_AROAE       -APRNDAGDNRGAKRPARRTGAEQAGAGDKAGTRTRKAGVDDAAAVEKEVS---------
RS3_AZOSB       -APRNDGGEGRPGRRPARR----GDGQGRQEDSRSE------------------------
RS3_DECAR       -PGRPDG--DKPRTRTVKK----VDGAADPA-KRVRKAGA--------------------
RS3_NEIG1       -AAAN-------------------------------------------------------
RS3_CHRVO       -AAAN-------------------------------------------------------
RS3_BORA1       RPDGARN--GRPGGGRG-----RAPRKADAAPAPEGE-----------------------
RS3_METPP       RPAGDRRPPSRDGARPGP----RGPRADAGAAAPTDKPADGAAPAAADGPKAAVKRVRKA
RS3_PARXL       RPGGDRRP-RRDGEGGG----------PAGARRGAPRRAGG----------------AG-
RS3_RALSO       RPEGRR----REGEGR-----------PGGQRRGAGAGGRR----------------SGG
RS3_ACISJ       RPGDRAGA-GRGGRRP----MGTNAAPADGSDKPAGAGGDS---------VKRVKS-APA
RS3_POLSJ       RPGSDRPA-PRGARAPRAPAGGTNTAPADGSDKPAEATPGSDAPKTT---VKRVRK-AAP
RS3_RHOFT       RPGADRPA-PRVARRP---PMGANTAPSDGSDKPAEATGAG-APKPA---VQRVRKVAAP
RS3_THIDA       -----------------------------GVKHAAAS-----------------------
RS3_NITEC       ------------------------------------------------------------
RS3_NITMU       RSDGKAGEKKGPRKSDNSSEESATKPAKKPVKPGVNDAAAS-------------------
RS3_METFK       ---------------------------KKVRKSGAKNAATS-------------------
RS3_METCA       ------------------------------------------------------------
RS3_NITOC       ------------------------------------------------------------
RS3_ALKEH       ------------------------------------------------------------
RS3_HALHL       ------------------------------------------------------------
RS3_XANOM       RPSRPAREAR--------------------------------------------------
RS3_XYLFT       RSSRRSREVR--------------------------------------------------
RS3_LEGPL       ------------------------------------------------------------
RS3_COXBU       ------------------------------------------------------------
RS3_FRATN       ------------------------------------------------------------
RS3_RUTMC       ------------------------------------------------------------
RS3_BARQU       -----RRRENA-------------------------------------------------
RS3_BARBK       -----RRRESV-------------------------------------------------
RS3_BRUME       -----RRRENA-------------------------------------------------
RS3_RHILO       --ERGRRRENA-------------------------------------------------
RS3_CHESB       -----RRRENA-------------------------------------------------
RS3_AGRFC       -DRPDRRRENA-------------------------------------------------
RS3_NITHX       -----PRRDAA-------------------------------------------------
RS3_RHORT       ------------------------------------------------------------
RS3_MAGSA       ------------------------------------------------------------
RS3_GRABC       ------------------------------------------------------------
RS3_CAUVC       RGDRRDRRDRA-------------------------------------------------
RS3_RHOS1       -----PRRDRERA-----------------------------------------------
RS3_PARDP       -----PRRDRDRDAR---------------------------------------------
RS3_ROSDO       -----GAGGRR-------------------------------------------------
RS3_JANSC       -----PRRDR--------------------------------------------------
RS3_ZYMMO       ------------------------------------------------------------
RS3_SPHAL       -----EDRR---------------------------------------------------
RS3_ERYLH       ------------------------------------------------------------
RS3_NOVAD       ------------------------------------------------------------
RS3_HYPNA       --GPASGAQAAGA-----------------------------------------------
RS3_MARMM       -----SGRQAA-------------------------------------------------
RS3_MAGMM       ------------------------------------------------------------
RS3_DESVV       ------------------------------------------------------------
RS3_DESAG       ------------------------------------------------------------
RS3_LAWIP       ------------------------------------------------------------
RS3_SYNFM       ------------------------------------------------------------
RS3_GEOSL       ------------------------------------------------------------
RS3_PELPD       ------------------------------------------------------------
RS3_PELCD       ------------------------------------------------------------
RS3_SYNAS       ------------------------------------------------------------
RS3_ANADE       ------------------------------------------------------------
RS3_MYXXD       ------------------------------------------------------------
RS3_DESPS       ------------------------------------------------------------
RS3_CAMJR       ------------------------------------------------------------
RS3_CAMFF       ------------------------------------------------------------
RS3_SULDN       ------------------------------------------------------------
RS3_HELHP       ------------------------------------------------------------
RS3_WOLSU       ------------------------------------------------------------
RS3_HELPY       ------------------------------------------------------------
RS3_BDEBA       ------------------------------------------------------------
RS3_CLOD6       RGNDRRGNDNRGNYRGQRPQGGSRPQRTENKGN---------------------------
RS3_CARHZ       ------------------------------------------------------------
RS3_CALS4       ------------------------------------------------------------
RS3_CLOPE       ------------------------------------------------------------
RS3_CLONN       ------------------------------------------------------------
RS3_CLOTE       ------------------------------------------------------------
RS3_CLOAB       ------------------------------------------------------------
RS3_ACET2       ------------------------------------------------------------
RS3_SYMTH       GGQRMSREERAALERAAIEAGPKPVNREGGQ-----------------------------
RS3_DESHY       ------------------------------------------------------------
RS3_MOOTA       ------------------------------------------------------------
RS3_SYNWW       ------------------------------------------------------------
RS3_KORVE       --------------------EPQVATAGNF------------------------------
RS3_SOLUE       GGDRGGYRGGDRGDRPPVQSAPPVEATGPAVQTPPSDLPRPAARPVAPILPPLMAPQQPS
RS3_THEMA       ------------------------------------------------------------
RS3_RICBR       ------------------------------------------------------------
RS3_ANAPZ       ------------------------------------------------------------
RS3_EHRRW       ------------------------------------------------------------
RS3_WOLPM       ------------------------------------------------------------
RS3_WOLTR       ------------------------------------------------------------
RS3_PELUB       ------------------------------------------------------------
RS3_TREDE       EKPAQAGRQ---------------------------------------------------
RS3_TREPA       QKSDELVRDERTHAERG-------------------------------------------
RS3_BORBU       DKKDGLSKDEVDLLNKKKFSASFSKERDDSNEQDIGG-----------------------
RS3_LEPBL       ------------------------------------------------------------
RS3_BACTN       ---KKNNR----------------------------------------------------
RS3_PORGI       ---RKGNR----------------------------------------------------
RS3_GRAFK       ---RK-------------------------------------------------------
RS3_CYTH3       GNRKKSNK----------------------------------------------------
RS3_SALRD       --QRRGG-----------------------------------------------------
RS3_CHLPD       ---TKRS-----------------------------------------------------
RS3_CHLL3       ---RPNDRG---------------------------------------------------
RS3_CHLTE       ---RPAKKA---------------------------------------------------
RS3_TROWT       -G----------------------------------------------------------
RS3_LEIXX       -GSN---------------APEASTVPAAAGVEA--------------------------
RS3_ARTS2       -ADRGDRRRR-----TDRPAAEAAPAAEAPAVEAAAPAVEGGQA----------------
RS3_BIFAA       -RNAAPQQ---------NAAAEAPAAAEAPAATETKE-----------------------
RS3_CORDI       -EQKQEG-----------------------------------------------------
RS3_CORJK       -EQKQEG-----------------------------------------------------
RS3_MYCVP       -SGTTATS---------TDAGRAASEGTVEAPATEA----AATAPSAGQPETTES-----
RS3_RHOJR       -TGTTATS---------TEAGRAAT-ATADAPATTE----QKEG----------------
RS3_MYCLE       -AGTTVTG---------TDAGRAVGGEESAATNIGH----SDDSVVTHEPQIAES-----
RS3_SACEN       -SGTTGSGG--------TEAGRAAADKSKGSAQSPEQAQTSGDVASANAPQVAEPRADEK
RS3_THEFY       GQQQQQ-------------AEKATAQATEAAKAAK----SGNEGS---------------
RS3_FRACC       APAETPAGEAAATEPTAPVAEPATAAASAPAEAAS----APAEAAVANTPEKAEE-----
RS3_STRCO       RRGRKPQQQ----------SAPAAEAPKAEAPAAA----APAESTGTEA-----------
RS3_ACIC1       APAGQGAAERPVAEQPVVTAEPAAAAAVTGETGTGGSNAAPAEPTTSAAAEEAPGGADAP
RS3_NOCSJ       RPTRADRGG----------DAPTSEATGAATEQAA---PAPAENQEG-------------
RS3_CUTAK       -PDRRGGRR---------RAEAAKQSAETPAPQTENAGA---------------------
RS3_RUBXD       ------------------------------------------------------------
RS3_RHOBA       ------------------------------------------------------------
RS3_CHLMU       ------------------------------------------------------------
RS3_CHLPN       ------------------------------------------------------------
RS3_PARUW       ------------------------------------------------------------
RS3_DEHMC       IPAEEKPKRVVKKAENITKEEE--------------------------------------
RS3_AQUAE       ------------------------------------------------------------
RS3_DEIGD       RPSRRRPTARRRPGGE--------------------------------------------
RS3_THET8       RPRRRRPAVRVKKEE---------------------------------------------
RS3_BACCZ       ------------------------------------------------------------
RS3_ALKHC       ------------------------------------------------------------
RS3_BACSU       ------------------------------------------------------------
RS3_LISW6       ------------------------------------------------------------
RS3_GEOTN       ------------------------------------------------------------
RS3_OCEIH       ------------------------------------------------------------
RS3_STAS1       ------------------------------------------------------------
RS3_LACLA       ------------------------------------------------------------
RS3_STRS2       ------------------------------------------------------------
RS3_ENTFA       ------------------------------------------------------------
RS3_LEVBA       ------------------------------------------------------------
RS3_PEDPA       ------------------------------------------------------------
RS3_LACS1       ------------------------------------------------------------
RS3_LACSS       ------------------------------------------------------------
RS3_LACP3       ------------------------------------------------------------
RS3_LACGA       ------------------------------------------------------------
RS3_LACAC       ------------------------------------------------------------
RS3_LACDB       ------------------------------------------------------------
RS3_LEUMM       ------------------------------------------------------------
RS3_OENOB       GQASTQGRGGNN------------------------------------------------
RS3_FUSNN       ------------------------------------------------------------
RS3_NEOSM       ------------------------------------------------------------
RS3_MYCMS       ------------------------------------------------------------
RS3_MESFL       ------------------------------------------------------------
RS3_MYCMO       ------------------------------------------------------------
RS3_MYCPU       ------------------------------------------------------------
RS3_MYCS5       ------------------------------------------------------------
RS3_MYCH7       ------------------------------------------------------------
RS3_MYCGE       ETASLKALTDNNQNHE--------------------------------------------
RS3_MYCPN       ETSSIQALTKPNKEDKQ-------------------------------------------
RS3_MYCGA       QFNKNHQNQQPAKE----------------------------------------------
RS3_UREPA       KPAPKQAVSE--------------------------------------------------
RS3_AYWBP       NNNHVNAKKN--------------------------------------------------
RS3_TRIV2       ------------------------------------------------------------
RS3_TRIEI       ------------------------------------------------------------
RS3_SYNE7       ------------------------------------------------------------
RS3_SYNY3       ------------------------------------------------------------
RR3_CYAPA       ------------------------------------------------------------
RS3_THEEB       ------------------------------------------------------------
RS3_SYNJA       ------------------------------------------------------------
RS3_GLOVI       ------------------------------------------------------------
RS3_PROMA       ------------------------------------------------------------
RS3_PROM5       ------------------------------------------------------------
RS3_SYNS3       ------------------------------------------------------------
RR3_TRICV       ------------------------------------------------------------
RR3_THAPS       ------------------------------------------------------------
RR3_PHATC       ------------------------------------------------------------
RR3_PORPU       ------------------------------------------------------------
RR3_PYRYE       ------------------------------------------------------------
RR3_GRATL       ------------------------------------------------------------
RR3_GUITH       ------------------------------------------------------------
RR3_CYACA       ------------------------------------------------------------
RR3_EMIHU       ------------------------------------------------------------
RR3_CYAM1       ------------------------------------------------------------
RR3_OLTVI       ------------------------------------------------------------
RR3_TUPAK       ------------------------------------------------------------
RR3_CHLVU       ------------------------------------------------------------
RR3_MESVI       ------------------------------------------------------------
RR3_CHLAT       ------------------------------------------------------------
RR3_NEPOL       ------------------------------------------------------------
RR3_OSTTA       ------------------------------------------------------------
RR3_EUGGR       ------------------------------------------------------------
RR3_CALFG       ------------------------------------------------------------
RR3_PHAAO       ------------------------------------------------------------
RR3_ACOCL       ------------------------------------------------------------
RR3_NUPAD       ------------------------------------------------------------
RR3_AMBTC       ------------------------------------------------------------
RR3_PIPCE       ------------------------------------------------------------
RR3_CITSI       ------------------------------------------------------------
RR3_EUCGG       ------------------------------------------------------------
RR3_GOSHI       ------------------------------------------------------------
RR3_CUCSA       ------------------------------------------------------------
RR3_MORIN       ------------------------------------------------------------
RR3_DAUCA       ------------------------------------------------------------
RR3_COFAR       ------------------------------------------------------------
RR3_PLAOC       ------------------------------------------------------------
RR3_SPIOL       ------------------------------------------------------------
RR3_RANMC       ------------------------------------------------------------
RR3_POPTR       ------------------------------------------------------------
RR3_PHAVU       ------------------------------------------------------------
RR3_LOTJA       ------------------------------------------------------------
RR3_OENEH       ------------------------------------------------------------
RR3_JASNU       ------------------------------------------------------------
RR3_EPIVI       ------------------------------------------------------------
RR3_MAIZE       ------------------------------------------------------------
RR3_PELHO       ------------------------------------------------------------
RR3_ANTAG       ------------------------------------------------------------
RR3_PHYPA       ------------------------------------------------------------
RR3_MARPO       ------------------------------------------------------------
RR3_HUPLU       ------------------------------------------------------------
RR3_PINTH       ------------------------------------------------------------
RR3_ADICA       ------------------------------------------------------------
RR3_PSINU       ------------------------------------------------------------
RR3_STAPU       ------------------------------------------------------------
RR3_ZYGCR       ------------------------------------------------------------
RR3_CHAVU       ------------------------------------------------------------
RR3_CHAGL       ------------------------------------------------------------
RR3_EUGLO       ------------------------------------------------------------
RR3_BIGNA       ------------------------------------------------------------
RS3_CARRP       ------------------------------------------------------------
RR3_HELSJ       ------------------------------------------------------------
                                                                            

RS3_ACIBT       ----------------------------------------
RS3_PSYCK       ----------------------------------------
RS3_PSEU5       ----------------------------------------
RS3_SACD2       ----------------------------------------
RS3_HAHCH       ----------------------------------------
RS3_MARHV       ----------------------------------------
RS3_CHRSD       ----------------------------------------
RS3_ALCBS       ----------------------------------------
RS3_BLOFL       ----------------------------------------
RS3_BLOPB       ----------------------------------------
RS3_BUCAP       ----------------------------------------
RS3_BUCBP       ----------------------------------------
RS3_BUCCC       ----------------------------------------
RS3_WIGBR       ----------------------------------------
RS3_BAUCH       ----------------------------------------
RS3_ECOLI       ----------------------------------------
RS3_HAES1       ----------------------------------------
RS3_AERS4       ----------------------------------------
RS3_PHOPR       ----------------------------------------
RS3_IDILO       ----------------------------------------
RS3_PSET1       ----------------------------------------
RS3_PSEA6       ----------------------------------------
RS3_PSYIN       ----------------------------------------
RS3_COLP3       ----------------------------------------
RS3_SHEFN       ----------------------------------------
RS3_SHELP       ----------------------------------------
RS3_HYDCU       ----------------------------------------
RS3_AROAE       ----------------------------------------
RS3_AZOSB       ----------------------------------------
RS3_DECAR       ----------------------------------------
RS3_NEIG1       ----------------------------------------
RS3_CHRVO       ----------------------------------------
RS3_BORA1       ----------------------------------------
RS3_METPP       VAPGDAKGE-------------------------------
RS3_PARXL       DGGKTGE---------------------------------
RS3_RALSO       ADAKTGE---------------------------------
RS3_ACISJ       AAAADGKGE-------------------------------
RS3_POLSJ       AAAADGTKTE------------------------------
RS3_RHOFT       AAAADGKGE-------------------------------
RS3_THIDA       ----------------------------------------
RS3_NITEC       ----------------------------------------
RS3_NITMU       ----------------------------------------
RS3_METFK       ----------------------------------------
RS3_METCA       ----------------------------------------
RS3_NITOC       ----------------------------------------
RS3_ALKEH       ----------------------------------------
RS3_HALHL       ----------------------------------------
RS3_XANOM       ----------------------------------------
RS3_XYLFT       ----------------------------------------
RS3_LEGPL       ----------------------------------------
RS3_COXBU       ----------------------------------------
RS3_FRATN       ----------------------------------------
RS3_RUTMC       ----------------------------------------
RS3_BARQU       ----------------------------------------
RS3_BARBK       ----------------------------------------
RS3_BRUME       ----------------------------------------
RS3_RHILO       ----------------------------------------
RS3_CHESB       ----------------------------------------
RS3_AGRFC       ----------------------------------------
RS3_NITHX       ----------------------------------------
RS3_RHORT       ----------------------------------------
RS3_MAGSA       ----------------------------------------
RS3_GRABC       ----------------------------------------
RS3_CAUVC       ----------------------------------------
RS3_RHOS1       ----------------------------------------
RS3_PARDP       ----------------------------------------
RS3_ROSDO       ----------------------------------------
RS3_JANSC       ----------------------------------------
RS3_ZYMMO       ----------------------------------------
RS3_SPHAL       ----------------------------------------
RS3_ERYLH       ----------------------------------------
RS3_NOVAD       ----------------------------------------
RS3_HYPNA       ----------------------------------------
RS3_MARMM       ----------------------------------------
RS3_MAGMM       ----------------------------------------
RS3_DESVV       ----------------------------------------
RS3_DESAG       ----------------------------------------
RS3_LAWIP       ----------------------------------------
RS3_SYNFM       ----------------------------------------
RS3_GEOSL       ----------------------------------------
RS3_PELPD       ----------------------------------------
RS3_PELCD       ----------------------------------------
RS3_SYNAS       ----------------------------------------
RS3_ANADE       ----------------------------------------
RS3_MYXXD       ----------------------------------------
RS3_DESPS       ----------------------------------------
RS3_CAMJR       ----------------------------------------
RS3_CAMFF       ----------------------------------------
RS3_SULDN       ----------------------------------------
RS3_HELHP       ----------------------------------------
RS3_WOLSU       ----------------------------------------
RS3_HELPY       ----------------------------------------
RS3_BDEBA       ----------------------------------------
RS3_CLOD6       ----------------------------------------
RS3_CARHZ       ----------------------------------------
RS3_CALS4       ----------------------------------------
RS3_CLOPE       ----------------------------------------
RS3_CLONN       ----------------------------------------
RS3_CLOTE       ----------------------------------------
RS3_CLOAB       ----------------------------------------
RS3_ACET2       ----------------------------------------
RS3_SYMTH       ----------------------------------------
RS3_DESHY       ----------------------------------------
RS3_MOOTA       ----------------------------------------
RS3_SYNWW       ----------------------------------------
RS3_KORVE       ----------------------------------------
RS3_SOLUE       WKQEVRQDTPSAEGAPEAKPAADENNPGTEQKPEGSGENQ
RS3_THEMA       ----------------------------------------
RS3_RICBR       ----------------------------------------
RS3_ANAPZ       ----------------------------------------
RS3_EHRRW       ----------------------------------------
RS3_WOLPM       ----------------------------------------
RS3_WOLTR       ----------------------------------------
RS3_PELUB       ----------------------------------------
RS3_TREDE       ----------------------------------------
RS3_TREPA       ----------------------------------------
RS3_BORBU       ----------------------------------------
RS3_LEPBL       ----------------------------------------
RS3_BACTN       ----------------------------------------
RS3_PORGI       ----------------------------------------
RS3_GRAFK       ----------------------------------------
RS3_CYTH3       ----------------------------------------
RS3_SALRD       ----------------------------------------
RS3_CHLPD       ----------------------------------------
RS3_CHLL3       ----------------------------------------
RS3_CHLTE       ----------------------------------------
RS3_TROWT       ----------------------------------------
RS3_LEIXX       ----------------------------------------
RS3_ARTS2       ----------------------------------------
RS3_BIFAA       ----------------------------------------
RS3_CORDI       ----------------------------------------
RS3_CORJK       ----------------------------------------
RS3_MYCVP       ----------------------------------------
RS3_RHOJR       ----------------------------------------
RS3_MYCLE       ----------------------------------------
RS3_SACEN       TEG-------------------------------------
RS3_THEFY       ----------------------------------------
RS3_FRACC       ----------------------------------------
RS3_STRCO       ----------------------------------------
RS3_ACIC1       SDATETKEG-------------------------------
RS3_NOCSJ       ----------------------------------------
RS3_CUTAK       ----------------------------------------
RS3_RUBXD       ----------------------------------------
RS3_RHOBA       ----------------------------------------
RS3_CHLMU       ----------------------------------------
RS3_CHLPN       ----------------------------------------
RS3_PARUW       ----------------------------------------
RS3_DEHMC       ----------------------------------------
RS3_AQUAE       ----------------------------------------
RS3_DEIGD       ----------------------------------------
RS3_THET8       ----------------------------------------
RS3_BACCZ       ----------------------------------------
RS3_ALKHC       ----------------------------------------
RS3_BACSU       ----------------------------------------
RS3_LISW6       ----------------------------------------
RS3_GEOTN       ----------------------------------------
RS3_OCEIH       ----------------------------------------
RS3_STAS1       ----------------------------------------
RS3_LACLA       ----------------------------------------
RS3_STRS2       ----------------------------------------
RS3_ENTFA       ----------------------------------------
RS3_LEVBA       ----------------------------------------
RS3_PEDPA       ----------------------------------------
RS3_LACS1       ----------------------------------------
RS3_LACSS       ----------------------------------------
RS3_LACP3       ----------------------------------------
RS3_LACGA       ----------------------------------------
RS3_LACAC       ----------------------------------------
RS3_LACDB       ----------------------------------------
RS3_LEUMM       ----------------------------------------
RS3_OENOB       ----------------------------------------
RS3_FUSNN       ----------------------------------------
RS3_NEOSM       ----------------------------------------
RS3_MYCMS       ----------------------------------------
RS3_MESFL       ----------------------------------------
RS3_MYCMO       ----------------------------------------
RS3_MYCPU       ----------------------------------------
RS3_MYCS5       ----------------------------------------
RS3_MYCH7       ----------------------------------------
RS3_MYCGE       ----------------------------------------
RS3_MYCPN       ----------------------------------------
RS3_MYCGA       ----------------------------------------
RS3_UREPA       ----------------------------------------
RS3_AYWBP       ----------------------------------------
RS3_TRIV2       ----------------------------------------
RS3_TRIEI       ----------------------------------------
RS3_SYNE7       ----------------------------------------
RS3_SYNY3       ----------------------------------------
RR3_CYAPA       ----------------------------------------
RS3_THEEB       ----------------------------------------
RS3_SYNJA       ----------------------------------------
RS3_GLOVI       ----------------------------------------
RS3_PROMA       ----------------------------------------
RS3_PROM5       ----------------------------------------
RS3_SYNS3       ----------------------------------------
RR3_TRICV       ----------------------------------------
RR3_THAPS       ----------------------------------------
RR3_PHATC       ----------------------------------------
RR3_PORPU       ----------------------------------------
RR3_PYRYE       ----------------------------------------
RR3_GRATL       ----------------------------------------
RR3_GUITH       ----------------------------------------
RR3_CYACA       ----------------------------------------
RR3_EMIHU       ----------------------------------------
RR3_CYAM1       ----------------------------------------
RR3_OLTVI       ----------------------------------------
RR3_TUPAK       ----------------------------------------
RR3_CHLVU       ----------------------------------------
RR3_MESVI       ----------------------------------------
RR3_CHLAT       ----------------------------------------
RR3_NEPOL       ----------------------------------------
RR3_OSTTA       ----------------------------------------
RR3_EUGGR       ----------------------------------------
RR3_CALFG       ----------------------------------------
RR3_PHAAO       ----------------------------------------
RR3_ACOCL       ----------------------------------------
RR3_NUPAD       ----------------------------------------
RR3_AMBTC       ----------------------------------------
RR3_PIPCE       ----------------------------------------
RR3_CITSI       ----------------------------------------
RR3_EUCGG       ----------------------------------------
RR3_GOSHI       ----------------------------------------
RR3_CUCSA       ----------------------------------------
RR3_MORIN       ----------------------------------------
RR3_DAUCA       ----------------------------------------
RR3_COFAR       ----------------------------------------
RR3_PLAOC       ----------------------------------------
RR3_SPIOL       ----------------------------------------
RR3_RANMC       ----------------------------------------
RR3_POPTR       ----------------------------------------
RR3_PHAVU       ----------------------------------------
RR3_LOTJA       ----------------------------------------
RR3_OENEH       ----------------------------------------
RR3_JASNU       ----------------------------------------
RR3_EPIVI       ----------------------------------------
RR3_MAIZE       ----------------------------------------
RR3_PELHO       ----------------------------------------
RR3_ANTAG       ----------------------------------------
RR3_PHYPA       ----------------------------------------
RR3_MARPO       ----------------------------------------
RR3_HUPLU       ----------------------------------------
RR3_PINTH       ----------------------------------------
RR3_ADICA       ----------------------------------------
RR3_PSINU       ----------------------------------------
RR3_STAPU       ----------------------------------------
RR3_ZYGCR       ----------------------------------------
RR3_CHAVU       ----------------------------------------
RR3_CHAGL       ----------------------------------------
RR3_EUGLO       ----------------------------------------
RR3_BIGNA       ----------------------------------------
RS3_CARRP       ----------------------------------------
RR3_HELSJ       ----------------------------------------