CLUSTAL format seed alignment for MF_01315

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RS13_CAMHC      ------------------------------------------------------------
RS13_ANAD2      ------------------------------------------------------------
RS13_DEHM1      ------------------------------------------------------------
RS13_CHLSY      ------------------------------------------------------------
RR13_CYACA      ------------------------------------------------------------
RS13_ENDTX      ------------------------------------------------------------
RS13_ELUMP      ------------------------------------------------------------
RS13_RHOBA      ------------------------------------------------------------
RS13_BORAP      ------------------------------------------------------------
RS13_SOLUE      ------------------------------------------------------------
RS13_ACIC1      ------------------------------------------------------------
RS13_SALRD      ------------------------------------------------------------
RS13_AMOA5      ------------------------------------------------------------
RS13_PSELT      ------------------------------------------------------------
RR13_EMIHU      ------------------------------------------------------------
RR13_TRICV      ------------------------------------------------------------
RR13_GRATL      ------------------------------------------------------------
RR13_CYAM1      ------------------------------------------------------------
RS13_NEOSM      ------------------------------------------------------------
RS13_ANAMF      ------------------------------------------------------------
RS13_PELUB      ------------------------------------------------------------
RS13_RHOPA      ------------------------------------------------------------
RS13_ORITB      ------------------------------------------------------------
RT13_ARATH      ------------------------------------------MLGLRRSATTLFDISQSL
RT13_SOYBN      ------------------------------------------MFG---SARILSDVTLRL
RR13_ARATH      ----------------------------MAQMVAMPVAHSLSLICNWAKSNPLSRNTLAL
RR13_SPIOL      ----------------------------MAHTLATPVAPSVSLICNTKLSVSLSSSSLAF
RS13_MYCH2      ------------------------------------------------------------
RS13_MYCSP      ------------------------------------------------------------
RS13_PHYMT      ------------------------------------------------------------
RS13_UREPA      ------------------------------------------------------------
RS13_SULMW      ------------------------------------------------------------
RS13_METI4      ------------------------------------------------------------
RS13_AKKM8      ------------------------------------------------------------
RS13_CARRP      ------------------------------------------------------------
RS13_BUCCC      ------------------------------------------------------------
RS13_RUTMC      ------------------------------------------------------------
RS13_NITMU      ------------------------------------------------------------
SWS2_SCHPO      ------------------------------------------------------------
SWS2_YEAST      ------------------------------------------------------------
RT13_PROWI      ------------------------------------------------------------
RT13_MAIZE      ------------------------------------------------------------
RT13_MARPO      ------------------------------------------------------------
RS18_DICDI      ----------------------------------------------------------MS
RS18_ENTHI      -----------------------------------------------------------M
RS18_ENCCU      -----------------------------------------------------------M
RS13_NANEQ      -----------------------------------------------------------M
RS13_METKA      -----------------------------------------------------------M
RS13_METJA      ------------------------------------------------------------
RS13_THEKO      ------------------------------------------------------------
RS13_METST      ------------------------------------------------------------
RS13_CENSY      ------------------MRSPPICMKRTPKLARIRETARCKGADLCPASGRVFIGASGK
RS13_HYPBU      ------------------------------------------------------------
RS13_SULTO      ------------------------------------------------------------
RS13_THEPD      ------------------------------------------------------------
RS13_PYRCJ      ------------------------------------------------------------
RS13_METAC      -------------------------------------------------MLYALQWRKYM
RS13_METTP      ---------------------------------------------------------MET
RS13_METLZ      -----------------------------------------------------------M
RS13_METAR      MSEKTDKTEKKQKKAEETVETASAEAAPAKKGGKKQAAKPAEGAPADEAARKGGKGKKPA
RS13_METHJ      -----------------------------------------------------------M
RS13_ARCFU      ------------------------------------------------------------
RS13_HALMA      -------------------------------------------------MSAEDPNAGED
RS13_THEAC      -----------------------------------------MAKGSANNVKVNQDAGKSQ
                                                                            

RS13_CAMHC      -----------MARISGV------DLPKKKRIEYGLTY-IYGIGLFTSRKILDATG--IS
RS13_ANAD2      -----------MARIAGV------DLPREKRIEVSLQY-IYGIGKTSAKLILERAN--VS
RS13_DEHM1      -----------MVRIAGT------DIPDNKQVYFSLQY-IFGIGPARSEKVLVQAG--VD
RS13_CHLSY      -----------MARIAGV------DIPRNKKIEIAITY-IYGIGRSNGMEILRKAN--VN
RR13_CYACA      -----------MVRIAGR------ELPTNKRVDIALNY-IYGIGPWRSRQILKELK--VD
RS13_ENDTX      -----------MARVAGI------DLPNNKRLDIALRY-IYGIGPAISDEIIKELS--LN
RS13_ELUMP      -----------MARVAGI------DLPKNKRIDVALEY-IYGIGKRNAKDVIAKANGQID
RS13_RHOBA      -----------MPRLMGV------DIPNDKQIQYSLTY-LYGLGLYRAREVCEKLG--ID
RS13_BORAP      -----------MARISGI------DLPSNKQLKIALTS-IYGIGRTRALEVCNKAD--IS
RS13_SOLUE      -----------MARLAGV------DLPPGKRAEIGLTY-IYGIGRTRSKSLLHRAG--ID
RS13_ACIC1      -----------MARLVGV------DLPRDKRLEVALTY-IYGIGRTRALETLAATG--IS
RS13_SALRD      -----------MPRIEGV------DVPDDKRGEIALTD-IYGVGQSRASEILEKAE--VS
RS13_AMOA5      -----------MARILGV------DIPDNKRGEIALTY-IFGIGRSSANQILAAAG--VN
RS13_PSELT      -----------MARIVGV------ELPGNKKCFVALTY-LYGVGRTRAFEILKNTG--IN
RR13_EMIHU      -----------MVRISGV------DLPRNKRIQIGLTS-IFGIGNTSADKILTTAN--LS
RR13_TRICV      -----------MVRLIGV------DLPRNKRIAYALTY-IHGIGITSARKIIELAE--IS
RR13_GRATL      -----------MTRIVGV------DLPKNKRIEISLTY-IYGIGKSKAIEILEQLK--IN
RR13_CYAM1      ------------MRIAGV------DLPSQKKLEVALTY-LYGIGKTLAKEILEACQ--LS
RS13_NEOSM      ------------MRFLGV------NLPDNKAVVVALTY-LYGIGLPTARKICSSLA--ID
RS13_ANAMF      -----------MARIGGV------NVPVNKRVVVALTY-IYGIGPSLASKICEGCG--IG
RS13_PELUB      -----------MARIAGV------NIPQNKLVHIGLTY-IYGIGNKFSSQICTSLE--IP
RS13_RHOPA      -----MTGEKSVARIAGV------NIPTNKRVLIALQY-IHGIGQKNAADILEKVK--IP
RS13_ORITB      -----------MSRISNV------NVPTNKRVMIGLTY-IYGIGRSTAQKICQEVQ--VS
RT13_ARATH      LRNVTFH--GLRVQGIRVGNA---EVPNNKPLKTGLQE-VYGIGRRKSHQVLCH-LGITN
RT13_SOYBN      RQNLSVH--GVRVQNINIGGGVGGEIPDNKRLVYALQN-LHGIGRSKAQHIVAE-LGVEN
RR13_ARATH      PASNTPNKQSLSIRCARVGGV---EIPANKRIEYSLQY-IHGIGRTRARQILVD-LQMEN
RR13_SPIOL      RPVNPKNGGGLSIKCVRVGNV---EIPNNKRVEYSLQY-IHGIGRSRARQILCD-LTLEN
RS13_MYCH2      -----------MARVLNV------EIPNHKRIVIALCS-IFGIGKSLATEIVEKTAKLQE
RS13_MYCSP      -----------MARVLNI------EIPNNKKARISLTY-IFGIGPTIAKQILAD-ANVDG
RS13_PHYMT      -----------MARIAGV------EIPSNKRVVIALTY-IRGIGIKKAQNILSDLKEIDI
RS13_UREPA      -----------MARILGV------DIPNDKRVVISLTY-IFGIGKSTSQQILKL-ANIDE
RS13_SULMW      -----------MAIVSGI------EIPNNKIGLIALTY-IFGIGISTSKRIFKD-TGIDE
RS13_METI4      -----------MARILGV------EIPGNKPLISALPV-IYGIGRSRAKLICEQAE--LN
RS13_AKKM8      -----------MARLFGT------EIPNEKRIEASLPY-IYGIGRSTSKRILEQAG--IN
RS13_CARRP      ----------MNINICGV------LISKKKNIVFGLTK-IYGIGYSMSLKICSKIENFKN
RS13_BUCCC      -----------MTRIAGI------NISDKKHILVALTS-IYGIGISLSKKICFSIGIRCD
RS13_RUTMC      -----------MARIAGI------NIPTHKHIVIGLQS-IFGIGDTRAKATCKILKLDPA
RS13_NITMU      -----------MARIAGV------NIPNHQHAEIALTA-IYGIGRARAREICEAAGINVS
SWS2_SCHPO      -----------MVYILGV------AVNDDKPVRFALLS-FYGIGHAKAEEICAKLSFHNT
SWS2_YEAST      ----------MVVHILGK------GFKGKEVIKIALASKFYGIGKTTAEKICSKLGFYPW
RT13_PROWI      -----------MVYIQNT------HLNDKKQIYQACAQ-IYGLGHHHCLQICDVLGVSPE
RT13_MAIZE      -----------MSYISGA------RSLPDEQVRIASTK-MDGIGPKKAIQLRYRLGISGN
RT13_MARPO      -----------MSYILGT------NLNSNKQVKIALTR-IFGIGPKKAIQVCDQLGLSDT
RS18_DICDI      SSLVFQGEFQHIIRIYNT------NVDGRRKIQYALTC-VKGVGRRFANLVCKKADIDTS
RS18_ENTHI      ATVTSESEFQHMLRVCNT------NLDGRRKVPYALTG-IKGCGRRYAYLVCKRAGIDVN
RS18_ENCCU      NYTYDPAEVQYIVRIHNT------NIDGTKRIPFALTK-IRGIGIRIATAICKRLGIDLR
RS13_NANEQ      AKKPYGEVTKDIVHIADV------DLDGHKPIYVELRK-VVGVNWMFAHAVCAALGIDKW
RS13_METKA      AD----DEVKPIVRIADV------DLDGHKKVPYALTG-IKGIGIRMAYAICRELGLDEE
RS13_METJA      ---MQNSEFKYLIRVSRT------DLDGNKKLIMALQD-IYGVGEAMARAIVRVAKLDPN
RS13_THEKO      ----MTENFRHIVRVAGV------DIDGHKQVRWALTG-IKGIGINFATMVLRVAGIDPF
RS13_METST      ---MAEQEFRHMVRITRK------DVDGNSTIATALTE-IRGIGKAFAIAICKVLDLDQD
RS13_CENSY      RPRLSAQEYKHIVRILGN------DLPGEKKAVVGLRQ-IRGIGYGFATAILDVLKIDNN
RS13_HYPBU      --MLSEQQYRYIVRILGT------DIPGDLKVPYGLAL-VKGIGVNLAYALCRLLGIDPN
RS13_SULTO      --MSQQQQFKYIVRLFGQ------DVDGTMKVPYALAM-VKGIGYNTARAIVFKLGLDKD
RS13_THEPD      --MSGE--FRYIVRVAGV------DLPGDKALVYALAD-IKGIGVSTAQAVAKKLGLDPY
RS13_PYRCJ      --MAQE--IRAIVRIGDT------DLDGNKTVAYALAK-IRGIGIATAYAICRKLGIDPH
RS13_METAC      VEENNNEELRHLVRIMNT------DLQGAKPVQYALTG-LPGVGRRTAKLIAKGAGVDPS
RS13_METTP      KETESSVELRHIVRIYNT------DLDGKKQVQMALTG-IKGVGRRLARVFAVKAGVDPC
RS13_METLZ      VEE---SELKYFVRIINT------DLDGTQPVQLALTG-IKGIGLHAALIIARRAGVDTR
RS13_METAR      AEEKPKDEIKYIVRIANT------DLDGTQTVEFALTG-IKGIGNRISKIIARQAQVDPH
RS13_METHJ      AQDD--QEINYFVRVHNT------DLDGTKPVLISLTG-IKGVGRHTAKFIAETAGVEKN
RS13_ARCFU      ------MTFKHIVRIADT------DLDGNKSLMFALTG-IKGIGLRAARCIVNELGVDGR
RS13_HALMA      ADAEEEEDIRYFVRIGQT------DLDGTKSVERALTE-LNGIGHRAARIIAQKADVDRR
RS13_THEAC      PEKKENKDFQYIVRIANK------DLNGERLLPLALSD-LKGIGERLGYVIAERLDLPID
                                                       . * .                

RS13_CAMHC      YDK-----------RVADLSEDEVAAIRKEIQE------------------------HYM
RS13_ANAD2      PVT-----------RTKDLTDDEVRRIRETIEQ------------------------NVK
RS13_DEHM1      KAI-----------RVNKLTDEEINRLREIIDK------------------------EYR
RS13_CHLSY      PER-----------RVRDLTEEEVGRIREIVDR------------------------EYR
RR13_CYACA      FST-----------RVKDLLVGEIAAIREYIER------------------------NYV
RS13_ENDTX      PAK-----------RVKDLTEEEVGRINNLITK------------------------NLK
RS13_ELUMP      PTT-----------RVKDLTEAQANLLNTILQK------------------------EYK
RS13_RHOBA      PTS-----------PASDISDEDVGRIAALLER------------------------DYL
RS13_BORAP      SSK-----------IAKDLDNDEVNRLRKVIES------------------------DYV
RS13_SOLUE      FDK-----------KIRDLTEDEINKVRTILEE------------------------EGA
RS13_ACIC1      PDL-----------RVRDLTDDDLLKLREWIEA------------------------NYR
RS13_SALRD      VDK-----------RPREWTESETKRVRRIIEE------------------------DYT
RS13_AMOA5      KDK-----------RVSSWTDEESQTIRTVINE------------------------NYK
RS13_PSELT      PDK-----------RVKDLTDEEVSKITKFIQD------------------------HYK
RR13_EMIHU      PDI-----------RCSDLTDEQVSSLRTIIDE------------------------SYQ
RR13_TRICV      PET-----------RTDDLTTEQTIALRDQLESI-----------------------DLN
RR13_GRATL      RNI-----------KTKELKDEQIVLIRQILNN------------------------SYQ
RR13_CYAM1      PDL-----------RVRDVNDEQSMRLRQYIEQ------------------------KYL
RS13_NEOSM      GSA-----------KLPDLEQEQLNSIMAYIKN------------------------DIP
RS13_ANAMF      EDV-----------LVSSLSDEDVVKIRNFIRS------------------------GCV
RS13_PELUB      KAK-----------RINELTDEDILKIREYIDA------------------------NFK
RS13_RHOPA      LDR-----------RVNQLSDAEVLQIREVIDR------------------------DYL
RS13_ORITB      VNK-----------KVKDLSNQELVALRSIIES------------------------KYK
RT13_ARATH      KL-------------ARDLTGKELIDLREEV-------------------------GQHQ
RT13_SOYBN      KF-------------VKDLSKRELYSIRELL-------------------------SKYL
RR13_ARATH      KI-------------TKDMAEEELIILRDEV-------------------------SKYM
RR13_SPIOL      KL-------------TKELSEDELLQVRDEV-------------------------TKYM
RS13_MYCH2      EKFGKKFPILTENTKVKEINEEVLQVIRDVA-------------------------KTYK
RS13_MYCSP      EK------------RVKELTEEELTRIRDEA-------------------------KKYT
RS13_PHYMT      NT------------KVEDLKEQHLIAIRNKIQ-----------------------NGNYL
RS13_UREPA      NI------------RVKDLADEQIAEIRRVALNFVK-----------------ANGEKLQ
RS13_SULMW      NI------------KVINWSDEDINKIRK----YIS-----------------SN---IR
RS13_METI4      PQM-----------RAKDLTNQQINRIIQVIEE-----------------------NGFV
RS13_AKKM8      PDI-----------RTGQLTDEQLTKIVQVITT-----------------------DGIL
RS13_CARRP      K-------------KFKDLTNEEKAKIENFINK-------------------------IN
RS13_BUCCC      V-------------KINSLTKEKIESLRSIISK-------------------------FL
RS13_RUTMC      T-------------KVVDIAEDQLELIRAEVAK-------------------------YE
RS13_NITMU      T-------------KMKDVTDAEMDKLRDNVAK-------------------------FV
SWS2_SCHPO      LRV-------------RELTNVQLTTLSQLLS-------------------------GMT
SWS2_YEAST      MRM-------------HQLSEPQIMSIASELS-------------------------TMT
RT13_PROWI      TRL-------------GMLSTGQHTLLAQIITQ------------------------NYD
RT13_MAIZE      IKI-------------HELTKYQIDQIEQMIAQ------------------------DHV
RT13_MARPO      IKV-------------NKLTKYQFDQILKIISQ------------------------NYL
RS18_DICDI      KRA-------------GELSKDEVERLTTIMNHPRQ--YNIPTWFLNRQKDIKDGKYSHC
RS18_ENTHI      KRA-------------GLMTPAEIEKIVDILTTQLN--YKIPVWFLNRQKDNKDGKDSQL
RS18_ENCCU      KRA-------------GEMGEDEMKRISDAILDPAS--VGIPESYMNHQRDIIDGTTSHL
RS13_NANEQ      RKI-------------GSLSDEELEKLEDALRNPWK--YGIPSWLYNRRRDPETGKDLHL
RS13_METKA      KKL-------------GELSDEEIERIEEEIKKLSEGESNIPSWMYNRQKDYETGEDMHL
RS13_METJA      KLA-------------GYLTEEEVKKIEEVLADPAK--FGIPSWMFNRRKDYVTGEDKHV
RS13_THEKO      MKA-------------GYLTDEQVKKIEEILADPVA--HGIPAWAVNRPKDYETGKDMHL
RS13_METST      AQI-------------GYIDDESVKQIEAVLENPQE--FGIPEWFLNRRNDYETGETKHL
RS13_CENSY      SNI-------------GYLTDEQVASIEKLLQDPAG--AGFPTWFLNRRKDLETGEDRHI
RS13_HYPBU      KRI-------------GFLTDAEIEKIEKAMANPLA--IGIPVWMLNRRKDYETGKDLHL
RS13_SULTO      RRL-------------GELSDEDIKKIENYLTDKKI--LEVPNWMYNRRKDYESGIDMHL
RS13_THEPD      RLL-------------GTLSEEEVEKLSAALREIEK--LGLPPWMLNRRKDPFLGVDRHL
RS13_PYRCJ      ATL-------------GLLPEDQINKLDWAVRNLHE--LA-PAWFLNRRKDPETGRDLHL
RS13_METAC      AIL-------------GYLPEEEVAKLDTAIGKFED---IVPSWMLNRQKDLATGQDKHL
RS13_METTP      ATL-------------GKLPEEQIEALKNVIESVRD---NIPAWMMNRRKDIITGVDKHV
RS13_METLZ      ATM-------------GLLGDEDVAAIEEQVKAYPA---SVPKWMVNRPVDVYSGEPKHL
RS13_METAR      ATM-------------GYLPPEQVDKLRAVIDNLEA---NVPVWMLNRRRDIYTGEDKHL
RS13_METHJ      VLM-------------GKLDEASVDRIREVVSNYAD---RIPVWMSNRPKDVYTGVKRHL
RS13_ARCFU      AKL-------------GELDDETIEKVKKFVEEEIE---SLPSWLLNRRKDPYSGQDLHL
RS13_HALMA      AVF-------------GKLDDDVIERVVERVENFAD---DVPEWMTNHQKDYFTGETTHE
RS13_THEAC      KKI-------------GELKEEQLEKLREYVEAKEY---DLPEWLLNHRREPVTGKNLNL
                                          :                                 

RS13_CAMHC      VEGDLRKEVSMNIKSLMDLGCYRGLRHIKGLPVRGQKTKTNARTRKGKRK-TVGAVSAAA
RS13_ANAD2      VEGDLRREISLNVKRLMDLGCYRGLRHRKGLPVRGQRTHTNARTRKGPKKGLVRKAAAPA
RS13_DEHM1      VEGDLRKEIALNIKRLIDIGCYRGNRHKHNLPVRGQRTKTNARTRRGPRKTVAGRGQKRG
RS13_CHLSY      VEGDLRREVQLNIKRLMDIGCYRGLRHRRGMPVRGQRTRTNARTRRGRRGQAI--GIKKK
RR13_CYACA      VESDLRRFELLNIKRLIEINSYKGKRHKMLLPVRGQRTRTNARTRRGVKRII--------
RS13_ENDTX      VEGDLRREVQSNIKRLIEIRSYRGLRHRRNLPVRGQRTKTNARTRRGKRKTVGA-GKSTS
RS13_ELUMP      VEGELRREISGNIQRYVDTGSYRGNRHRKRLPVRGQRTKTNSRTRKGKRRTVG------S
RS13_RHOBA      VEGPLRRQVTQNISRMREIKSYRGIRHRVSLPVRGQRTKTNARTRKGPRK-TVAGKKGVK
RS13_BORAP      VEGKLRSEVAMSIKRLMDIACYRGVRHRKGLPLRGQRTKTNARTRKGKRK-TVANKKIAS
RS13_SOLUE      VEGDLRKEISMNIKRHIEMGSYRGLRHRRSLPVRGQRTHTNARTRKGPRRGTVANKKKAT
RS13_ACIC1      VEGDLRREVAADIRRKIEIGCYQGIRHRRGLPVRGQRTHTNARTRKGPRK-TVAGKKKPG
RS13_SALRD      VEGQLRTEVQMNIKRLKEIGCYRGKRHREGLPVNGQRTRTNARTRKGKR-KTVAGRSQST
RS13_AMOA5      VEGELKSEIRLNIKRLVDIGCYRGRRHVLGLPVRGQSTKNNARTRKGKR-KTVANKKKAA
RS13_PSELT      VEGELRTDINRNIKRLIDIGCYRGFRHKLGLPVRGQRTRSNARTRKGPRPSRIKTKKKKE
RR13_EMIHU      TEGDLRRVYSLNIKRLTEIGSAAGRRHRVNLPVRGQRTRTNARTRKGKVKTAVAKKKGR-
RR13_TRICV      LEGDLRCFNGLNIKRLNEINCHRGKRHRNNLPVRGQRTRTNARSRRGSKKTVTGKKK---
RR13_GRATL      IEGDLKRVESMNIKRLMTISSYRGKRHQLGLPLRGQNTRTNARTKRGIKKTMAGKKKAPR
RR13_CYAM1      IESDLKRVESMNIKRLMDIGCYRGRRHRALLPVRGQRTRSNARTRRGAKKTVAGKKLAK-
RS13_NEOSM      FEGELRKSVAFSIKHLVDIKCYRGVRHRKNLPVRGQRTRTNARTRKGKVRVPIAAKKRV-
RS13_ANAMF      VEADLRKEVAMNIKFLMDIGCYRGLRHRKKLPVRGQRTHTNARTRKGGTRLAVAVKKG--
RS13_PELUB      VEGDLRRDYSLTIKRLIDLACYRGSRHRKKLPVRGQRTRCNARTRKG-KAIAIAGKKLTP
RS13_RHOPA      VEGDLRRETGMNIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRKG-PAKAIAGKKK--
RS13_ORITB      VEGDLRREINLNIKKKKDIRCYEGLRHIRKLPVRGQNTHSNARTRKG-KAIAIAGKKKPN
RT13_ARATH      HGDELRRRVGSEIQRLVEVDCYRGSRHRHGLPCRGQRTSTNARTKK-GKAVAIAGKKKAP
RT13_SOYBN      IGNDLKKCVERDVGRLVGIQCYRGIRHVDSLPCRGQRTHTNARTRR-SRK-TFSGSR---
RR13_ARATH      IEGDLRRFNALAIKRLKEIQCYRGVRHIQGLPCRGQRTKNNCRTLK-GKKIAIAGKKKVS
RR13_SPIOL      IEGDLRRFNAIAIRRLKEIQCYRGVRHIQGLPCRGQRTKNNCRTLKRGKRVQIAGKKKPP
RS13_MYCH2      TEGDLHREVQSNIKRLIEIKCYRGIRHRKGLPVRGQVTQKNARTRK-GPRKTIMAKKDKG
RS13_MYCSP      TEGDLKREINLNIKRLMEIKSYRVIRHRKDTCKRS--TKKNARTRK-GPKKDNRWKER--
RS13_PHYMT      VEGDLKREVALNIKRLMENGSYRGLRHRKGLPSRGQNTRNNARTIK-GKRRTKNTVANNK
RS13_UREPA      LEGDLRRTVAMDIKRLMEIGSYRGIRHRRGLPVRGQRTKTNARTRK-GPRKTVANKKIET
RS13_SULMW      IEGELRFEIQLDIKRMIEIGCYRGIRHRIGLPVRGQKTKNNCRTRK-GKKKTVANKKKKI
RS13_METI4      VEGDLRREIQQNIKRLQSIRCYRGIRHIRGLPVRGQRTSTNARTRKGPRKTIGVVRRKEA
RS13_AKKM8      IEGDLRREKQSILKRLTSINCYRGQRHRRGLPVRGQRTRTNARTRKGKKKTVGAQAKKK-
RS13_CARRP      VENNLKTIIKENFKKKLNLNSYKSLRHKKKLPCRGQRTKTNAKTRKKMNHEII-------
RS13_BUCCC      VEGDLRREKTINIKRLMDIGCYRGLRHRKHLPVRGQRTKTNARTRKGPRKLIKSR-----
RS13_RUTMC      VEGDLRRQVSMDIKRLKDLGCYRGVRHRKSLPLRGQRTKTNARTRKGPRRLIK-------
RS13_NITMU      VEGDLRREVSMNIKRLMDLGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKAVRASSAKAG
SWS2_SCHPO      IEGDLRRQRNADISRLVNIRCYRGMRHVNGLPVNGQNTRTNAKTAKKLNKVPRRGYMTLS
SWS2_YEAST      IEGDARAIVKDNIALKRKIGSYSGMRHTLHLPVRGQHTRNNAKTARKLNKIDRRGIHTFS
RT13_PROWI      TGSDVRRFTRQNIQRLVNIHSYRGYRHIQGLPVRGQRSHGNARTVRKLKNVIKI------
RT13_MAIZE      VHWELKRGERADIERLISISRYRGIRHQDGSPLRGQRTHTNARTARKQIRKGNERRLPKE
RT13_MARPO      VDSELKRVIQRDIKRLISIGCYRGFRHNAGLPLRGQRTHTNAKTCRK-LRYVSIRS----
RS18_DICDI      LANQIDVKFREDLERLKKIRAHRGVRHHFGLRVRGQKTKTTGRRGRTVGVAGRR------
RS18_ENTHI      IANAVETRLREDIEALKKMRAHRGLRHYWGLRVRGQNTKTTGRRGRTVGVSRTKRA----
RS18_ENCCU      IGTRLDADLRMMIERGKKNKRIRAYRLDVGLKVRGQRTKSNGRRGRSMGVSRKK------
RS13_NANEQ      VGNDYKITMEFDIKREMQINSWRGYRHREGLPVRGQRTRSHHRKGRTVGVIKKK------
RS13_METKA      VGAELEMTVKQDIDRLKKIRAYRGIRHELGLPVRGQRTKSSFRRGRTVGVKKKQ------
RS13_METJA      IESDLMIIKQEDINRLKRIRCYRGIRHELGLPCRGQRTKSTFRRGPTVGVSRRKK-----
RS13_THEKO      ITAKLVMAWREDVNRLRRIRAYRGIRHELGLPVRGQRTRSNFRHGTTVGVSRRKK-----
RS13_METST      IESDLNMTLRDDLNRMKMIRSYKGKRHEVGLPVRGQRTKSTFRHGSSVGVSRTRPTGN--
RS13_CENSY      FTSDIEFTVRNDVERERVSGSWKGYRHMFGLKVRGQRTRNTGRKGGAVGVAKGGKVMPAK
RS13_HYPBU      VGADLIYYVKRDIEREKRIRSWRGIRHALGLKVRGQRTATTGRIGMTIGVRKGKK-----
RS13_SULTO      VTSDLIFYVRNDIEREKKIKSWRGVRHSLGLKVRGQRTRTTGRTGVTVGVRRSKAAQAAQ
RS13_THEPD      ITSDLLITVRNDIEFMKKIKSYKGVRHMLGLKVRGQRTRTTGRTGLTVGVKRGK------
RS13_PYRCJ      IGSELVLAAKRDVDLMKKLKSWKGIRHSLGLKVRGQRTVTTGRFGATAGVTKKK------
RS13_METAC      LGTDILLTFREDINNLKKVRAYRGLRHERGLKVRGQRTKSTGRRGSTVGVSRKK------
RS13_METTP      MGAEVLTTLREDLDIMKKTRSYKGIRHELGLRVRGQRTRSTGRSGATVGVTRKKTQAKK-
RS13_METLZ      YGSDLSLAKEDDINLMKKMRCYRGIRHENGLKVRGQRTKATGRFGKIVGVSKRRN-----
RS13_METAR      YGVDLTMAVKEDINIMKKIRSYKGIRHERGQKVRGQRTKSTGRTGATVGVVRKKGEQGGA
RS13_METHJ      LGADVTMTVDDDINLLKKIRAYRGIRHETGQKVRGQRTKSTGRTGLIVGVKRKKA-----
RS13_ARCFU      LSKDVDFARMLDIERLIKMKAYRGVRHARGKKVRGQRTRSTGRKGRTVGVVRRKR-----
RS13_HALMA      TGNDLQLTRRQDINRMKMIDSYRGVRHKRGQKVRGQRTKSTGRTEGTIGVNVEAIKEEQA
RS13_THEAC      VSTDLEIQVQEDINLMKKIRSYKGIRHEKGKKVRGQRTRSNGRKGLSIGVVRKKE-----
                            .            *       ..  :    :                 

RS13_CAMHC      NKE------------------------
RS13_ANAD2      PMA------------------------
RS13_DEHM1      ATKK-----------------------
RS13_CHLSY      ATKK-----------------------
RR13_CYACA      DLKGV----------------------
RS13_ENDTX      SIKRVK---------------------
RS13_ELUMP      KTK------------------------
RS13_RHOBA      DLR------------------------
RS13_BORAP      K--------------------------
RS13_SOLUE      GKT------------------------
RS13_ACIC1      KK-------------------------
RS13_SALRD      QKK------------------------
RS13_AMOA5      KK-------------------------
RS13_PSELT      QTV------------------------
RR13_EMIHU      ---------------------------
RR13_TRICV      ---------------------------
RR13_GRATL      K--------------------------
RR13_CYAM1      ---------------------------
RS13_NEOSM      ---------------------------
RS13_ANAMF      ---------------------------
RS13_PELUB      LKK------------------------
RS13_RHOPA      ---------------------------
RS13_ORITB      K--------------------------
RT13_ARATH      RK-------------------------
RT13_SOYBN      ---------------------------
RR13_ARATH      K--------------------------
RR13_SPIOL      GPK------------------------
RS13_MYCH2      K--------------------------
RS13_MYCSP      ---------------------------
RS13_PHYMT      K--------------------------
RS13_UREPA      R--------------------------
RS13_SULMW      NK-------------------------
RS13_METI4      KKGKV----------------------
RS13_AKKM8      ---------------------------
RS13_CARRP      ---------------------------
RS13_BUCCC      ---------------------------
RS13_RUTMC      ---------------------------
RS13_NITMU      R--------------------------
SWS2_SCHPO      PASTRPITWSFCLPRMVSVFQKLKHIH
SWS2_YEAST      QAKVQHNPSLWS-----CIFGK-----
RT13_PROWI      ---------------------------
RT13_MAIZE      QATD-----------------------
RT13_MARPO      ---------------------------
RS18_DICDI      ---------------------------
RS18_ENTHI      ---------------------------
RS18_ENCCU      ---------------------------
RS13_NANEQ      ---------------------------
RS13_METKA      ---------------------------
RS13_METJA      ---------------------------
RS13_THEKO      ---------------------------
RS13_METST      ---------------------------
RS13_CENSY      GGAGAPPQEEAAGAEPAKTDAPEEKKA
RS13_HYPBU      ---------------------------
RS13_SULTO      QQQKAQASSGGEKKQG-----------
RS13_THEPD      --EKAQQQKGG----------------
RS13_PYRCJ      ------AAPGGK---------------
RS13_METAC      ---------------------------
RS13_METTP      ---------------------------
RS13_METLZ      ---------------------------
RS13_METAR      AKKEDKK--------------------
RS13_METHJ      ---------------------------
RS13_ARCFU      ---------------------------
RS13_HALMA      EDAAAEDDE------------------
RS13_THEAC      ---------------------------