CLUSTAL format seed alignment for MF_01310

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RS11_AERPE      ------------------------------------------------------------
RS11_METS5      ------------------------------------------------------------
RS11_PYRCJ      ---------------------------------------------------------MST
RS11_THEPD      -------------------------------------------------MSEKEQKEVEA
RS11_METTH      ------------------------------------------------------------
RS11_NANEQ      ------------------------------------------------------------
RS11_CENSY      MSGTEAGAGEPAAEEPTKEAAQPEAGAPDAGTPEASAPEAGAAQPEAGTQPEAGTAQPEA
RS11_METJA      ------------------------------------------------------------
RS11_META3      ------------------------------------------------------------
RS11_THEKO      ----------------------------------------------------------MS
RS11_THEVO      ------------------------------------------------------------
RS11_METB6      ------------------------------------------------------------
RS11_METAC      ------------------------------------------------------------
RS11_KORCO      ------------------------------------------------------------
RS14_CHLRE      ------------------------------------------------------------
RS14_DICDI      ------------------------------------------------------------
RS14_TRYBB      ------------------------------------------------------------
RS14_ENCCU      ------------------------------------------------------------
RS11_HALWD      ------------------------------------------------------------
RS11_DESPS      ------------------------------------------------------------
RS11_MESFL      ------------------------------------------------------------
RS11_PELUB      ------------------------------------------------------------
RS11_LACP7      ------------------------------------------------------------
RS11_ACHLI      ------------------------------------------------------------
RS11_BACSK      ------------------------------------------------------------
RS11_HUNT2      ------------------------------------------------------------
RS11_LACAC      ------------------------------------------------------------
RS11_OENOB      ------------------------------------------------------------
RS11_PHYMT      ------------------------------------------------------------
RS11_FUSNN      ------------------------------------------------------------
RS11_NATTJ      ------------------------------------------------------------
RS11_PAEAT      ------------------------------------------------------------
RS11_TROW8      ------------------------------------------------------------
RS11_CORU7      ------------------------------------------------------------
RS11_MYCBO      ------------------------------------------------------------
RS11_ROSS1      ------------------------------------------------------------
RS11_THERP      ------------------------------------------------------------
RS11_AQUAE      ------------------------------------------------------------
RS11_DEHM1      ------------------------------------------------------------
RS11_KORVE      ------------------------------------------------------------
RS11_SOLUE      ------------------------------------------------------------
RS11_DESDA      ------------------------------------------------------------
RS11_GEOMG      ------------------------------------------------------------
RS11_ALCBS      ------------------------------------------------------------
RS11_BUCAI      ------------------------------------------------------------
RS11_LEGPC      ------------------------------------------------------------
RS11_DICNV      ------------------------------------------------------------
RS11_METCA      ------------------------------------------------------------
RS11_XYLFA      ------------------------------------------------------------
RS11_HALHL      ------------------------------------------------------------
RS11_PSYWF      ------------------------------------------------------------
RS11_POLNS      ------------------------------------------------------------
RS11_VESOH      ------------------------------------------------------------
RS11_RHOBA      ------------------------------------------------------------
RS11_BARBK      ------------------------------------------------------------
RS11_GRABC      ------------------------------------------------------------
RS11_HYPNA      ------------------------------------------------------------
RS11_JANSC      ------------------------------------------------------------
RS11_MAGMM      ------------------------------------------------------------
RS11_MYXXD      ------------------------------------------------------------
RS11_CHLPN      ------------------------------------------------------------
RS11_PARUW      ------------------------------------------------------------
RS11_COPPD      ------------------------------------------------------------
RS11_DICT6      ------------------------------------------------------------
RS11_DEIDV      ------------------------------------------------------------
RS11_THET2      ------------------------------------------------------------
RS11_BDEBA      ------------------------------------------------------------
RS11_BORAP      ------------------------------------------------------------
RS11_TREDE      ------------------------------------------------------------
RS11_LEPBJ      ------------------------------------------------------------
RS11_CYAP4      ------------------------------------------------------------
RR11_CYAPA      ------------------------------------------------------------
RR11_CHLAT      ------------------------------------------------------------
RR11_GUITH      ------------------------------------------------------------
RR11_EMIHU      ------------------------------------------------------------
RR11_GRATL      ------------------------------------------------------------
RR11_OEDCA      ------------------------------------------------------------
RR11_STIHE      ------------------------------------------------------------
RR11_CHLRE      ------------------------------------------------------------
RR11_PLETE      ------------------------------------------------------------
RR11_TUPAK      ------------------------------------------------------------
RR11_OLTVI      ------------------------------------------------------------
RR11_CHLVU      ------------------------------------------------------------
RR11_NEPOL      ------------------------------------------------------------
RR11_BIGNA      ------------------------------------------------------------
RR11_OSTTA      ------------------------------------------------------------
RR11_HETA4      ------------------------------------------------------------
RR11_TRICV      ------------------------------------------------------------
RS11_THEAB      ------------------------------------------------------------
RS11_THENN      ------------------------------------------------------------
RS11_KOSOT      ------------------------------------------------------------
RS11_PETMO      ------------------------------------------------------------
RR11_CYAM1      ------------------------------------------------------------
RS11_AZOPC      ------------------------------------------------------------
RS11_GRAFK      ------------------------------------------------------------
RS11_CYTH3      ------------------------------------------------------------
RS11_SULMW      ------------------------------------------------------------
RS11_CHLT3      ------------------------------------------------------------
RS11_SALRD      ------------------------------------------------------------
RS11_HELAH      ------------------------------------------------------------
RS11_SULNB      ------------------------------------------------------------
RS11_ARCB4      ------------------------------------------------------------
RS11_RUBXD      ------------------------------------------------------------
RS11_EHRRG      ------------------------------------------------------------
RS11_WOLPP      ------------------------------------------------------------
RS11_ORITB      ------------------------------------------------------------
RS11_RICM5      ------------------------------------------------------------
RS11_MYCPE      ------------------------------------------------------------
RS11_UREPA      ------------------------------------------------------------
RS11_MYCGA      ------------------------------------------------------------
RS11_MYCGE      ------------------------------------------------------------
RS11_MYCMO      ------------------------------------------------------------
RS11_MYCSP      ------------------------------------------------------------
RS11_MYCPU      ------------------------------------------------------------
RS11_MYCH2      ------------------------------------------------------------
RS11_MYCS5      ------------------------------------------------------------
RT11_MARPO      ------------------------------------------------------------
RT11_PROWI      ------------------------------------------------------------
RS11_CARRP      ------------------------------------------------------------
RR11_CHAGL      ------------------------------------------------------------
RR11_PSINU      ------------------------------------------------------------
RR11_ADICA      ------------------------------------------------------------
RR11_CRYJA      ------------------------------------------------------------
RR11_HUPLU      ------------------------------------------------------------
RR11_CUSGR      ------------------------------------------------------------
RR11_OENAR      ------------------------------------------------------------
RR11_DIOEL      ------------------------------------------------------------
RR11_PINKO      ------------------------------------------------------------
RR11_PELHO      ------------------------------------------------------------
RR11_AGRST      ------------------------------------------------------------
RR11_JASNU      ------------------------------------------------------------
RR11_WELMI      ------------------------------------------------------------
RS11_NEOSM      ------------------------------------------------------------
RS11_UNCTG      ------------------------------------------------------------
RR11_CYACA      ------------------------------------------------------------
RR11_EUGLO      ------------------------------------------------------------
RR11_EUGGR      ------------------------------------------------------------
RS11_COXBU      ------------------------------------------------------------
RT11_BOVIN      -------------------MQVLRNSGSWLLRSWAWPPTTRVVAGVPAPTIHMSAQQMQD
RR11_HELSJ      ------------------------------------------------------------
RT11_CHOCR      ------------------------------------------------------------
RT18_YEAST      -----------------------------MLLQPVWKGCRWTQFVRPIRRWNSTGTNRGV
RT11_ACACA      -----------------------------------------------MKILKPITFRKPR
                                                                            

RS11_AERPE      -----MAMYPRELK------------------------------WGVAHIYSSFNNTHVH
RS11_METS5      ------MSSKREIR------------------------------WGLARIYASQNNTIIT
RS11_PYRCJ      AETPQQPQQQQKLR------------------------------WGIAWIYSSSNNTIIT
RS11_THEPD      KESSGKAEERRETRE-----------------------KQVRGDVGIAWIYASYNNTIIH
RS11_METTH      --------MAEKEK------------------------------WGIANIYSSFNNTIIT
RS11_NANEQ      --------MA-KER------------------------------WGVAHIYSSENNTIIH
RS11_CENSY      PPEGTPETTPADEK------------------------------LGIAHIYSSYNNTIIH
RS11_METJA      ------MAEQKKEK------------------------------WGIVHIYSSYNNTIIH
RS11_META3      ----------MSEK------------------------------WGVIHIYASYNNTIIH
RS11_THEKO      EEQTTQVNIKKKEK------------------------------WGVAHIYSSYNNTIIH
RS11_THEVO      ------MEVNRMNK------------------------------TGIAHIYASQNNTIIH
RS11_METB6      ------MAANDKEK------------------------------WGIAHIFASFNNTIIT
RS11_METAC      ------MAD---MK------------------------------WAVAHIKSSFNNTIIT
RS11_KORCO      ------MSTERKGK------------------------------IGVAHIYSSFNDTIVH
RS14_CHLRE      ------MAPKKAAKGDEAPKEVV-------SLGPTVREG--EHVFGVAHIFASFNDTFVH
RS14_DICDI      ------MSGKKEVK---APKVVE-------ALSAKIPCGPSELVFGVAHIFASFNDTFVH
RS14_TRYBB      ------MSKKQEVK----------------YYGSSAGKD--QLVYGVVHIYASFNDTFVH
RS14_ENCCU      ------MTEQIESM----------------------------ELAAVAHIKATKNDTFVH
RS11_HALWD      ----MSESENTEKR------------------------------WGVAHVHASFNNTLIT
RS11_DESPS      ------MAVAK------------------------KRKVKKNIPEGIVYIYSTFNNTIVT
RS11_MESFL      ------MAKPKTN--------------------NTKKRIKKNIPKGIAHIHSTFNNTIVT
RS11_PELUB      ------MAKVDKVENKDAVVEKKVDKKSKKSSYSKKKKIKKNILNGIAYVQSTFNNTIIS
RS11_LACP7      ------MAKKIAAKK------------------VTKKRVKKNVDRGQAHIQSSFNNTIVT
RS11_ACHLI      ------MAAQKRKTTK--------------------RRVRKNIPSGIAHIHTTFNNTIVT
RS11_BACSK      ---MKNMAKKTNTRPK--------------------RRQRKNIDSGVAHIRSTFNNTIVT
RS11_HUNT2      --MATKMAGVKRAGRK--------------------RKERKNIERGAAHIRSTFNNTIVT
RS11_LACAC      ------MMPAKKTARK--------------------RRVKKHVESGVAHIHSTFNNTLVM
RS11_OENOB      ----MASRTSRTSGHK--------------------RRAKKNIEKGVAHIHSTFNNTIVL
RS11_PHYMT      ------MFMIKKKKNK--------------------NKFKKNINLGIAHIHTTFNNTILT
RS11_FUSNN      ------MA--KKTVAKI-------------------KKKSKNIPNGVAHIHSTFNNTIVA
RS11_NATTJ      ------MARRKRAAARK-------------------KKVKKNIESGIATINSTFNNTLVN
RS11_PAEAT      -MPPKTRGAVRKPRRK----------------------DKKNIALGQAHIKSTFNNTIVS
RS11_TROW8      ----MSKQAQSRSRKK----------------------ARKNIPAGLAHIKSTFNNTIVT
RS11_CORU7      --MAAPKSTATRARRG-------------------RRVVKKNVTQGHAYIKSTFNNTIVS
RS11_MYCBO      -MPPAKKGPATSARKGQKT----------------RRREKKNVPHGAAHIKSTFNNTIVT
RS11_ROSS1      -MAKQAAKGSAAATKRQRG----------------KRREKKNVPRGQAHIQSTFNNTIVT
RS11_THERP      -MADRRRGAARGGAARPR------------------RRERKNIPRGRAYIHATFNNTIVT
RS11_AQUAE      ------MAKKK-------------------------KKQKRQVTKAIVHIHTTFNNTIVN
RS11_DEHM1      ------MAVKKRAGAK--------------------KKEKKVIPVGKAFVQATFNNTIVT
RS11_KORVE      ------MAKAAGSAAAGEKKGKT--------NKKFKKKERKHVPHGLAHIQASFNNTIVT
RS11_SOLUE      ------MAKA--PVKAGKKKS-------------FKKKEKRVVHTGVVHIQATFNNTIVT
RS11_DESDA      ------MARP---KKVVKKK------------------EKKSVPVGIAHIQASFNNTIIT
RS11_GEOMG      ------MASPA--KKVVKKKK-----------------EKKNIPNGVAHIQATFNNTIIT
RS11_ALCBS      ------MAKSKKDSG------------------ARRKKVTRTVADGIAHVHASFNNTIIT
RS11_BUCAI      ------MVKNST-SI------------------RTRKRVKKQILDGIAHIHASFNNTIVT
RS11_LEGPC      ------MAITKSKQQ------------------KTRKKVKRVVSDGIVHIHASFNNTIVT
RS11_DICNV      ------MAKAAGKQK------------------NVRKKAKRVVVDAVAHVHASFNNTIVT
RS11_METCA      ----------MATTG------------------RPVKRVKRDISDGIAHISASFNNTIIT
RS11_XYLFA      --------MAKQSVV------------------KIKKKVKRVITDGVAHISASFNNTIVT
RS11_HALHL      -------MAKASSRG------------------GGKKKVKRTVSDGVAHINATFNNTLIT
RS11_PSYWF      -------MAKDTR--------------------GRKKTARRSVSEGVAHIHASFNNTIVT
RS11_POLNS      ---MAQQKSAAAASQ------------------RARKKVKKNVADGIAHVHTSFNNTIIT
RS11_VESOH      ----------MIAKS------------------SSKKKSKKVITDGIAHIHATFNNTIVM
RS11_RHOBA      -----------MAKT------------------NKKKRIRRNVSNGVAHVHATFNNTTVT
RS11_BARBK      ------MAKEAK---------------------RVRRSERKNISSSVVHINSTFNNTMIT
RS11_GRABC      ------MARNATSS-------------------RPRKKERKNISSGVAHVAATFNNTMIT
RS11_HYPNA      ------MAREAT---------------------RIRRRERKNITSGIVHVNSSFNNTMVT
RS11_JANSC      ------MARDRR---------------------PAKKKVSKNIAAGVAHVNSSFNNTKIL
RS11_MAGMM      ------MAKAQKGA-------------------RTKKKERKNIASGIAHIHSTFNNTLIT
RS11_MYXXD      ------MADEINTSAAASTGAEGEAPA----AKKSKRKGKKNILNGVVHIQSTFNNTIIT
RS11_CHLPN      ------MVKNQAQAKK---------------SVK--RKQLKNIPSGVVHVKATFNNTIVS
RS11_PARUW      ------MSKQPATNKK---------------PVKAKKKAFQNVPSGIAHVKATFNNTIIA
RS11_COPPD      ------MAQKKRK-------------------------ERRYVPYGVAHIHSTFNNTIIT
RS11_DICT6      ------MAKKKRTRGP--------------------KREKRIVPVGVAHINSTFNNTIVT
RS11_DEIDV      ------MAKPTKGKAP--------------------RRARRNISAGRAYVHASYNNTIVT
RS11_THET2      ------MAKKPSKK-----------------------KVKRQVASGRAYIHASYNNTIVT
RS11_BDEBA      ------MNTDKKAVTK--------------------KKVKRNVPQGNCYIQAGFGNVIVT
RS11_BORAP      ------MSAKLSTNSK--------------------KKIKRNIGEGNVYIQATFNNTIVT
RS11_TREDE      ----------MATVKK--------------------RKEKKSIYEGNVYIQATFNNTIIT
RS11_LEPBJ      -MADDKKSVKKEKKVK--------------------KKEKKIVPRGKVYITASFNNTIVT
RS11_CYAP4      ------MPQQPTKRTGG------------------VRKQKRNVPNGVAHIQSTFNNTIVT
RR11_CYAPA      ------MARQ-IKRSG-------------------TTKQKKNIPVGVAHIQSTFNNTIIS
RR11_CHLAT      ------MAKK-IRKIG-------------------IRKGKRKIPKGVVHVQATFNNTIVT
RR11_GUITH      ------MVRQ-VKKSS-------------------LKKNKKVAANGVVHIQSTFNNTIVT
RR11_EMIHU      ------MIKQ-VKRFT-------------------SKKSKKTVNAGIVHIKSTFNNTIVN
RR11_GRATL      ------MARQ-IRKTH-------------------AKQ-KKNIINGITHIKSTFNNTLIT
RR11_OEDCA      ------MSKQ--LRQ-S------------------TKKTKRRLYRGVIHIQTSYNNTIIT
RR11_STIHE      ------MSKQ--IRK-N------------------VKKPRKKIYRGVVYIQTTQNNTIVT
RR11_CHLRE      ------MAKQ--TRKLT------------------TNKTKKKIFRGVVHIQAGHHNTIVT
RR11_PLETE      ------MAKL--TRKIP------------------KKTK-RKFSRGLVHIQVSFNNTIVT
RR11_TUPAK      ------MAKQ--IRKTN------------------KKVKMTKLPKGVVHIQSTFNNTIVT
RR11_OLTVI      ------MAKQ--VRKAS------------------KKTK-LKVPSGVAHVQATFNNTIIT
RR11_CHLVU      ------MAKK--IEKSA------------------KKKFREKVLLGVAHIQSTFNNTIVT
RR11_NEPOL      ------MARQ--SKRLA------------------PRRLKRKVSKGVVHIQASFNNTIVT
RR11_BIGNA      ------MVKQ--IRKLT------------------IKKAKWKASDGIVYIYATLNNTIIT
RR11_OSTTA      ------MATK--QRKVT------------------QKKSRRKVQRGVVHILATFNNTLVT
RR11_HETA4      ------MIKQ--IKR---------------------KKVKKNVVVGVVHIQASFNNTIVT
RR11_TRICV      ------MAQK--IRKST------------------FKKDKNSSINGVVHIQSTFNNTIVT
RS11_THEAB      ------MAKK-TRRVVK------------------RK-KKLTVDRGVVHIKSTYNNTIIT
RS11_THENN      ------MARK-KGTSTR------------------KKQKKLSFDYGVVHIKSTFNNTIIT
RS11_KOSOT      ------MARN-RSSRTK------------------KR-KKLNIDRGVVHIKSTFNNTIIT
RS11_PETMO      ------MAKG-GAKQRT------------------KK-KKAAPEKAAIHIHSTFNNTIVT
RR11_CYAM1      ------MKK---SKRTD------------------RK--------GSIHIQSTFNNTLIT
RS11_AZOPC      ------MAKRT---------------------VATKKRVVKVDVKGQLHIHSSFNNIIVT
RS11_GRAFK      ------MAKKANPKA-----------------KTQKKRKVVVESNGEAHVTASFNNIIIS
RS11_CYTH3      ------MAQQSTAAKRK---------------DKAKKRIVVIEPTGQVHIRASFNNIIIS
RS11_SULMW      ------MEKTF----------------------TFRKKNSRNYNIGEAHIKSTYNNIIIT
RS11_CHLT3      ------MATAPVK----------------------KKKKVNVTQDGIVHIKATFNNIAVT
RS11_SALRD      ------MADGDDRGG-K---------------RTPQKKNVVVESNGRAYVKATFNNVIVT
RS11_HELAH      ------MAKRNVATKK--------------------KVVKKNIARGVVYISATFNNTNIT
RS11_SULNB      -------------MAK--------------------KKAKKSIAKGVVYVAATFNNTVIT
RS11_ARCB4      ------MAKRKV-TRK--------------------KIVRKNIADGIVHIAASFNNTMVT
RS11_RUBXD      -MGRQRQQRSRGSRSR--------------------RRVRKNISTAVVHIKSSFNNTIIS
RS11_EHRRG      ----------MSVTYN--------------------KKKKRNVVVGVVHIHATYNNIIVT
RS11_WOLPP      ---------MKKVKTV--------------------GKNTKRFITGIVHIRATFNNTFVN
RS11_ORITB      --------MYN--AKT--------------------KKKRKNITLGIVYIKSTFNNTIVT
RS11_RICM5      --------MMNQTVKV--------------------KKKKKTITLGVVHIRASFNNTIVT
RS11_MYCPE      ------MAKKRKKK--------------------------LSSPEGISHIHASANNTIVT
RS11_UREPA      ------MAK--KKK--------------------------LSFTNGIAYIHATKNNTIIT
RS11_MYCGA      ------MAK--KKK--------------------------TVASNGIAHIHATSNNSIIT
RS11_MYCGE      ------MAK--KKK--------------------------INVPSGLIHVSCSPNNTIVS
RS11_MYCMO      -----MAVKKTKSKQKV---------------------KRKNIVSGVAHIHSTHQNTIVA
RS11_MYCSP      ------MAKKNK----------------------------KVVTQGIAHIHSTYQNTIVS
RS11_MYCPU      ----MAQRRSSQTTKKV---------------------KRKNVTNGVAHIHSTHNNTIVT
RS11_MYCH2      ------MATNVKKVKKL---------------------RPKNVTVGIAHIHSSHQNTIIS
RS11_MYCS5      ------MARKAKK---------------------------KNISSGVAHIHSSNQNTIIT
RT11_MARPO      ------MQKKHG-----------------------ITN--MQKKHCITYIQSTFGNTIIT
RT11_PROWI      -----MLVKKSQ-----------------------ISRKFIEKKSGIVHIQSTTNNTLIT
RS11_CARRP      -------MK-------------------------------LYKKRGIIYIHSTFNNTIST
RR11_CHAGL      ------MPKPSK------KINL--------------RKIKKKVPKGVIHIQASFNNTIVT
RR11_PSINU      ------MPKPIK------RLSS--------------HKKKRVIFKGIIQIKASFNNTIVT
RR11_ADICA      ------MSNKSR------KIRS--------------RGGKRGVQKGVIHIQASFNNTIIT
RR11_CRYJA      ------MPRRAT------RRFLP-------------RKTKHRILKGVIYVRASFRNTIVT
RR11_HUPLU      ------MPRLIK------KVGSL-------------RRGKRGVPKGVIHIQASFNNTIVT
RR11_CUSGR      ------MVKLIP------RLSS------RRNGRIRLRKNTRKISQGVIHIQASLQNTIVT
RR11_OENAR      ------MAKSIPSAGLRLRLRL------RRNARRRSRKSTRKIPKGVIHVQASFHNTIVT
RR11_DIOEL      ------MTKPIP------RIGS------RRNGRIGSRKNARRIPKGVIHVQASFNNTIVT
RR11_PINKO      ------MSKTIK------RIGS------RRN--------EHRVLKGVIYVQASFNNTIVT
RR11_PELHO      ------MAKTIR------RYSSFR----LRNRRIRSRKSARKIPKGIIHVQASFSNTIVT
RR11_AGRST      ------MAKAIPKIGSRKKVRIGL----RRNARFSLRKSARRITKGVIHVQASFNNTIIT
RR11_JASNU      ------MAKGTRFINFRRYGRFGS----RRYRRFGSHKSVRKIPRGVIHIQTSFHNTIVT
RR11_WELMI      ------MKPRLLNSFRGYRYRYRY----RYGYR-RKKPEIRNIDKGIIHILASFNNTIIT
RS11_NEOSM      ------------------------------------MREKKSIVSGNAHVIVTFNNVYIS
RS11_UNCTG      ----MAGEKNAVG---------------------SSKKKKYTGGVAKAYILSTFNNTIVN
RR11_CYACA      ----ML--KQSKK---------------------SSKKLKKSVIDGLIIINSTFNNTIVT
RR11_EUGLO      --------------------------------------------MAMVYIKMSFHNTIVT
RR11_EUGGR      ------MIKQKKK---------------------IIKITKKKFPKGIVHIKTTYNNVLVS
RS11_COXBU      ------MAKK----------------------------RYRKVTEGIAHIKATFNNTMIS
RT11_BOVIN      AAAKEEVEKAETPAPAPSRSSFSIYPPIPGQESSLRWAGKKFEEIPIAHIKASYNNTQIH
RR11_HELSJ      --MPFLLNNFKFSRFRSFATKLEKTKGFFNYQPLTKFKQKYSLDVAYVYIISSYNNTLIS
RT11_CHOCR      --------------------------------------MENKSKLIVLSILFTPNNILYY
RT18_YEAST      PFSFKDISNQEDITNISYPSSSDS-VLTKSNGSSEVYKPKEEVVKYILHGKFTKNNTHLT
RT11_ACACA      IISQKKVLRSKLSKVKKSPWYKAKKNYVSFRQRLVLAKKNPNKKRYYLFFSKKRNNVFLT
                                                                       :    

RS11_AERPE      ITDLTG-----------------------AETVARVTGGMVVKADREKP-SPYAAMIAAS
RS11_METS5      ITDITG-----------------------AEVISKASGGMMVKADREKP-SPYAAMLAAN
RS11_PYRCJ      ITDLTG-----------------------AETVARVSGGMVVRADKDKP-SPWAAMQAAY
RS11_THEPD      ITDLSG-----------------------AETIAFASGGMVAKADRDKP-SPWAAMQAAA
RS11_METTH      ITDITG-----------------------AETITQWSGGKVVRADRQES-SPFAAMEAAT
RS11_NANEQ      ITDITG-----------------------AETIAVGSGGMVVNADRLEG-SPTAAILAAK
RS11_CENSY      MTDLTG-----------------------AETVSISSGGVHVNADRYES-SPFAAMKAAN
RS11_METJA      ATDITG-----------------------AETIARVSGGRVTRNQRDEG-SPYAAMQAAF
RS11_META3      VTDITG-----------------------AETIAKISGGMIVKNQKDES-SPYAAMQGAF
RS11_THEKO      ITDLTG-----------------------AETISRWSGGMVVKADRDEP-SPYAAMIAAR
RS11_THEVO      VTDPTG-----------------------AETIAMVSGGMVVKNDRDQA-SPYAAMKAAD
RS11_METB6      VTDLSG-----------------------AETVTKSSGGMVVKQDRNES-SPYAAMQMAA
RS11_METAC      VTDITG-----------------------AETIAKSSGGMVVKAARDES-SPYTAMQMAG
RS11_KORCO      ITDITG-----------------------AETLARYSGGMFVDADRLEG-SPYAALKAAM
RS14_CHLRE      VTDLSG-----------------------RETISRVTGGMKVKADRDES-SPYAAMLAAQ
RS14_DICDI      VTDLSS-----------------------KETIVRVTGGMKVKTDRDES-SPYAATMAAQ
RS14_TRYBB      VTDMSG-----------------------RETFCKVTGGMKVKADRDES-SPYAAMMAAQ
RS14_ENCCU      ITDMTG-----------------------SETIAKITGGMRVKAQRDEG-SPYAAMLAAQ
RS11_HALWD      VTDLTG-----------------------AETIVKSSGGAVVKQNRDEA-SPYAAMQMAE
RS11_DESPS      ISDKQ------------------------GNVVSWCSAGVLGFKGSRKS-TPFAAQNALA
RS11_MESFL      ISDEK------------------------GNVLSWSSAGAIGFKGSKKS-TPYAAQMISE
RS11_PELUB      IADTN------------------------GNVISWASAGQKGFKGSRKS-TPYAAQIAAD
RS11_LACP7      LTDAE------------------------GNALSWASAGGLGFRGSRKS-TPYAAQMAAE
RS11_ACHLI      ITDPA------------------------GNAISWSSAGALGIKGSRKS-TPFAAQLTSE
RS11_BACSK      ITDPH------------------------GNAISWASAGALGFKGSRKS-TPFAAQMAAE
RS11_HUNT2      ITDVE------------------------GNTISWSSAGTLGFRGSRKS-TPFAAQMAAE
RS11_LACAC      ITDVQ------------------------GNAVAWSSAGALGFKGSRKS-TPFAAQMAAE
RS11_OENOB      ITDEA------------------------GNAVSWSSAGSLGFKGSRKS-TPFAAQLAGE
RS11_PHYMT      ITDLQ------------------------GNTITWSSAGSLGFKGSRKS-TPFAAQIASS
RS11_FUSNN      ITDVD------------------------GKVVSWKSGGTSGFKGTKKG-TPFAAQIAAE
RS11_NATTJ      ITDSD------------------------GNTMAWSSSGACGFKGSRKG-TPYAAQIAAE
RS11_PAEAT      ITDPNGAVSITDPN---------------GAVISWASAGEVGFKGSRKS-TPFAAQMAAE
RS11_TROW8      ITDLS------------------------GNVIGWSSSGAVGFKGSRKS-TPYAAQMAAD
RS11_CORU7      ITDPK------------------------GHVISWASSGQVGFKGSRKS-TPFAAQLAAE
RS11_MYCBO      ITDPQ------------------------GNVIAWASSGHVGFKGSRKS-TPFAAQLAAE
RS11_ROSS1      ITDPA------------------------GNVICWSSAGQNGFKGSRKS-TPYAAQVAAE
RS11_THERP      LTDPN------------------------GNVVAWSSAGSSGFKGTRKS-TPYAAQVAAE
RS11_AQUAE      VTDTQ------------------------GNTIAWASGGTVGFKGTRKS-TPYAAQLAAQ
RS11_DEHM1      LTDLQ------------------------GNVIAWASCGTAGFKGSRKG-TPYAAQMAAQ
RS11_KORVE      ISDPS------------------------GNVVSWKSSGSLGFRGSRKG-TPFAAQQAAM
RS11_SOLUE      ISDQE------------------------GNTISWSSAGSLGFRGSRKG-TPFAAQQAAM
RS11_DESDA      FTDTR------------------------GNAVSWASSGQSGFKGSRKS-TPFAAQVAAE
RS11_GEOMG      ITDPA------------------------GNVVAWSSAGGKGFKGSRKS-TPFAAQVAAE
RS11_ALCBS      ITDRQ------------------------GNALSWATSGGAGFRGSRKS-TPFAAQVAAE
RS11_BUCAI      ITDRQ------------------------GNALGWATSGGSGFRGSRKS-TPFAAQVAAE
RS11_LEGPC      FTDRQ------------------------GNALCWATSGGSGFRGSRKS-TPYAAQVATE
RS11_DICNV      ITDGQ------------------------GNTLSWATAGGSGFRGSRKS-TPFAAQIAAE
RS11_METCA      ITDRK------------------------GNALSWASAGASGFRGSRKS-TPFAAQVAAE
RS11_XYLFA      ITDRQ------------------------GNSLFWCTSGASGFRGSRKC-TPFAAQVAAE
RS11_HALHL      ITDRQ------------------------GNALSWASAGGSGFKGSRKS-TPFAAQVASE
RS11_PSYWF      ITDRQ------------------------GNALAWATSGGQGFRGSRKS-TPFAAQVAAE
RS11_POLNS      ITDRQ------------------------GNALSWATSGGQGFKGSRKS-TPFAAQVAAE
RS11_VESOH      ITDRH------------------------GNTVCWATSGGSGFRGSRKS-TPFAAQVAAG
RS11_RHOBA      ITDAK------------------------GDTLCWASAGTSGFKGSRKS-TPFAGQCAAQ
RS11_BARBK      ITDSQ------------------------GDTIAWSSAGAQGFKGSRKS-TPFAAQVAAA
RS11_GRABC      ISDAQ------------------------GNAIAWSSAGAQGFKGSRKS-TPYAAQVAAE
RS11_HYPNA      ITDAQ------------------------GNTISWSSSGVMNFKGSRKS-TPYAAQMAAE
RS11_JANSC      ISDVQ------------------------GNAIAWSSAGTMGFKGSRKS-TPFAAQMAAE
RS11_MAGMM      ITDTH------------------------GNSISWGSAGAQGFKGSRKS-TPFAAQMAAE
RS11_MYXXD      ITDVS------------------------GNVISWSSAGARGFKGSRKS-TPFAAQVAAG
RS11_CHLPN      ITDPA------------------------GNVISWASAGKVGYSGSRKS-SAFAATVAAQ
RS11_PARUW      ITDPS------------------------GRVISWASAGKVNFSGSRKS-SAFAATVAAQ
RS11_COPPD      ITDPN------------------------GAVLAWASGGFF-FKGTRKG-TPYAAQLASE
RS11_DICT6      ITDPE------------------------GNVLTWGSGGTAGFKGTKKG-TPFAAQLAAE
RS11_DEIDV      ITDLD------------------------GNSVAWSSGGTIGYKGSKKG-TPYAAQLAAA
RS11_THET2      ITDPD------------------------GNPITWSSGGVIGYKGSRKG-TPYAAQLAAL
RS11_BDEBA      MTDPT------------------------GATVSWSSAGHLGFKGSRKG-TPFAAQVAAE
RS11_BORAP      VSDIK------------------------GNALAWASAGGMGFKGAKKS-TPYAAQITAE
RS11_TREDE      ITDLK------------------------GNVLSWASSGGLGFAGAKKS-TPFAAQTVAE
RS11_LEPBJ      ITDMA------------------------GNTISWSTSGAMGFRGSKKS-TPYAAQIAAG
RS11_CYAP4      ISDVA------------------------GEVISWASAGSSGFKGAKKG-TPFAAQTAAE
RR11_CYAPA      ITSPT------------------------GEVIAWASAGSSGFKGARKG-TPFAAQTAAE
RR11_CHLAT      ITDIK------------------------GEVISWSSAGSCGFKGTKKG-TPFAAQTAAE
RR11_GUITH      LSTLE------------------------GDTVAWASSGAIGFKGAKKG-TPFAAQIAAE
RR11_EMIHU      ITDKQ------------------------GNTLFWASAGGCGFKGAKKS-TPFAAQSAAE
RR11_GRATL      ITDLK------------------------GSTLSWSSAGASGFKGTKKG-TPFAAQIAAE
RR11_OEDCA      VTNIK------------------------GDVMCWSSAGSSGLKGKRKS-TAYAAKLAAA
RR11_STIHE      ITNIK------------------------GDAVCWSSAGSCDLKGRRKA-TAYAAKLAAA
RR11_CHLRE      ITNIR------------------------GEVLCWSSAGACGFRGKRKS-TSFAAKKAAE
RR11_PLETE      ITNLK------------------------GDVLAWSSAGACGFKGARKG-TPFAAQIVAE
RR11_TUPAK      ITNLK------------------------GEVISWSSAGAVGFKGARKS-TPFAAKTAAQ
RR11_OLTVI      ITNPA------------------------GDVLAWCSAGASGFKGARKS-TPFAAKIAAE
RR11_CHLVU      ITTNK------------------------GNVLAWSSAGACGFKGARKK-TPLAAKQAAE
RR11_NEPOL      ITDSS------------------------GGVLAWSSAGACGFRGAKKG-TPFAAQTAAE
RR11_BIGNA      IVDTS------------------------GRVVSWSSAGICGFRGARKA-SPFAAKTAAE
RR11_OSTTA      ISDRS------------------------GLVIASSSAGACGFRGARKG-TPFAAQTASE
RR11_HETA4      ITDLG------------------------GNTLSTGSAGAVGFKGARKG-TPFAAQLASE
RR11_TRICV      ITNIT------------------------GDTISWASAGSSGFKGARKG-TPFAAQTAAE
RS11_THEAB      LTDPD------------------------GKVITWGSGGTAGFQGTRKG-TPYAAQLAAD
RS11_THENN      LTDKD------------------------GNTLTWASGGTVGFEGTRKG-TPYAAQLAAD
RS11_KOSOT      LSDLD------------------------GNTILWASGGTVGYSGSKKS-TPYAAQLAAD
RS11_PETMO      LTDTE------------------------GRPIIWSSGGNVGFKGAKKG-TPFSAQMASD
RR11_CYAM1      VSDAQ------------------------GACVCWSSAGLVGFKGAKKG-TPFAAGMAAE
RS11_AZOPC      ITNDE------------------------GQVISWSSSGKMGFRSSKKN-TPYAAQMAAQ
RS11_GRAFK      LTNKK------------------------GDVVAWSSAGKMGFRGSKKN-TPYAAQLAAE
RS11_CYTH3      VTNST------------------------GQVISWASAGKMGFRGSKKN-TPYAAQVAAQ
RS11_SULMW      LTNKK------------------------GDVIAWSSAGKMGFKGSKKN-TPYAAQITAE
RS11_CHLT3      ITDVT------------------------GNTVSWSTAGKNGFKGSKKN-TPYASQVTAE
RS11_SALRD      LTDQY------------------------GNTISWASAGKMGFKGSRKN-TPYAAQKAGE
RS11_HELAH      ITDEM------------------------GNVICWSTAGGLGFKGSKKS-TPYAAQQAVE
RS11_SULNB      VTDEM------------------------GNVISWSSAGALGFKGSKKS-TPFAATEAVA
RS11_ARCB4      VTDNA------------------------GNAIAWSSAGNLGFKGSKKS-TPFAAQAAVE
RS11_RUBXD      VTDQE------------------------GNVIAWESAGSMGFKGSRKS-TPYAAQMTAE
RS11_EHRRG      ITDQQ------------------------GHSLVSTSAGAYGFKGSKKA-TPYAAQETAG
RS11_WOLPP      VTDVC------------------------GNTLYQTSVGACGFSGSRKS-TPYAAGKVAD
RS11_ORITB      FTDMQ------------------------GNAIAALSAGAIGFKGAKKA-TPYAAQVIVE
RS11_RICM5      FTDIQ------------------------GNTISSASAGGNGFKGARKA-TPYAAQVTID
RS11_MYCPE      LTNTG------------------------GDAITWSSSGSIGYKGSKKS-TPYAAGIAAE
RS11_UREPA      LADEQ------------------------GSVLSWASSGSIGYKGTKKK-TPYSAGIAAE
RS11_MYCGA      ITDIN------------------------GNAITWSSSGAIGYKGAKKK-TPYSAGVAAE
RS11_MYCGE      ATDPS------------------------GNVLCWASSGTVGFKGFRKK-TPYSAGVAAD
RS11_MYCMO      FSDEA------------------------GNVFAWSSAGAIGYKGTKKK-TPYAAGLATT
RS11_MYCSP      FSDLK------------------------GNVFAWSSSGAIGYKGTKKK-TPYAAGLAAA
RS11_MYCPU      FSDEK------------------------GNVISWASSGTIGYKGTKKK-TAYAAGLAAQ
RS11_MYCH2      FTDKQ------------------------GNVISWASSGSIGFKGTKKK-TAYAATLATA
RS11_MYCS5      FTDEK------------------------GNVIAWSSSGKVGFKGTKKK-TSFAASEAAK
RT11_MARPO      LTDYN------------------------GNTKTWSSSGSVGFKGSRRS-TNYAAQATAE
RT11_PROWI      LTDLE------------------------GNTQFFVSAGTLGFKNSRKS-TVYASGAAAE
RS11_CARRP      LTDVF------------------------GNTIVWYSAGILGYKGPKKS-TSLASQLISE
RR11_CHAGL      ITDVR------------------------GQVISWSSAGACGFKGAKKS-TPFAAQTAAE
RR11_PSINU      VTNSQ------------------------GQVITWSSAGACGFKGTKRS-TPFAAQIATE
RR11_ADICA      VTDVR------------------------GQVIIWSSAGACGFKGTRKS-TPFAAQAAAE
RR11_CRYJA      VTDTR------------------------GQAVSWSSAGACGFKGTKRR-SPFAAQTAAA
RR11_HUPLU      VTDVR------------------------GQAVSWSSAGACGSRGTKKS-TPFAAQTAAE
RR11_CUSGR      VTDVR------------------------GRVVSWASAGSAGFKGTTRR-TPFAAQTAAT
RR11_OENAR      VTDVR------------------------GRVISWSSAGTCGFKSTRKG-TPFAAQTAAG
RR11_DIOEL      VSDVR------------------------GQVISWASAGTSGFKGTRRG-TPYAAQAAAV
RR11_PINKO      ATDVR------------------------GQVISWSSAGACGFKGTRRG-TPFAAQTAAE
RR11_PELHO      VTDVG------------------------GRVVTSASAGACGFKGRRRG-TPFAAQTTAE
RR11_AGRST      VTDPQ------------------------GRVVFWSSAGTCGFKSSRKA-SPYAGQRTAV
RR11_JASNU      VTDGR------------------------GQVVSWSSAGTCRFKGPRKR-TPFAAQIVAA
RR11_WELMI      VTDVK------------------------GHVIYWSSAGACGFKGPKKG-SAFAAQKATE
RS11_NEOSM      VTDHQ------------------------GNVQGWASSGSVGFKGNKKS-TAYAAQSVAT
RS11_UNCTG      ITDEK------------------------GNTLAWASAGVSGFKGTKKG-TPFAAQMTAA
RR11_CYACA      ATDCY------------------------GKVIAWASGGTEGFKGAKKG-TPFAAQSATE
RR11_EUGLO      VIDGR------------------------ANVLSWCSSGVCKFKGRQKT-TAFATKIVIT
RR11_EUGGR      VSDPK------------------------GNVIAWSSSGACGFKSSKKA-TPLATKTTTA
RS11_COXBU      VSDPQ------------------------GNVLCFRSAGGSGFKGSRKG-TPYGAQMASE
RT11_BOVIN      VVSAA------------------------HQPLARASCGTEGFRNAKKG-TGIAAQTAGI
RR11_HELSJ      LTDFL------------------------GNVLKNESCGSCNYKGRFKR-KFIASKQAAE
RT11_CHOCR      ATQLN------------------------GNIIFWTSSGVHKQKNTKKV-TLISITTVIN
RT18_YEAST      FSSVVEDKNFHKNKGLTYNDTMLYYLNLPQKVKISLSTGCLGFRKAARG-EYEAAFQTSG
RT11_ACACA      ITDVI------------------------GRVVVSQSAGSCKITTKKKKRSPDTLKTVSA
                                                    : *        .            

RS11_AERPE      RAAQKAME--RGIAAIHIKVRAPGG-HGPKTPGPGAQAAIRALARA-----GFIIGRIED
RS11_METS5      KAASDALD--KGLMAIHIKVRAPGG-AGPKTPGPGAQPAIRSLARS-----GFIIGRIED
RS11_PYRCJ      KAAQLALA--RGINAVHIKVRGPGG-YGMKVPGPGASAAIRALARS-----GLVIGRIED
RS11_THEPD      RAAKIALD--KGIRVVHVKIKAPGG-YGPKTPGPGAGPAIRALVRA-----GLMVDRIED
RS11_METTH      RAADDAKE--KGIVGLHIKVRAPGG-NGPRTPGPGAQAAIRALARA-----GMRIGKIED
RS11_NANEQ      RAAALAKE--RGITGLHIKVRAPGGHNGPWIPGPGASAAIKTLARE-----GLKIGIIED
RS11_CENSY      KVIESARA--KGFTGFHIRVRAVGG-VGSRVPGPGAQAAIRALARG-----GFRIGRIDD
RS11_METJA      KLAEVLKE--RGIENIHIKVRAPGG-SGQKNPGPGAQAAIRALARA-----GLRIGRIED
RS11_META3      KIADMIRE--KGIDKVHIKVRATGG-SKSKNPGPGAQAAIRALARA-----GIKIGRIED
RS11_THEKO      RAAEEAME--KGITGVHIKVRAPGG-SKSKSPGPGAQAAIRALSRA-----GLRIGRVED
RS11_THEVO      MVSETLKE--HEITDLIIKVRAPGG-NKSKIPGPGAQAAIRALSRA-----GLKIVRIEE
RS11_METB6      NVAAIARE--KGIVGVHVKVRAPGQ-GKQRSPGPGAQAAIRALARA-----GMRIGRIED
RS11_METAC      QLADQLKD--KGINGIHIRVRAPGG-NKQRSPGPGAQAAIRAFARA-----GIRIGRIED
RS11_KORCO      AAAKEAQR--KGITHLIVKVRAPGG-IKSRIPGPGATAAIRGLSRS-----QLTLIRVED
RS14_CHLRE      DVAQKCKE--LGITALHIKLRATGG-NRTKTPGPGAQSALRALARA-----GMKIGRIED
RS14_DICDI      DVALRCKE--LGVTALHIKLRATGG-NGSKTPGPGAQSALRALARS-----GMRIGRIED
RS14_TRYBB      DVVARCKE--CGINALHVKMRATGG-VGTKSPGPGAQAALRALARA-----GMKIGRIED
RS14_ENCCU      DVATKILG--RGVKVLHFKLRGAGG-VKPMALGPGAQTAIRTLIRA-----GLRVGRIED
RS11_HALWD      SVAEDIKA--AGIDGLHVRVRGPGG-NGNKSPGPGAQATIRALARA-----GLEIGRIED
RS11_DESPS      DAAKKAAD--CGMRKVEVKVKGPGP---------GREAALRALVST-----GFEVSRIYD
RS11_MESFL      AAAKGAMD--QGVKSVQVEVKGPGP---------GRDAAVRALTIV-----GMEVTSIKD
RS11_PELUB      SAASKALE--YGMKTLSVEVKGPGS---------GRETALRALQAR-----GFKILSIKD
RS11_LACP7      TAAKAALV--HGLKTVEVMVKGPGS---------GREAAIRALQAC-----GIEVTSIKD
RS11_ACHLI      AAAKGAMD--NGMARVEVYVKGPGP---------GREAAIRSLQAA-----GLEITAIKD
RS11_BACSK      SAAKTAME--HGMKTIEVSVKGPGA---------GREAAIRSLQAV-----GLEVNMIKD
RS11_HUNT2      AAAKAAME--HGLKTVEVYVKGPGS---------GREAAIRALQAA-----GLEVSLIKD
RS11_LACAC      AAAKSAMD--QGMKHVEVSVKGPGA---------GRESAIRSLQAT-----GLEITAIRD
RS11_OENOB      AAAKAAME--QNMHSVAISVKGPGP---------GRESAIRAVAAA-----GLEITAISD
RS11_PHYMT      TAAKAALE--HGMLKVEVFIKGPGA---------GREASIRSLQAS-----GLEITSIRD
RS11_FUSNN      QAAQIAME--NGMRKVEVKVKGPGS---------GREACIRSLQAA-----GLEVTKITD
RS11_NATTJ      TAAKTAME--DGLKGVEVRVKGPGS---------GREAAIRSLQAA-----GLEINAIKD
RS11_PAEAT      AAAKRAQE--HGLRKVDVFVKGPGS---------GRETAIRSLQAA-----GLEVGSIQD
RS11_TROW8      AAARSAQE--HGVKKVDVFVKGPGS---------GRETAIRSLQTA-----GLEIGSISD
RS11_CORU7      SAARKAME--HGMKKVDVFVKGPGS---------GRETAIRSLSTA-----GLEVGTIAD
RS11_MYCBO      NAARKAQD--HGVRKVDVFVKGPGS---------GRETAIRSLQAA-----GLEVGAISD
RS11_ROSS1      NAARKAME--NGMRQVEVFVKGPGA---------GREAAIRSLQAA-----GLQVTAITD
RS11_THERP      NAARKAME--HGMRQVDVYVKGAGA---------GREMAIRALAAA-----GLQVMSITD
RS11_AQUAE      KAMKEAKE--HGVQEVEIWVKGPGA---------GRESAVRAVFAS-----GVKVTAIRD
RS11_DEHM1      AAARKAAE--SGLRQVEVLVKGPGS---------GREAAIRSLQAS-----GINVTAIRD
RS11_KORVE      TAANMARD--HGMRSLDVRVAGPGS---------GRESAVRALAAA-----GLDVRVIRD
RS11_SOLUE      TAANKANE--TGLRVVEVRVSGPGS---------GRESAVRALSTA-----GIEVRAIKD
RS11_DESDA      TAARKAQD--NGMRTVGIYVQGPGS---------GREAAMRAISAA-----GMKVAFIRD
RS11_GEOMG      DCAKKAQD--HGMRSVEVYVKGPGS---------GRESALRALQAA-----GFHVNFIRD
RS11_ALCBS      NAGNAAKD--YGLKNLEVRVKGPGP---------GRESSIRALNGC-----GYKITHIED
RS11_BUCAI      RCAEIVKD--YGIKNLEVMVKGPGP---------GRESTIRALNAA-----GFRITNITD
RS11_LEGPC      RAAAVAKE--YGMKSVAVFVHGPGP---------GRESTIRELITQ-----DFKIVEITD
RS11_DICNV      RAGEVAKE--YGVQNLDVNIKGPGP---------GRESAIRALNSA-----GFNIHSITD
RS11_METCA      KAGAVAKE--YGIKNLDVHVTGPGP---------GRESAVRSLNAL-----GFKIVNVVD
RS11_XYLFA      KAGRAVLD--YGMKSLEVRINGPGP---------GRESAVRSLNNV-----GYKITNIID
RS11_HALHL      TAARAAQD--YGLKNVEVRVKGPGP---------GRESAVRALNAV-----GYRITNISD
RS11_PSYWF      VAGKAAQET-YGVKNVDVLVKGPGP---------GRESAVRALGAL-----GYKINSISD
RS11_POLNS      VAGKTAIE--CGIKSLEAQIKGPGP---------GRESAVRALNSL-----GIKITEIQD
RS11_VESOH      SCGEKALA--FGMKNLEVHVKGPGP---------GRDSAIRGLNAQ-----GLKIQSITD
RS11_RHOBA      QAAEKATK--FGMRDVEVRVKGPGS---------GRESAITALQAA-----GLNVKLIEE
RS11_BARBK      DCAKKAEE--HGVRSLEVEVCGPGS---------GRESALRALQSA-----GFIITSIRD
RS11_GRABC      DAGRKARE--HGMETLEIEVSGPGS---------GRESALRALQAV-----GFAITAIRD
RS11_HYPNA      DAAKKAKE--HGLQTVEVRVRGPGS---------GRESALRALQAA-----GLTVTAIND
RS11_JANSC      DAGKKAQD--HGVRTLEVEVQGPGS---------GRESALRALAAL-----GFQISSIRD
RS11_MAGMM      NAGKKAMD--HGMRNLEVRLKGPGS---------GRESALRALAAI-----GFNISHVQD
RS11_MYXXD      DAAAKAME--HGLKNVSVFVKGPGA---------GRESALRALAAA-----GLKINLIRD
RS11_CHLPN      DAAKTAMN--SGLKEVEVCLKGTGA---------GRESAVRALISA-----GLVVSVIRD
RS11_PARUW      DAAKTASS--LGMKEVEVNLKGPGA---------GRESAVRGLQSA-----GLTITAIRD
RS11_COPPD      SVAKKVQQT-YGMKEIDVFVKGPGP---------GRETAIRALQAV-----GLDVKSIKD
RS11_DICT6      MAAKKAISE-YGMKKVDVLVKGPGP---------GRETAIRALQAA-----GLEISLIKD
RS11_DEIDV      DAVKKAQQT-FGMNIVDVIVRGSGS---------GREQAIRAIQAS-----GIEVKSIMD
RS11_THET2      DAAKKAM-A-YGMQSVDVIVRGTGA---------GREQAIRALQAS-----GLQVKSIVD
RS11_BDEBA      DAAKKAM-E-AGMKSVDVYLKGPGA---------GREPAIRALAAT-----GMRILSLKD
RS11_BORAP      SALNKVRDF--GINYVHVYIKGPGI---------GRESAIRAIGSI-----GMTVKSISD
RS11_TREDE      TAVQKCQPY--GLHEVHVFVKGPGV---------GRESAIRTLGTM-----GLKVRSISD
RS11_LEPBJ      NAAEKAMDS-AGLQEVDVMVSGPGI---------GRESAIRSLVAR-----GLNIKMIKD
RS11_CYAP4      SAARRA-ID-QGMRQIEVMVSGPGA---------GRETAIRALQGA-----GLEITLIRD
RR11_CYAPA      NSARQA-ME-QGMRQIEVIISGPGS---------GREMAIKALQAT-----GLEISLIRD
RR11_CHLAT      NAVRQA-IE-QGMKEAEITVSGPGS---------GRETAIRAIRTA-----GLGITVLKD
RR11_GUITH      KATKEA-IS-QGMKKAEVLINGPGS---------GRETAIRALQAA-----GLEITLIRD
RR11_EMIHU      KVGSMA-VE-QGMKQAEVIISGPGN---------GRETAIRALQSC-----GLEVLLIKD
RR11_GRATL      KAAKQA-IE-QGIRQTEVLVNGPGA---------GRETAIRALQAT-----GINITLIKD
RR11_OEDCA      NAARKAIRD-FSLREAKVLITGPGP---------ARETAIHEIYKA-----GIKLTVIRE
RR11_STIHE      NAAKKARRE-FVLKEAKVLITGPGA---------ARDTAIHEIHKA-----GIKLTILRE
RR11_CHLRE      TVARKS-RD-FTMKAAKILVTGPGQ---------GRESAIREIFKA-----GIKVSVIRE
RR11_PLETE      TAARKS-FD-RGLKQAQVLVKGPGP---------GRDKALVGLFKA-----GIQISLIRD
RR11_TUPAK      TAARQS-MD-QGLKQAKVLVKGAGP---------GRETAIRGLIDS-----GLQITLIRD
RR11_OLTVI      TAARKS-MD-YGLRQISVIIKGAGS---------GRESAIRGLSEA-----GLEIKLLRD
RR11_CHLVU      NAAQTC-VS-QGMREIRVNVKGAGA---------GREAALRGLRDA-----GLNITIIRD
RR11_NEPOL      TAIRQC-ID-QGMRQADIIVQGPGN---------GRETAIRALQLA-----GVGVSLIRD
RR11_BIGNA      YAARQC-IN-KGINRAQVLVKGLGT---------GRHTSIRGLQDA-----GLKISLIRD
RR11_OSTTA      EAVRKA-LD-YGLKYVDVMVKGPGA---------GREMAIRALQQL-----GLGVTLIRD
RR11_HETA4      KAAEKA-TE-YGLKKVEVLVKGQGS---------GRETAVRAIQNS-----DIEITAITD
RR11_TRICV      KAALDA-LS-KGMKSVEVLVKGQGS---------GRETAIRSIEGA-----GFEVTSIQD
RS11_THEAB      QVAKEA-VK-LGMKKVDILVKGPGS---------GREAAIRTFQAA-----GLEIGVIKD
RS11_THENN      KVAREA-LR-MGIKRVDVLVKGPGP---------GREPAIRTLQGA-----GLEINQIKD
RS11_KOSOT      KIAKEA-LK-LGLTRVSIEVKGPGA---------GREAAIRTIQAA-----GLVVDSIKD
RS11_PETMO      KVAKEA-LN-LGVKRVDVYVKGPGS---------GRESAIRALQAA-----GLNVESIKD
RR11_CYAM1      KVAQLA-KD-QGMKQVDVFVKGPGA---------GRETAIRALEAA-----GLQITSIQD
RS11_AZOPC      DCAKVAYD--LGMRKVKAYVKGPGN---------GRESAIRMVHNV-----GIEVTEIID
RS11_GRAFK      DASKVAHE--AGMRKVKVYVKGPGN---------GRESAIRAVHNS-----GIEVTEIID
RS11_CYTH3      NCAQVAFE--GGMRKCEVFVKGPGS---------GRESAIRTIQNA-----GIEVLTIKD
RS11_SULMW      DVAEKGLN--AGIKKLKVIVKGPGA---------GRDAAIRALVNK-----NLILLVIKD
RS11_CHLT3      SAAKEAYD--LGMRKVDVRIKGPGS---------GRDAAIRSLQNA-----GLEVKTISD
RS11_SALRD      SAANEAYE--LGLRRVDVYVKGPGS---------GREGAIRAMSES-----GLEVASIRD
RS11_HELAH      SALSKAKE--HGVKEVGIKVQGSGS---------GRETAIKSVGATE----GVKVLWIKD
RS11_SULNB      DAMAKAKE--NGIKEVGIKVQGPGS---------GRDTAVKAIGATE----GIRVTFLKD
RS11_ARCB4      DAMNKAME--HGIKNVGIKIQGPGS---------GRDTAVKAVGSMD----GVRVTWLKD
RS11_RUBXD      SAANKAME--HGVKRVDIQVKGHGS---------GRDMAARTFQAM-----GIEVLSIKD
RS11_EHRRG      HAVKTVVEQ-NGMKTVSIKVSGPGA---------GREAAIRAVQAC-----NLNVTSIKD
RS11_WOLPP      SAAKKVIER-FGMKVVSVIIRGPGF---------GAEAAVKALRNC-----GLTVTSIAD
RS11_ORITB      KVSEVAKE--HGIKTLSIRIQGAGS---------QRESALRAIFNQ-----NFIVTSITD
RS11_RICM5      RASEKAKE--YGLKTISIRIGGPGA---------QRESAMRALFGQ-----NFVVTSIVD
RS11_MYCPE      TAAKVAID--LGLKKVIVKVNGTGS---------GKDTAIRSLHAA-----GLEISEIHD
RS11_UREPA      AAAKAVID--MGLKSVEVHVNGTGA---------SRDTAIRSLQAA-----GLEVTKIKD
RS11_MYCGA      KAAKEAMA--MGLSTIKIYVNGVGR---------GKETAIRSLAAC-----GLTITEIHD
RS11_MYCGE      KVAKTVKE--MGMGSVKMYLKGTGR---------GKDTTIRSFANA-----GITITEINE
RS11_MYCMO      AAVEKAKE--HGLKEVRVELKGTGS---------GKDAARKQIEAL-----GIIIKEVKD
RS11_MYCSP      AAVEKAKE--FGLKEVSILVKGVGP---------GKSTARKQIETS-----GFTIKDVKD
RS11_MYCPU      NASEKAKE--HGIREVSVRVKGIGQ---------GRDAARKQIEVS-----GISVSQIVD
RS11_MYCH2      AAAQKARE--HGMREVIVELKGTGQ---------GKEAARKQIITS-----GLNILLTKD
RS11_MYCS5      DAAQMAKE--HGISQVRVEMKGLGS---------GKDSARKQIEVW-----GIKVTEIKD
RT11_MARPO      NAARVAIQL--GFKFVEVRIKGLGY---------GKESSLRGLKLG-----GLIITKIRD
RT11_PROWI      ALASKAFNE--GYRTIIVKIKGLGY---------GKKSAIRGLQKS-----NLVIKQIQE
RS11_CARRP      KITISILKN--NIKVVDIYIKGLGL---------GKETTLRIINNS-----GIFIRSITD
RR11_CHAGL      KALRPLIDQ-G-MRQAEVMISGPGR---------GRDTALRIIRKS-----GITLNFVRD
RR11_PSINU      NAIRTLISQ-G-MKQAEVMISGPGP---------GRDTALRTIRKS-----GLVLHFVRD
RR11_ADICA      NAIKASVDR-G-MKQAEVMMSGPGP---------GRDTALRAIRRS-----GIILSFIRD
RR11_CRYJA      NVVDTLVNQ-GLLKEAEVMISGPGP---------GRDTALRAIAQS-----GIQLSYVRD
RR11_HUPLU      NAIRMLIDQ-GGMEQAEIIMKGPGP---------GRDTASRAIRKS-----GVVLSFVRD
RR11_CUSGR      NAIRTAINH--GMREADVLIKGPGL---------GRDAALRAIRRS-----GIRLELILD
RR11_OENAR      DAIRPVVDQ--GMQRAEVRIKGPGL---------GRDAALRAIRRS-----GIRLSCIRD
RR11_DIOEL      NAIRTIIDQ--DMQRAEVMIKGAGF---------GRDAALRAIRRS-----GILLSFVRD
RR11_PINKO      NVIRTLMDR--GIGRVEVMISGPGR---------GRDTALRTIRRS-----GILLSFVRD
RR11_PELHO      NAIRTVVTQ--GMHRAVVLVKGVGR---------GRDAALRAILRS-----GVRLHLLRD
RR11_AGRST      DAIRTV-----GLQRAEVMVKGAGS---------GRDAALRAIAKS-----GVRLSCIRD
RR11_JASNU      DAIGPVVDQ--GLQRAKIKLKGTGR---------GRDAALRTISKS-----GIGFTSVQD
RR11_WELMI      SVIYRVV-----IKRAAVLITGCGK---------GRDAALRVIQHN-----RIPIRAVVD
RS11_NEOSM      TLMTKLKRI--GLKILNVHLSGSNP---------IREAALRAIRNS-----GIVIISLQD
RS11_UNCTG      SVGRKVMGI--GVKQIAIFIKGPGP---------GRETAIRGLQSS-----GLGITTIKD
RR11_CYACA      KLIKALLEQ--GTQRIHISVSGPGP---------GRETSIRSFQTS-----GLQIISIKD
RR11_EUGLO      RALKSVLER--GFNGIDIKVSGPGF---------GRNVAIRAIIKM-----GFKVFSLKD
RR11_EUGGR      IAVKKAIEQ--GLQKVEINISGPGT---------GRETALKCVQSL-----GLRISCIRD
RS11_COXBU      EVGRLARDN-FDMRRIAVRVKGPGA---------GRDSAIRGLRSA-----GLEVIHLED
RT11_BOVIN      AAAAKATG--KGVTHVRVVVKGLGP---------GRLSAIKGLTMG-----GLEVISITD
RR11_HELSJ      NIVSFCKF--QRIKRLVIILHGYGK---------GSEMVIRTIREK-----ELKILDIKI
RT11_CHOCR      YIKYKSVN----YKGIHIRTKGFSK---------NKKLVIKQLKQS-----TLNILSISD
RT18_YEAST      RMFELIKEKNMLNKDIEVVMDDFGK---------GRAAFISALVGKEGASVVKKVVKISD
RT11_ACACA      SVAKIARAK--NIKYLFKFFMNTNQ-------TKIGKTIFESFKKT-----GLFILQGVV
                                       .                  .           .     

RS11_AERPE      VTPIPHDTTRRPGGRRGRRV------
RS11_METS5      VTPIPHDTIRRPGGRRGRRV------
RS11_PYRCJ      VTPIPHDTIRPPSGRKGRRV------
RS11_THEPD      VTPLPTDSIRKPGGRRGRRV------
RS11_METTH      VTPIPHDGTGRPGGKRGRRV------
RS11_NANEQ      VTPTPHDGCRRKGGKRGRRV------
RS11_CENSY      VTPIPHDTTRKKGGKRGRRV------
RS11_METJA      VTPVPHDGTTPKKRFKK---------
RS11_META3      ATPIPHDGTTPKKGNR----------
RS11_THEKO      VTPIPHDGTRPKGGRRGRRV------
RS11_THEVO      VTPIPHDGTKKKGGKRGRRV------
RS11_METB6      VTPVPHDSCRPKGGRRGRRV------
RS11_METAC      VTPVPHDGTRPKGGRR---V------
RS11_KORCO      VTPIPHDGCRRPHGRRGRRV------
RS14_CHLRE      VTPIPTDSTRRKGGRRGRRL------
RS14_DICDI      VTPIPTDSTRRKSGHRGRRL------
RS14_TRYBB      VTPVPTDSTRRKGSRRGRRL------
RS14_ENCCU      VTPVARDRVRKRGGHRGRRV------
RS11_HALWD      VTPIPHDGTRAPKNSRL---------
RS11_DESPS      VTPVPHNGCKPPKRRRV---------
RS11_MESFL      CTPIPHNGVRPKKRPRK---------
RS11_PELUB      TTPMPHNGVRPPKKRRV---------
RS11_LACP7      VTPVPHNGCRPPKRRRV---------
RS11_ACHLI      VTPVPHNGCRPPKRPRN---------
RS11_BACSK      VTPVPHNGCRPPKRRRV---------
RS11_HUNT2      VTPIPHNGCRPPKRRRV---------
RS11_LACAC      VTPVPHNGSRPPKRRRA---------
RS11_OENOB      VTPVPHNGSRPPKQRRA---------
RS11_PHYMT      VTTVPHNGCRPPKRPRG---------
RS11_FUSNN      VTPVPHNGCRPPKRRRV---------
RS11_NATTJ      ITPIPHNGCRPPKRRRV---------
RS11_PAEAT      VTPSAHNGCRPPKRRRV---------
RS11_TROW8      TTPLAFNGCRPPKKRLV---------
RS11_CORU7      VTPQPHNGCRPPKRRRV---------
RS11_MYCBO      VTPQPHNGVRPPNRRRV---------
RS11_ROSS1      VTPIPHNGCRPPKRRRV---------
RS11_THERP      ITPVPHNGCRPPKRRRT---------
RS11_AQUAE      VTPIPHNGCRPPARRRV---------
RS11_DEHM1      VTPIPHNGCRPPKRRRV---------
RS11_KORVE      VTPIPHNGCRPPKRRRV---------
RS11_SOLUE      VTPIPHNGCRPPKKRRV---------
RS11_DESDA      VTPIPHNGCRPPKRRRV---------
RS11_GEOMG      VTPIPHNGCRPPKRRRV---------
RS11_ALCBS      VTPIPHNGCRPPKKRRV---------
RS11_BUCAI      VTPIPHNGCRPPKKRRV---------
RS11_LEGPC      VTGIPHNGCKPPIKRRV---------
RS11_DICNV      VTPIPHNGCRPPKKRRV---------
RS11_METCA      TTPLPHNGCRPPKKRRV---------
RS11_XYLFA      VTPIPHNGCRPPKKRRV---------
RS11_HALHL      VSPIPHNGCRPPKKRRV---------
RS11_PSYWF      VTPIPHNGCRPPKKRRV---------
RS11_POLNS      VTPVPHNGCRPPKRRRI---------
RS11_VESOH      VTPIPHNGCRPSKKRRV---------
RS11_RHOBA      VTPIPHNGCRPRKKRRV---------
RS11_BARBK      VTPIPHNGCRPRKRRRV---------
RS11_GRABC      TTPIPHNGCRPRKRRRV---------
RS11_HYPNA      TTPIPHNGCRPPKRRRV---------
RS11_JANSC      VTPMAHNGCRPPKRRRV---------
RS11_MAGMM      VTPIPHNGCRPPKRRRV---------
RS11_MYXXD      VTPIPHNGCRQPKRRRV---------
RS11_CHLPN      ETPVPHNGCRPRKRRRV---------
RS11_PARUW      TTPVPHNGCRPRKRRRV---------
RS11_COPPD      VTPIPHNGCRPPKARRV---------
RS11_DICT6      VTPIPHNGCRPPRRRRV---------
RS11_DEIDV      DTPVPHNGCRPKKKFRA---------
RS11_THET2      DTPVPHNGCRPKKKFRKAS-------
RS11_BDEBA      VTPVPHNGCRPPKRRRI---------
RS11_BORAP      ITPIPHNGCRPKKTRRV---------
RS11_TREDE      VTPIPHNGCRPKKTRRI---------
RS11_LEPBJ      VTPLPHNGCRPRKRRRV---------
RS11_CYAP4      VTPIPHNGCRPPKRRRV---------
RR11_CYAPA      ITPVPHNGCRPPKRRRV---------
RR11_CHLAT      VTPIPHNGCRPPKKRRV---------
RR11_GUITH      ITPVPHNGCRPPKKLRV---------
RR11_EMIHU      ITPVPHNGCRPPKKRRV---------
RR11_GRATL      ITPIPHNGCRPPKKRRV---------
RR11_OEDCA      KSTVPHNGCRPPKRRRI---------
RR11_STIHE      KSGVPHNGCRPPKRRRV---------
RR11_CHLRE      KTGIPHNGCRPPKKRSV---------
RR11_PLETE      ITAIPHNGCRPPKKRRL---------
RR11_TUPAK      ITAIPHNGCRPPKKRRV---------
RR11_OLTVI      ITSIPHNGCRPPKKRRV---------
RR11_CHLVU      ITPIPHNGCRPPKKRRI---------
RR11_NEPOL      ITSVPHNGCRPPKQRRI---------
RR11_BIGNA      ITTTPHNGCRQPKRRRV---------
RR11_OSTTA      VTPLPHNGCRPPKKRRV---------
RR11_HETA4      ITSIPFNGCRPPKRRRV---------
RR11_TRICV      ITPVPHNGCRPPKRRRV---------
RS11_THEAB      VTPIPFNGCRPKKKR-V---------
RS11_THENN      VTPIPFNGCRPKKRRRV---------
RS11_KOSOT      ITPIPHNGCRPRRRRRV---------
RS11_PETMO      VTPIPHNGCRPKKKRF----------
RR11_CYAM1      VTGIPHNGCRPPKRRRV---------
RS11_AZOPC      VTPLPHNGCRPPKGRRV---------
RS11_GRAFK      ITPLPHNGCRPPKRRRV---------
RS11_CYTH3      VTPMPHNGCRPPKKRRV---------
RS11_SULMW      ITPIPHNGCRPPKKRRI---------
RS11_CHLT3      ITPLPHNGCRPPKRRRV---------
RS11_SALRD      VTPLPHNGCRPPKRRRV---------
RS11_HELAH      ITPLSHNGCRPPKRRRV---------
RS11_SULNB      ITPLPHNGCRPPKKRRV---------
RS11_ARCB4      VTPLAHNGCRPPKRRRV---------
RS11_RUBXD      VTGQPHNGCRPPKRRRG---------
RS11_EHRRG      TTKLPHNGCKLPGRRRV---------
RS11_WOLPP      KTAIPHNGCRLRKKRRV---------
RS11_ORITB      TSPVAHNGCRPPKKRRV---------
RS11_RICM5      VSSIAHNGVRPPKRRRV---------
RS11_MYCPE      VTPIPHNGCRPPKKPR----------
RS11_UREPA      VTPIPHNGCRPPKKPR----------
RS11_MYCGA      VTPIPHNGCRPPKKPR----------
RS11_MYCGE      KTPIPHNGCKPPKRPR----------
RS11_MYCMO      VTPIPHNGTRPPKKVLKRDLK-----
RS11_MYCSP      VTPTPHNGTRPPKKILKREK------
RS11_MYCPU      VTPQAHNGTRPPKRVLKREKAR----
RS11_MYCH2      VTPVPHNGTRPPRKWFKRQEKR----
RS11_MYCS5      VTPIPHNGTRPPKRVLKRLRLKK---
RT11_MARPO      VTPTPHNGCRPPKKRRV---------
RT11_PROWI      VTPIAHNGCRPPKKRRV---------
RS11_CARRP      ITPIPHNGCRKKKKRRV---------
RR11_CHAGL      VTPIPHNGCRPPSKRRV---------
RR11_PSINU      VTPLPHNGCRPPKRRRV---------
RR11_ADICA      VTPMPYNGCRPPRKRRV---------
RR11_CRYJA      VTPMPHNGCRPPKRRRV---------
RR11_HUPLU      ITPMPHNGCRPPKKRRV---------
RR11_CUSGR      VTPMPHNGCRPPKKRRV---------
RR11_OENAR      VTPLPHNGCRPPKKRRV---------
RR11_DIOEL      VTPMPHNGCRPPQKRRV---------
RR11_PINKO      VTPMPHNGCRPPKKRRV---------
RR11_PELHO      RTPLPHNGCRPPKRRRT---------
RR11_AGRST      VTPMPHNGCRPPKKRRL---------
RR11_JASNU      VTPVPHNGCRPPNKKRQ---------
RR11_WELMI      ITPNPHNGCRPPAKRRV---------
RS11_NEOSM      MTPVPHNGVRLRRRRRV---------
RS11_UNCTG      ITPVPHDGCRPPKLRRV---------
RR11_CYACA      ITSVPFNGCRPPKKRRI---------
RR11_EUGLO      ITPLPYNGCRPRKRRRT---------
RR11_EUGGR      VTPLPHNGCRPSKRRRI---------
RS11_COXBU      RTPLPHNGCRPRKKRRV---------
RT11_BOVIN      NTPIPHNGCRPRKARRL---------
RR11_HELSJ      KDKKPYNGCRQKKKRRI---------
RT11_CHOCR      KISWPHNGCKKRKIRRI---------
RT18_YEAST      ATKLKFGGVRSPKMRRL---------
RT11_ACACA      VKNKSHGLLMRKKKAKRL--------
                      .