CLUSTAL format seed alignment for MF_01318_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RL1_BUCAI       ---MNK-----------KTKRMKKIKEHIN--FAKLHHIDETIDLLKKSST---VKFNES
RL1_BUCAP       ---MKK-----------INKRMKKIKNDIN--FEKLYYIDELIQLLKKSSN---VNFNES
RL1_BUCBP       ---MKK-----------LTKKQNLFKTFLN--HTKKYDIDEGITLLKKMAT---SKFIES
RL1_BAUCH       ---MGK-----------TTKRMRMISNQID--RTKQYNIHEAIPLLKDHAT---VKFIES
RL1_BLOFL       ---MNR-----------LSKRKKIL-NCID--KSVQYNIADGLRILQETAR---VKFVEN
RL1_BLOPB       --MTGK-----------LSKRMRMMRDCAD--TSIQYPVLDGLELLKKMAR---VKFVES
RL1_BUCCC       -----------------MKKKKKNYTFNKK--NKKIYNIKEAIQLLKNKKS---AKFIES
RL1_WIGBR       ---MSK-----------MTKKMKKICEIKS--SLKDYKFNNLISILNSFPK---AKFNEN
RL1_DEHMC       ---MVT-----------HGKKYQDAIKLLD--QSVAYAPAEAIDLAKKMS---AAKFDET
RL1_RHOBA       ---MGK-----------KSKRYRAALEKQP--KE-MLPLGKAVEVLKTYD---ATKFDQT
RL1_TREDE       ----MK-----------HGKNYKNALAKYD--SAASYELPKAVDIVKELK---YAKFDET
RL1_TREPA       ----MK-----------RGKKYRAAVARYD--RAERFSLDRAVGLLKEVR---YASFDET
RL1_BORBU       ---MSK-----------KGKKYIEAFSKVD--KNKFYNIEDAILLLKEIK---FAKFDET
RL1_LEPIC       ----MQ-----------RGKKYRAHKEKVD--STKFFSIDKAVELAKSTS---YTKFDGT
RL1_CHLFF       ---MTK-----------HGKRIRSILKSYD--FSKSYSLQEAIDILKQCP---TVRFDQT
RL1_CHLPN       ---MTK-----------HGKRIRGILKNYD--FSKSYSLREAIDILKQCP---PVRFDQT
RL1_CHLMU       ---MTK-----------HGKRIRGIQEKYD--FTKPYSLGEAIDILKQCP---AVRFDQT
RL1_PARUW       ---MGR-----------PSKRIREIAKSLD--AAKAYTIREAIDILKKCP---PVKFDQT
RL1_DEIGD       ---MPK-----------HGKRYRALIEKVD--RNRQYSIDEAAALVKDLA---TAKFDET
RL1_DEIRA       ---MPK-----------HGKRYRALEGKVD--RNKQYSIDEAAALVKELA---TAKFDET
RL1_THET8       ---MPK-----------HGKRYRALLEKVD--PNKVYTIDEAARLVKELA---TAKFDET
RL1_PROMP       ---MKK-----------LSKRMKALSTKIE--D-RTYAPLEALGIVKENA---NAKFDET
RL1_PROMT       ---MKN-----------FSKRMTTLLSKVE--E-RSYSPIEAIKLVKENA---NAKFDET
RL1_SYNS3       ---MPK-----------LSKRLASLVTKIE--D-RAYQPLEAIQLVKENA---TAKFDET
RL1_SYNS9       ---MPK-----------LSKRLAGLASKIE--D-RTYGPLEAIALVKDNA---NAKFDET
RL1_SYNPW       ---MPK-----------TSKRLASLVNKIE--E-RAYEPLEAIKLVKENA---TAKFDET
RL1_PROMM       ---MPK-----------LSKRITGLLAKVE--D-RVYQPLEAIQLVKENA---TAKFDET
RL1_PROMA       ---MTK-----------ISKRMKSLSAKVE--D-KSYAPLEAIQLVKENA---NAKFDET
RL1_SYNR3       ---MKS-----------ISKRFKAAQATVE--P-RAYAPLEAVSLVKANA---TAKFDET
RL1_TRIV2       --MTKK-----------VSRRLRELQAKVE--D-REYGPLDALSLLKETA---TAKFAEA
RL1_THEEB       ---MRK-----------LSRRLRELYAKVE--D-RPYAPLEALQLLKETA---TAKFPES
RL1_SYNP6       --MTRK-----------VSRRLQELQKKVE--D-RAYEPLAALNLLKETA---TAKFPES
RL1_TRIEI       --MPKK-----------ISRRLQELRKKVE--E-RPYEPKEALQLLKETA---TAKFLEA
RL1_SYNJA       --MARK-----------LSKRMQALREKVK--P-IAYPPAEALALMKETA---TAKFDEA
RK1_CYAPA       ---MKK-----------RSRRMQELVGKVE--E-QLYEPLEAIQLLKQIS---TAKFIET
RL1_SYNY3       --MTKK-----------LSKRMQAAIAKVD--DSKLYSPLEAMELLKETA---TAKFDET
RL1_GLOVI       ---MVQ-----------LSKRLKALREQVD--RQTIYAPQKALELLKQTA---NAKFDET
RK1_RHDSA       ---MAK-----------VSQRVKKIQTKVE--L-RPYKGTEALNLLKELA---TAKFTET
RK1_GUITH       ---MSK-----------VSKRISEVRNKIE--N-KPYKAIEALNLLKDTA---TAKFVES
RK1_PORPU       ---MKK-----------TSRRLKTLKSKVD--P-KLYSLNEAVTILRATS---NAKFKET
RK1_PYRYE       ---MKK-----------FSRRLTTLKSKVE--P-KLYTINEAVSILKATS---NAKFKET
RK1_GRATL       ---MKK-----------RSRRFSTLLKQIE--ADKLYSPLDALNLMKNLS---NVKFIET
RK1_CYAM1       ----MK-----------RSKRYQSLCSLIE---PKLYSPQEALKLLKKLA---TAKFVET
RK1_CYACA       --MVKI-----------RSRRFKILQSQIS--VEKMCEPIEAINLLKSGP---KAKFSET
RK1_TRICV       ---MRK-----------LSRRQKENRAKTK--DSIYSNLEDAITILQETA---TAKFTET
RK1_THAPS       ---MRK-----------LSRRQNENLKKIK--NVVHSSLEEAITLLQDTA---TAKFIES
RK1_PHATC       ---MQK-----------VSRRHKENFERTK--NIVYSNIDEAIAVLKETA---TTKFVES
RL1_KORVE       --MAK------------PGKKIEAARKQVE---VRPYALQDAVPLLQKVK---FAKFDET
RL1_SOLUE       --MARK-----------PGKQYQAAQKQVE---SKEYQLEEAIPLIKKIK---FAKFDET
RL1_AQUAE       --MAR------------RGKKYIEASKLVDR--NKRYTLEEAVDLLKKMEEVLQRRFDET
RL1_RUBXD       -----M-----------AGKRLLEQRARVE--RERLYSPREALELLKELD---GARFDET
RL1_SALRD       --MANI-----------EGKRYQDANELVEE-QDEPVKLREAAGLAKDTA---TANFDES
RL1_CLOBL       -----M------------GKKYTESVKLVD--KNTLYTVQEAIELVTKTS---KAKFDET
RL1_CLONN       --MAKM------------GKKYSESIKLID--KNSLYTPSEAIDLTLKTA---KAKFDET
RL1_CLOAB       -----M------------GKKYIESAKLVD--KNTLYAPDEAVDLVVKTS---KAKFDET
RL1_CLOPS       -----M------------GKKYIESSKLID--KNALYTPAEALELAVKTA---KAKFDET
RL1_CLOTE       -----M------------GKNYAESAKLID--KSTLYSSEEAMNLVVKTS---KANFDET
RL1_HUNT2       ---MKR------------GKKYQESVKLVD--KTKLYDPVEAMELVQKTA---KAKFDET
RL1_CLOD6       --MAKK------------GKRYAGALQKVD--RTKFYDASEALTLVSDIA---GAKFDET
RL1_CALS4       ---MKR------------GKRYLENLKLYD--KTQQYSSDEAMDIVLKTA---NAKFDET
RL1_CALS8       ---MFR------------GKKYQEAAKLVD--KTKLYDPEEAIDLALKTS---YAKFDET
RL1_DESHY       --MAKV------------GKNYQEAVKAFD--RAALHEPMEALAVVKKIA---KAKFDET
RL1_CARHZ       --MPKH------------GKKYLEAAKKVD--KTKLYEPAEAFSLVKELS---FAKFDET
RL1_SYNWW       ---MKR------------GKNYQQAGEKFD--RLTLYEPKEALELVKEIA---KAKFDET
RL1_MOOTA       --MPKH------------GKRYREVSKLVS--RQELYEPDEAIELLKKTA---SAKFDET
RL1_SYMTH       --MPKH------------GKKYRSAAALVD--RNKLYDPMEALELVKKTA---TANFDET
RL1_THEMA       --MPKH------------SKRYLEARKLVD--RTKYYDLDEAIELVKKTA---TAKFDET
RL1_FUSNN       --MGKH-----------RGKKYLEVAKLVE--IGKLYDIREALELVQKTK---TAKFTET
RL1_ACIC1       ----MK-----------RGKKYRAAAQLVD--RTKLYSPLEAMRLAKQTN---TMRVPAT
RL1_THEFY       ----MK-----------RSKSYRKAAEQID--RTRLYTPAEAVRLAKETS---TVKFDAT
RL1_MYCUA       ---MSK-----------NSKAYRAAAEKVD--RSNPYTPLQAAKLAKETS---STKQDAT
RL1_MYCLE       ---MSK-----------SSKAYRAAAVKVD--RTNLYTPLQAAKLAKETS---STRQDAT
RL1_MYCSS       ---MSK-----------NSKAYREAAEKVD--KTKLYSPLEAAKLAKETS---SKKQDAT
RL1_NOCFA       ---MAK-----------RSKAYLAAAEKVD--RTKLYSPLAAARLAKETA---TTKTDAT
RL1_SACEN       ---MAK-----------RSKAYQQAAELVD--RARLYAPLEAAELAKKTA---KVKMDPT
RL1_FRACC       ----MK-----------RSKAYRAAAEKIN--PENFYSPLEAVRLAQQTS---TTKYDAT
RL1_NOCSJ       ----MQ-----------RSKTYRAAAESFD--KDELYAPLAAIKIAKTSS---KKKFDET
RL1_CUTAK       ----MK-----------RSKAYRAAAEKVN--LDQLYSPEEALALVASGA---SAKFDET
RL1_ARTS2       ---MAK-----------RSKAYEAAAAKID--AEKFYAPFEAVTLAKDTN---PSKFDAT
RL1_STRCO       ---MSK-----------RSKSLRAADAKID--RDKLYAPLEAVRLAKETS---TSKFDGT
RL1_CLAM3       ---MA------------KSKAYRAAAEKID--PAKAYTASEAVELARETG---SSKFDST
RL1_LEIXX       ---MAQ-----------KSKAYRAAAEKIE--AGKYYTPTEAVALAKETG---SAKFNST
RL1_BIFAA       ---MVQ-----------RSKKYREAAEKID--RNNLYTANEAIALLKSMP---EYKFDQT
RL1_BIFLO       ---MVK-----------RSKKYREAAERVD--RNNLYTANEAIALLKSMP---SYNFDQT
RL1_CORGL       ---MSK-----------NSKAYREAAEKID--AGRIYSPLEAANLVKETS---SKNYDAS
RL1_COREF       ---MSK-----------NSKAYREAAAKID--AGREYTPLQAAELVKETS---SKNFDAS
RL1_CORDI       ---MGN-----------KSKAYKAAAEKID--KGRLYTPLKAAELVKETS---SKNCDAT
RL1_CORJK       ---MSK-----------TSKAYRAAAEKID--AGRLYTPLAAAKAVKETS---SKNFDAT
RL1_TROWT       ---MTK-----------RSKAYRSAVTSIA--SDKLYPVEDAIGLVKETA---YAKIDSA
RL1_MYCMS       ---MAK-----------ISKRFKEALSKVE--KNKVYPLTQALDLAKQTS---TTKFDST
RL1_MESFL       ---MAK-----------ISKRMKSVKGLVD--KQKVYALDEAIKLAKETS---TTKFDST
RL1_MYCGE       ---MKK-----------LSKRMQAVTKLID--KNKLYPIQEAFELIKKTA---ITKFVSS
RL1_MYCPN       ---MAK-----------LSKKMKIAVGLVD--KTKLYPLQEAVDLVKKTS---ITKFNGS
RL1_MYCGA       --MAKK-----------LTKKTKAALGSFD--PKQIYDLDKAIEIAKKTA---TTKFESS
RL1_UREPA       ---MAK-----------ISKKLFAAYEGID--KQKAYPLFDAIKLAQEKS---ITKFDGS
RL1_MYCHJ       ---MKK-----------VSRNLLQARQMVD--KNRFYSLEEAMELVKKTS---YTKFSGS
RL1_MYCPU       ---MAK-----------IGKKLQEAKKLVD--KNQFYPLIEAIQLAKKTS---YSKFDAS
RL1_MYCS5       --MAKK-----------LSKNQQKVRALFD--ANQAYDLHEAIELAKKTS---YTKFDAS
RL1_MYCMO       --MSKK-----------ITKNRQKINELIKDVENKIYSLDEAIEMAKKTS---FVKFDAS
RL1_ONYPE       ----MK-----------RGKKYLASLQMFD--VKKTYPLQEAISLAKQTQ---VAKFDAA
RL1_BACCR       MKMAKR------------GKKYVEAAKLVD--RAAAYSATEAVELVKKTN---TAKFDAT
RL1_BACSU       --MAKK------------GKKYVEAAKLVD--RSKAYDVSEAVALVKKTN---TAKFDAT
RL1_GEOKA       --MPKR------------GKKYLEALKLVD--RSKAYPIAEAIELVKKTN---IAKFDAT
RL1_BACSK       --MAKK------------GKKYADALKLVD--RDTAYQAEEALELVKKTS---VAKFDET
RL1_BACHD       --MAKR------------GKKYLEAVKLID--RDQAYQVEEALELVKKAS---VAKFDET
RL1_OCEIH       --MAKI------------GKKHQEALKLVD--RSKSYEIKEAVELAKKAA---KANFDET
RL1_LISMO       --MAKK------------GKKYQDALKQID--ANKVYTAEEAVELAKKID---FAKFDAT
RL1_ENTFA       --MAKK------------SKKMQEALKKVD--ATKAYSVEEAVALAKDTN---IAKFDAT
RL1_STAEQ       --MAKK------------GKKYQEAASKVD--RTQYYSVEEAIKLAKETS---VANFDAS
RL1_STAS1       --MAKK------------SKRYQEAASKID--RLKHYNVEEAVELAKETN---IANFDAS
RL1_STRMU       --MAKK------------SKQLRAALEKID--STKAYSVEEAVALAKETN---FAKFDAT
RL1_STRS2       --MAKK------------SKNLRAALEKID--STKLYSVEEAVALAKKTN---FAKFDAS
RL1_LACLA       --MAKK------------SKALRAAIEKID--ATKLYSVEEAVALAKETS---FAKFDAT
RL1_LACBA       --MAHK-----------RGKKYQDAAKQVE--ADKVYGMGDAIDLVKKID---FAKFDAT
RL1_LEUMM       --MTQK-----------HGKNYVAAVAKVE--AEKAYALNDAVSLVKEID---FAKFDAS
RL1_PEDPA       --MAKK------------GKKFQDAAKQVE--ALKAYAPKEALELVKKID---FAKFDAT
RL1_LACPL       --MAKK------------SKQYQDAAKLVD--RDKAYDVTEAVDLVKKMD---FAKFDAT
RL1_LACS1       --MAKK-----------KSKKYLEAAKQVE--EGKLYNASEAFGLVKKID---FANFDAT
RL1_OENOB       --MVKK-----------HSKKYLAAAEKID--HSKKYSLADAATLVKDIS---FTNFDSN
RL1_LACP3       --MAKK------------GKKYLEAAKAVD--PTKQYTPEEAVDLLKKID---FAKFDET
RL1_LACSS       --MAKK------------GKNYLEAAKQVD--ATKAYTVEEAIDLVKKVD---FAKFDAS
RL1_LACDB       --MPKH------------GKKYVEAAKKVD--SNKLYSVEDAIKLVKETS---YANFDAS
RL1_LACAC       --MPKH------------GKKYLDAAKKVD--SNKLYSVAEAMKLVKETS---YANFDAT
RL1_LACJO       --MAKH------------GKRYLEAAKKVD--STKFYSVDEAMKLAKETS---YANFDAT
RL1_BACV8       ---MGK-----------LTKNQKLAAEKI--EAGKAYSLKEAAQLVKDITF---SKFDAS
RL1_PARD8       ---MSK-----------LTKNQKLALGKI--EAGKAYTLKEASALVKEITT---TKFDAS
RL1_PORGI       ---MSK-----------LTKKQKLAFSKI--EPGKAYTISEASALVKEITT---TNFDAS
RL1_FLAPJ       ---MAK-----------LTKKQKEAVSKI--EKNKLYSLKDASVLIKQIAS---AKFDES
RL1_GRAFK       ---MAK-----------LTKKQKEAQSKI--ENGKTYTVAEASALIKEVSN---ANFDAS
RL1_CYTH3       ---MAK-----------LTKKQKDALSKF--DVNNSYSLSDASALIKEITY---TKFDAS
RL1_CHLPD       -----M-----------AGKKYRDAVAKT--DRFQEYDLVDAVEKIREITQ---VKFDAT
RL1_PELLD       -----M-----------AGKNYRAAAAQV--DRNMEYDLVDAVAKVKEITN---VKFDAT
RL1_CHLCH       -----M-----------AGKKYREAATKI--ERFRDYELAEAIEKVKEVTT---TKFDAT
RL1_CHLTE       ---MSM-----------AGKNYRNASAKV--NRAQEYELAEAIEKVKEITT---TKFDAT
RL1_ANADE       ---MAH-----------VAKKYKAAAEKV--DRAKRYKLDEAMSLVKQTA---TKKFDET
RL1_MYXXD       ---MAK-----------TGKKFRAAAALV--DRDKRYAVAEGFQLLKKTVEARSTKYDQT
RL1_BARQU       ---MRK-----------VAKRIKDIRKDI--DFNELYALKDAVSMVKERAV---AKFDET
RL1_BARBK       ---MVK-----------IVKRIKKIREGI--NFNELYTLTDAVSMVKERAV---AKFDET
RL1_RHIL3       -----M-----------AGKRTQKINEGV--DPTKLYALTLAIGMVKERAV---AKFDET
RL1_AGRFC       ---MAK-----------VAKRIQKIREGV--DPNKLYVLTDAISMVKERAV---AKFDET
RL1_RHIME       ---MAK-----------IAKRVQKSREGV--DPTKLYGLTEAVTLVKERAT---AKFDET
RL1_BRUME       ---MAK-----------ISKRINKIHEGV--DRNKLYDLSAAIGLVKERAV---AKFDET
RL1_CHESB       ---MAK-----------ISKRVAKGREGI--DRNRFYPLDEAVKVIKERAT---AKFDET
RL1_RHILO       ---MAK-----------IAKRVSKTREGI--DPNKAYALGEALKLLKDRSS---VKFDET
RL1_BRADU       ----MA-----------IGKRLNKAREGV--DREKLYPLAEAIKMVKERAK---AKFDET
RL1_NITWN       ----MA-----------TGKRLKKSREGI--DRNKLYPIADAIRMVKERAT---SKFDET
RL1_RHOPA       ----MA-----------IGKRLKKIREGI--DRTKLYPLDEAVKLVKERAI---SKFDET
RL1_MARMM       ---MAN-----------IGKRLSAARETF--DRDTLYTIDDAVAHVKSNAK---AKFDET
RL1_GRABC       ---MAH-----------N-KRLKAARASV--DSTKFYPLTEAVALAKTNAR---AKFDET
RL1_GLUOX       ---MAK-----------N-KRLTAAQATV--ERNKPYGLSEAVALVKSNAK---AKFDET
RL1_ROSDO       ---MAK-----------LGKRARAAREAF--AGKENVTVEEAVALIKANSS---VKFDET
RL1_RUEST       ---MAK-----------LGKRTRAAREAF--AGKSNLTIEEAVALVKANAT---TKFDET
RL1_JANSC       ---MGK-----------MGKRFAAAKAAV--EGKENITVEEAVALLKGNSK---TKFDET
RL1_RHOS4       ---MAK-----------VGKRTRSAREAF--VGKDLISVEDAVALIKQAAS---AKFDET
RL1_RUEPO       ---MAK-----------LGKRTRAAREAF--AGKEELSVEQAVALIKSAAS---AKFDET
RL1_PARDP       ---MAK-----------LSKKQVSARAAF--AGKSNLAVEEAVKLVKENAS---AKFDET
RL1_MAGSA       ---MAR-----------EGKRLKSAYADI--DRDKFYSLADAVKAIKTRAV---AKFDET
RL1_RHORT       ---MAK-----------VGKRLKAAHEGI--DREAFYDLPQAVHLIRERAT---AKFDES
RL1_HYPNA       ---MAT-----------KGKRARAIEQTV--DKTKAYSVSEAVKLVKSNAK---AKFDES
RL1_CAUVC       ---MAK-----------QPK--RITAWTG--DRDAAHSVEAAIALVKANAK---AKFDET
RL1_NOVAD       ---MAK-----------QTKKQKALVTKLG-DNQKLYAVDEAIALLKDLKS---AKFDES
RL1_SPHAL       ---MAK-----------LTKKQKALEGKV--DAQKLHGVDEAIKLVRELAT---AKFDET
RL1_ERYLH       ---MAK-----------QTKKQQE-VAKL--DPEKLYTVDEAIAVLREHK----AKFDET
RL1_ZYMMO       ---MAK-----------LSKKAKAIAAAV--DKNKLYTVAEAIALVREYAT---SKFDET
RL1_MAGMM       ---MAK-----------ISKRATAHGGKF--DRSVNHPLSDAIKIIKECAT---AKFDET
RL1_GEOSL       ---MPN-----------TAKKHREALAKI--DRSRTYPLVEGIESVKSAAY---AKFDET
RL1_PELPD       ---MSK-----------TAKKLAAASEKI--DRTKVYPVAAAIDVVKQAAY---AKFDET
RL1_PELCD       ----MS-----------IGKLHKQAKEKV--DRSQVYPIGEALALVKEVAH---AKFDET
RL1_DESVH       ---MPK-----------HGKKYRNATEGL--DLTVKYSVEDAVAKSLAAAP---AKFDET
RL1_LAWIP       ---MPK-----------LGKKYRNAVKGV--DLSLHLSFEDAVTQSIQTSF---ANFDET
RL1_DESAG       ---MPK-----------HGKKYRKATDGT--DLAVRFSVEDAVAKSLEASF---AKFDET
RL1_SYNFM       ---MAK-----------HGKKYRAARATI--DPAKRYTFQEALELATGSIF---CKFDET
RL1_SYNAS       ---MSR-----------RGKVYLNARGKV--EAGRRYTLSEALALVTDTAR---AKFDET
RL1_DESPS       ---MPK-----------RGKNYSNKSQSF--DKQQVYTLEEAVGHVLATSY---AKFDET
RL1_BDEBA       -----M-----------AGKKFAAVAKKV--DSAKKYTVEEAFKLVVETAP---AKFDES
RL1_CAMJJ       ---MAK-----------IAKRLKELSQKID--SNKEYALSDAIDTIKTLK---SAKFDET
RL1_CAMFF       --MSKK-----------VTKRFSELLKKVD--SDKIYTLDEAVSTVKTLA---SAKFDET
RL1_NITSB       --MAKK-----------HSKRYQQLLEKIE--KGKIYSIDEAVKKVKELK---SAKFDET
RL1_SULNB       --MAKK-----------LSKRREALLKKVD--ATKEYSVDEAMATLKELK---SAKFDET
RL1_SULDN       -----------------MSKRYKQLTEKID--VTKAYSVDEASLLVKNLV---SAKFDET
RL1_HELAH       --MAKK-----------VFKRLEKLFSKIQ--NDKVYGVEQGVGAVKSLA---SAKFDET
RL1_HELHP       --MGKK-----------IAKRLQTLQAKVE--PQKVYSIQSGVSAVKSLA---SAKFDET
RL1_WOLSU       --MSKK-----------ITKRMQALLDKVD--TQKVYDITTASVSVKSLA---SAKFDET
RL1_ACISJ       ---MAK-----------LTKKQKALQGKVD--STKLYAFAEAVALVKEAAT---AKFDES
RL1_VEREI       ---MPQ-----------LTKKQKAMQGKVD--STRLYAFTDALVLVKQAAT---AKFDES
RL1_RHOFT       ---MTQ-----------LTKKQKSFQGKVD--SNKLYPLADALGLVKECAT---AKFDES
RL1_POLSJ       ---MSK-----------LTKRQKTIGDKID--SNKLYALSDAIGLVKEFAV---AKFDES
RL1_METPP       ---MAK-----------LTKRQKALEGKVD--SLKLYAIDDAFKIVRDCAT---AKFDES
RL1_AZOSB       ---MAK-----------ISKRVQALRAKVD--RNRIYPVAEALALVKECAT---AKFDES
RL1_AROAE       ---MTK-----------LSKRVQALRTKVD--RNRTYPVTEALALVKECAT---AKFDES
RL1_PARXL       ---MAK-----------LSKRLQAFAAKVD--RQKLYAIDEALSLVKECAS---AKFDES
RL1_RALSO       ---MAK-----------ISKRVAANKAKVE--RTKFYPIDEALSLVKECAS---AKFDES
RL1_HERAR       ---MAK-----------LSKRVKAFKAKVD--RTKAYPFDNALALIKECAS---AKFNES
RL1_BORA1       ---MAK-----------LSKRAAAIAQKID--RTKLYPVAEALTLVKETAT---AKFDES
RL1_DECAR       ---MAK-----------LTKKQKALASKVV--AQKLYPLQEALTLAKETAI---AKFDES
RL1_NEIG1       ---MAK-----------VSKRLKVLRSSVE--ANKLYAIDEAIALVKKAAT---AKFDES
RL1_CHRVO       ---MAK-----------ISKRLQNLKATVD--RNKLYAVDEAIALVKAAAT---AKFDES
RL1_METFK       ---MAN-----------VSKRIKALRAKVD--RNKVYPVTEALALVKETAT---AKFDES
RL1_THIDA       ---MAN-----------VSKRLRALKEKID--RSRNYPVVDALQLVKDSAT---AKFDES
RL1_NITEC       ---MAK-----------SSRRYKEIAQKID--RDRLYPLTDALALVKEVAT---AKFDES
RL1_NITEU       ---MAK-----------TSKRYREIVQKID--RSQLYSLVDALALVKETAV---AKFDES
RL1_NITMU       ---MAR-----------LSKRLKAISEKVD--RTKYYPLQDALNLVRETAI---AKFDES
RL1_ACIAD       ---MAK-----------LTKRQKAIAAAIE--ANKVYTLEEAVQVLNNLPA---AKFKES
RL1_PSYA2       ---MSK-----------LTKRQKEINSRIE--HEKQYTIEEAVQILNDLPP---LKFKES
RL1_HAHCH       ---MAK-----------LTKRQKAIREKVQ--AGKAYSVEEAVALLTELSAP--VKFKES
RL1_MARHV       ---MAK-----------LSKRQKLIREKVD--STRAYSVDEAVALLAELGQN--VKFKES
RL1_PSEAE       ---MAK-----------LTKRQKAIAEKVV--AGKQYSFEEAAKLLAELST---IKFKES
RL1_PSEU5       ---MAK-----------LTKRQKAIAEKIE--SGKQYAFEDAAKLLAEVSA---VKFTES
RL1_PSEF5       ---MAK-----------LTKRQKAIAGKIE--AGKAYNFVEAAALLTELST---VKFSES
RL1_ALCBS       ---MAK-----------LSKRNRAIREKIE--AGKLYPVEEAVALLAELSA---VKFKES
RL1_CHRSD       ---MAK-----------LTKRAQMLREKVD--TSKVYNLEDAVALLSEVST---VKFKES
RL1_MANSM       ---MAK-----------LTKRMKAIKAGVD--STKAYEINEAIAVLKQFAT---AKFDES
RL1_HAES1       ---MAK-----------LTKRMKAIKAGVD--STKQYEINEAITVLKQFTS---TKFVES
RL1_PASMU       ---MAK-----------LTKKMKSIKAAVD--STKAYEINEAIAVLKQFAT---AKFVES
RL1_AERS4       ---MAK-----------LSKRMRVIREKVD--GTKEYSINEAIALLKELAT---AKFVES
RL1_VIBCH       ---MAK-----------LTKRMRTIRAKVD--VTKEYDINEAVALLKELAT---AKFVES
RL1_ECOLI       ---MAK-----------LTKRMRVIREKVD--ATKQYDINEAIALLKELAT---AKFVES
RL1_PSEHT       ---MAK-----------LTKRMRTIREKVE--VTKDYEINEAIALLKELAT---AKFVES
RL1_SHEAM       ---MAK-----------LTKRMRVIREKVD--ATKAYDINEAITLLKELAT---AKFVES
RL1_SHELP       ---MAK-----------LTKRARLIREKVE--ATKSYDINEAVALLKELAT---AKFVES
RL1_SHEFN       ---MAK-----------LTKRARVIREKVD--ATKLYDINEAVVLLQELAT---AKFVES
RL1_PHOPR       ---MAK-----------ITKRMRVIRDKVD--ATKSYDINEAVVLLKELAT---AKFVES
RL1_PSEA6       ---MAK-----------LTKRARLVRDKVE--ATKEYDFNEAVALLKELAT---AKFAES
RL1_IDILO       ---MAK-----------LTKRARMIAEKVE--A-RDYDVNEAITLLKELAT---AKFTES
RL1_COLP3       ---MAK-----------LSKRARLIREKVD--VTKEYDINEAVSLLKEFAT---ANFRES
RL1_PSYIN       ---MAK-----------LSKRMKLVRDSVD--ASKEYEINEAVVLLQKLAT---AKFTES
RL1_METCA       ---MAR-----------LTKRLKSIKDKVQ--PGKVYAIDDAFEVLKSVSS---VKFVES
RL1_ALKEH       ---MAR-----------LTKRQKAIREKID--PAQQYPVAEALGLLRELPG---AKFTES
RL1_NITOC       ---MAK-----------LGKRLVGIREKLE--PGKLYPVEEALNLLKEVAK---VKFEES
RL1_FRATW       ---MAK-----------VSKRMKEISAKIN--AEKKYPVSEAFDLLREVSS---VKFVES
RL1_SACD2       ---MAK-----------LSKRQKLINEKVD--STKAYSIEEAVALLQELSK---VKFSET
RL1_HYDCU       -MGMAK-----------LTKKQKMFAEKVD--SLKSYDALEGFSLVSELAT---AKFSES
RL1_DICNV       ---MAK-----------KTKRALAIREKLE--AGKVYTALEALQLLKEMPA---AKFVES
RL1_LEGPH       ---MSK-----------LTKKQKKIAEVIK--PNQLYTVADAVAILKQFAS---KKFRES
RL1_XANC8       ---MAQ------------SKRVKAIAAAVV--PGKTYAFEDAIKILKTSTK---AKFVES
RL1_XYLFT       ---MVQ------------TKRQKAIDIAVV--PGKAYGIDEAIKILKTATK---AKFIES
RL1_HALHL       ---MAK-----------LTKRQKQIRERVD--GNHAYPVDEALALVKELAT---ARFPES
RL1_COXBU       --MAAK-----------LTKKRKTLAEKVQ--RDKTYPLSEAIKLIKECAK---AKFNES
RL1_RUTMC       ---MAE-----------LTKKQKDILVKVE--SNKCYSINDALNLLKECAT---AKFDES
RL1_VESOH       ---MAK-----------LTKNQKYISTKVE--HNKYYSINDALNLLKICAI---AKFDES
RL1_RICTY       ---MSN-KDIFVKISG--SKKIREAREKVK--SDTLYNLTSAVERLKSASY---VKFDPT
RL1_RICBR       ---MSNNKDVAIKSSG--GKKIREARIKVR--SDSLYNLTTAVEKLKSASY---VKFDPT
RL1_ORITB       ---MLNINNKIAKGGYVYSKNIRLAKSKID--KQKCYDVREACSIIKEISF---AKFNET
RL1_PELUB       ---MPS-------------KRFKQLPEKTK--DLTADVIENLLATVKKNCT---TKFDES
RL1_ANAMM       --------------------------MSGD--GSCSYSAEEGIRELLQSAK---AKFRES
RL1_ANAPZ       ---------------------------MLD--KNIVYTPEEGIDQLLKSTT---ARFKES
RL1_EHRCR       -------------------------MNSLI--SNEVYDVESGLRKVIESAK---ANFCES
RL1_EHRRW       -------------------------MSLLA--NDEVYDIVSGFKKVIESAK---ANFCES
RL1_WOLPM       -----------------------------M--NTYNDNPKQCLKKIVESAS---AKFNES
RL1_WOLTR       -----------------------------M--NIHSDSPRQCLEEIIKSAS---AKFNES
                                                                            

RL1_BUCAI       IDIAINLGINSKKSDQNIRSSTVLPNGIGRSIRVAVFTQGD-NIAIAKDAGAELIGM-ED
RL1_BUCAP       IDVAINLGINPKKSDQNIRGSTILPHGTGRCVKVAVFTQGE-NIKIAKKAGAEFIGM-ED
RL1_BUCBP       LDVAINLGINPKNTNQNIRNTTILPHGIGRLIKVAVFTQGE-NEKIAKKFGAEFVGL-HN
RL1_BAUCH       LDVAVKLGINARKSSQNIHSATILPHGIGRSIKVAVFAQGI-NVSIAETAGADLVGM-DN
RL1_BLOFL       VDVAVNLGINPRRSDQNVRNSVVMPHGLGKKIRIAVFTQGESNVVLARRAGADFAGL-ED
RL1_BLOPB       VDTAINLGIDARKSDQNIRNNVILPHGIGRDIHVAVFTQGD-NIVLAKNAGADLVGL-ED
RL1_BUCCC       IDAAFNLNIDPKKSEQNVRGSVLLPHGTGNTIKIAVFTTGK-NIKIAQLAGADYVGL-ED
RL1_WIGBR       IDVAINLRINTKKSDQNIRGSIILPNSIKKEKYIVVFASGE-DKKNAYEAGANLAGM-EE
RL1_DEHMC       VEMHLKMGLDPKNATQQLRGVAVLPHGLGKTVRVLVFAQGEA-EKAAQVAGADVYGG-DE
RL1_RHOBA       VEVHMRLGVDPNQADQIIRGSLVLPHGIGKTQRVIVFAKGDA-AKAAEEAGADEVGQ-ED
RL1_TREDE       VEVHVSLTLG---KGQSVRDTLVLPHQFRGEKKVLVFCTDDR-VKEALDAGAAYAGS-TE
RL1_TREPA       VEVHVSLRLK---KNQTVRDTVVLPHRFRAEVRVLVFCKEDR-VSEALAAGAAYAGG-AE
RL1_BORBU       IDISINLNLK---KNHTVRDTIVLPNQFMKPKRILVFAKGDR-ADEARAFGATYVGD-DD
RL1_LEPIC       LEIATKVNYK---SLQNIRGTISLPHGTGKKIRVLVFCKGDK-QNDAKAAGADFVGD-TD
RL1_CHLFF       VDVSIKLGIDPKKSDQQIRGSVSLPNGTGKTLRILVFAAGEK-AKEALDAGADFVGS-DD
RL1_CHLPN       VDVSIKLGIDPKKSDQQIRGAVFLPNGTGKTLRILVFASGNK-VKEAVEAGADFMGS-DD
RL1_CHLMU       VDVSVKLGIDPRKSDQQIRGSVSLPHGTGKVLRILVFAAGDK-AAEAIEAGADFVGS-DD
RL1_PARUW       VEVSLKLGVDPRRSDQSVRGTVSLPNGTGKTMKILVFAKGDK-VKEALEAGADYAGH-DE
RL1_DEIGD       VEVHFRLGIDPRKSDQNVRGTVALPHGTGKTVRVAVITKGDN-VAAAEAAGADVVGG-ED
RL1_DEIRA       VEVHFRLGIDPRKSDQNVRGTVALPHGTGRSVRVAVITKGEN-VQAAEAAGADVVGS-DE
RL1_THET8       VEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEK-IKEAEEAGADYVGG-EE
RL1_PROMP       IEAHIRLGIDPKYTDQQLRTTVALPNGTGQSIKIAVITSGEN-VAKAKSAGADLFGE-ED
RL1_PROMT       IEAHIRLGIDPKYTDQQLRTTVALPSGTGQKIRIAVVTRGEK-VNEATKAGADLAGE-ED
RL1_SYNS3       MEAHVRLGIDPKYTDQQLRTTVALPQGTGQTVRIAVITRGEK-VAEAKAAGAELSGD-ED
RL1_SYNS9       MEAHVRLGIDPKYTDQQLRTTVALPNGTGQTVRIAVVTSGEK-VAAAKAAGAELAGD-ED
RL1_SYNPW       VEAHARLGIDPKYTDQQLRTTVALPHGTGQTVRIAVITRGEK-VAEAKAAGAELAGD-ED
RL1_PROMM       IEAHVRLGIDPKYTDQQLRTTVALPQGTGQSVRIAVISRGEK-LAEAKTAGAELAGD-DD
RL1_PROMA       IEAHIRLGIDPKYTDQQIRTTVSLPKGTGQKVRIAVIAKGEK-VAEANSAGADLAGE-EE
RL1_SYNR3       IEAHVRLGIDPKYTDQQLRTTVALPKGTGRSIRIAVITRGEK-VAEAKAAGAELVGD-EE
RL1_TRIV2       AEAHIRLGIDPKYTDQQLRTTVALPKGTGQIVRVAVIARGEK-VTEASNAGADVFGS-EE
RL1_THEEB       AEAHIRLGIDPKYTDQQLRTTVALPKGTGQTIRVAVIARGEK-VTEASAAGADVVGS-EE
RL1_SYNP6       AEAHIRLGIDPKYTDQQLRTTVALPKGTGQTIRVAVIARGEK-VAEAKAAGADIAGS-EE
RL1_TRIEI       AEAHVRLGIDPKYTDQQLRTTVALPKGTGQTIRIAVIAKGEK-VNEALAAGADLAGS-EE
RL1_SYNJA       AEVHIRLGIDPKYADQQLRTTVVLPRGTGQEIRVAVIARGEK-VTEAQNAGADRVGF-ED
RK1_CYAPA       VEVHCRLGIDPKYNDQQLRATVTLPNGTGQTLRVAVITRGEK-INEASTAGADLVGA-EE
RL1_SYNY3       AEAHIRLGIDPKYSDQQIRTTVSLPKGTGQTVRVAVLARGEK-VKEATDAGADIAGS-EE
RL1_GLOVI       AETHIRLGINPKYADQQVRSTVVLPRGTGKAIRIAVLAKGEK-VREAEKAGADIAGS-EE
RK1_RHDSA       AEAHISLKIDTKYADQQLRTTLVLPKGTGKKVRIAVVAQGEK-INEALAAGADLAGA-ED
RK1_GUITH       AEAHIALKLDTKYADQQLRTTLVLPKGTGKKIRIAVIAEGEK-ATEAINAGADLAGS-TD
RK1_PORPU       AEAHISLGLNPKYADQQLRATVILPKGTGKLVKVAVIAKGEK-LTEAMNAGADISGS-EE
RK1_PYRYE       AEAHIALGLNPKYADQQLRATVILPKGTGKLIKVAVIAKGEK-LTEAISAGADVSGS-EE
RK1_GRATL       AEVHIVLGLDPKYADQQLRTTVMLPKGTGKIMRVAVITQNNK-THEAKSSGADIVGG-ED
RK1_CYAM1       AEAHIRLNLDPKYTDQQIRATVVLPHGTGKAIRIAVITKQSS-----HIEGADLVGS-DD
RK1_CYACA       FEVHCCLDLNTKYSDQQLRASVVLPKGTGKRTKIAVITNEAE-VNKIKNFGVDIVGS-KD
RK1_TRICV       VELHANLNIDPKYADQQLRTTVTLPHGIGKTINIAVLTNDSN-FTEAREAGADRVGS-DD
RK1_THAPS       VELHANLNIDTKYADQQLRTTVTLPHGIGKSMRIAVLTNEAN-FNEANEGGADIVGS-QE
RK1_PHATC       VELHANLNIDPKYADQQLRTTVTLPNGIGKQVVIAVLTNEEN-FEEAKSSGGDIVGN-DE
RL1_KORVE       VDLTLRLGVDPKHADQMVRGTVVLPHGLGKTKIVLVIASGEK-QREAEAAGADFVGG-ED
RL1_SOLUE       VEVHMRLGVDPKHADQMVRGTVLMPNGLGKSKKVLVIASGDK-QREATEAGADFVGG-ED
RL1_AQUAE       VELAMRLNVDPRYADQMVRGSVVLPHGLGKPIKVVVFAEGEY-AKKAEEAGADYVGG-DE
RL1_RUBXD       VEAHVHLNVDPRRADQMVRGTLMLPNGTGKTRRVAVFAVGEK-AREAEEAGADIVGS-EE
RL1_SALRD       IDLDLRLGVDPQHADQMVRGSITLPNGTGREVTVLVLASEGK-QQEAEEAGADYVGL-DE
RL1_CLOBL       VELAVRLGVDPRHADQQVRGAVVLPHGTGKTVRVLVFAKGDK-VNEAQEAGADFVGA-EE
RL1_CLONN       IELSIRLGVDPRHADQQVRGAVVLPHGTGKKVRVLVFAKGDK-AKEAEAAGADYVGA-EE
RL1_CLOAB       VELAVRLGVDPRHADQQVRGVVILPNGTGKKVRVLVFAKGDK-AKEAEAAGADYVGA-EE
RL1_CLOPS       IELHVRLGVDPRHADQQVRGAVVLPHGTGKDVKVLVFAKGEK-AKEAEAAGADFVGA-DE
RL1_CLOTE       IDLAVRLGVDPRHADQQVRGAIILPHGTGKKVKVLVFAKGEK-AKEAEAAGADFVGA-EE
RL1_HUNT2       VEAHIRLGVDSRHADQQVRGAVVLPHGTGKKVRVLVFAKGEK-ATEAEKAGADYVGA-EE
RL1_CLOD6       VEAHIKLGVDSRHADQQVRGAVVLPHGTGKTKRVLVFAKGEK-AKEAEQAGADFVGA-EE
RL1_CALS4       IDLAVRLGVDPRHADQQVRGTVILPHGTGKTVKVLVFAKGEK-AKEAEAAGADYVGA-EE
RL1_CALS8       VEVHVRLNVDPRHADQQVRGTVVLPNGTGKNVRVLVFAKGDK-AKEAEEAGADYVGA-EE
RL1_DESHY       VEVAFKLGIDTRHADQQIRGALVLPHGTGKTRSVLVFAKGDK-AKEAEAAGADFVGA-ED
RL1_CARHZ       VEVAVKLGVDPRHADQQVRGAVVLPHGTGKTRKVLVFAKGEK-AKEAEAAGADYVGA-EE
RL1_SYNWW       VEVHIKLGVDPRHADQQVRGTVSLPNGTGKTRKVLVFAKGEK-IKEAELAGADYVGG-ED
RL1_MOOTA       VEVAVKLGVDPRHADQQVRGTVVLPNGTGKTRRVLVFAKGDK-AKEAEEAGADFVGA-ED
RL1_SYMTH       IEVAYRLGVDVRHADQQIRGAVVLPGGTGKEVKVLVFAKGEK-AKEAEAAGADYVGA-ED
RL1_THEMA       IELHIQTGIDYRKPEQHIRGTIVLPHGTGKEVKVLVFAKGEK-AKEALEAGADYVGA-ED
RL1_FUSNN       VEVALRLGVDPRHADQQIRGTVVLPHGTGKTVKILAITSGEN-IEKALAAGADYAGA-EE
RL1_ACIC1       VEVAMRLGVDPRKADQMVRGTVNLPHGTGKTPRVLVFATAER-AEEARAAGADYVGA-DE
RL1_THEFY       VEVAMRLGVDPRKADQMVRGTVNLPHGTGKTARVLVFAAGER-AEQARAAGADYVGD-DD
RL1_MYCUA       VEVAIRLGVDPRKADQMVRGTVNLPHGTGKTARVAVFAVGEK-ADAAVAAGADIVGS-DD
RL1_MYCLE       VEVAIRLGVDSRKADQMVRGTVNLPHGTGKTARVAVFAVGEK-ADVAVAAGADVVGS-DD
RL1_MYCSS       VEVAIRLGVDPRKADQMVRGTVNLPHGTGKTARVAVFAVGDK-AEQAAAAGADIVGS-DD
RL1_NOCFA       VEVAVRLGVDPRKADQMVRGTVNLPHGTGKTARVIVFAAGEK-AAEAEAAGADAVGA-ED
RL1_SACEN       VEVAMRLGVDPRKADQMVRGTVNLPHGTGKTARVIVFAVGDK-AAEAEAAGADAVGS-ED
RL1_FRACC       VEVAIRLGVDPRKADQMVRGTVNLPHGTGKSPRVAVFAAGEK-AAEASAAGADIVGS-DD
RL1_NOCSJ       VDVVMRLGVDPRKADQMVRGTVNLPHGTGKTARVLVFANADK-AEAAREAGADVVGG-DE
RL1_CUTAK       VDVAIRLGVDPKKADQMVRGTVNLPHGTGKTTRVLVFATGEK-AEAAREAGADEVGD-DD
RL1_ARTS2       VEVAFRLGVDPRKADQMVRGTVNLPHGTGKVARVLVFATGDK-AEAAIAAGADFVGS-DD
RL1_STRCO       VEVAFRLGVDPRKADQMVRGTVNLPHGTGKTARVLVFATGDR-AEAATAAGADIVGS-DE
RL1_CLAM3       VEVALKLGVDPRKADQMVRGTVILPHGTGKTARVIVFATGPA-AEAAIAAGADEVGG-DE
RL1_LEIXX       VEVALKLGVDPRKADQMVRGTVILPHGTGKTARVIVFATGPA-AEAAIAAGADEVGG-SD
RL1_BIFAA       VEAVLRLNVDPRKADQLVRGSVNLPNGTGKTAKVLVFARGPK-ATEALEAGADIVGD-DD
RL1_BIFLO       VEAVFRLSVDPRKADQLVRGTVNLPHGTGKTAKVLVFARGPK-ATEATEAGADIVGD-DD
RL1_CORGL       IDVAIRLGVDPRKADQLVRGTVSLPNGTGKTVRVAVFAQGEK-ATEAEAAGADFVGT-DE
RL1_COREF       VDVAIRLGVDPRKADQLVRGTVSLPNGTGKTVRVAVFAAGEK-ATEAEAAGADFVGT-DE
RL1_CORDI       VDVAIRLGVDPRKADQLVRGTVSLPNGTGKSVRVAVFAEGEK-ATEAQAAGADIVGT-TE
RL1_CORJK       VDVAIRLGVDPRKADQLVRGTVSLPNGTGKEVRVVVFAEGPN-ATAAEEAGADVVGT-AE
RL1_TROWT       FEVALKLGIDPRKTDQLVRGVVMLPHGTGKAVRVVVFATGPS-AQAALDSGASEVGG-SD
RL1_MYCMS       VEVAFNLNIDPRKADQQIRGAVVLPAGTGKTQRVLVLTNTK--TKEAEQAKADIVGGEEL
RL1_MESFL       VELSFNLNIDPRKADQQIRGALVLPAGTGKTQKVLVLTNTK--VKEAQDAGADFVGGEEL
RL1_MYCGE       VDIAVSLNLDTTKAEQQLRGAIAFPFSIGKSIRILAITDD---EKKASEAGADFVGG-LD
RL1_MYCPN       VDIAVSLNLDTTKAEQQLRGAIAFPHSVGKPIRILAITDD---EKAALEAGADFVGG-ID
RL1_MYCGA       IDIAIKLNLDTTKADQQLRGAISLPHNVSKPIRILAITDQ---QAEAKQAGADFVGE-ID
RL1_UREPA       INIAIKLNLDTTKVEQQLRGSISLPNGNGKNVRVLVLSEDIT-KEEAASVGADYFGG-AD
RL1_MYCHJ       VDLAIRLNLDTRKADQQLRGAVVLPHGTGKSVRVLVATDSSEVAAKSLEAGADLIYSTAE
RL1_MYCPU       IDLAFRLNLDTRKADQQLRGSILLPHGNGKVTRVLVATDSPELQKSSKEAGADFVVDKLE
RL1_MYCS5       VDLAFKLNLDVRKADQQLRGSVLLPKGTGKDVKVLVVTNNPEKQKLATEAKADFVLDAAA
RL1_MYCMO       IDISLKLNLDTRKADQQLRGSVSLPNGTGKIIRVLATSDEKEQLDLAKKAGANIVANKSD
RL1_ONYPE       VECAFHLNLDPKKVDQNLRGALVLPHGTGKVLKVAVLAKGEQ-AKQAQEAQADYVGD-QD
RL1_BACCR       VEAAFRLGVDPKKADQQIRGAVVLPHGTGKVQRVLVFAKGEK-AKEAEAAGADFVGD-TD
RL1_BACSU       VEVAFRLGVDPRKNDQQIRGAVVLPNGTGKTQRVLVFAKGEK-AKEAEAAGADFVGD-TD
RL1_GEOKA       VEVAFRLGVDPKKADQQIRGAVVLPHGTGKVARVLVFAKGEK-AKEAEAAGADYVGD-AE
RL1_BACSK       VEVAVRLGVDPKKADQQIRGAVVLPHGTGKTQRVLVFAKGEK-AKEAEAAGADYVGE-DD
RL1_BACHD       VEVAVRLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGEK-AKEAEAAGADYVGD-ED
RL1_OCEIH       VEAAFRLGVDPKKADQQIRGAFVLPHGTGKTQRVLVFAKGEK-AKEAEAAGADYVGE-GD
RL1_LISMO       VEVAFRLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGEK-AKEAEAAGADYVGE-SE
RL1_ENTFA       VEVAYKLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGEK-AKEAEAAGADFVGD-DD
RL1_STAEQ       VEVAFRLGIDTRKNDQQIRGAVVLPHGTGKSQRVLVFAKGDK-ITEAEEAGADYVGE-AD
RL1_STAS1       VEVAFRLGIDTRKNDQQIRGAVVLPNGTGKSQRVLVFAKGDK-AAEAEAAGADFVGE-GE
RL1_STRMU       VEVAYNLNIDVKKADQQIRGAMVLPNGTGKTQRVLVFARGAK-AEEAKEAGADFVGE-DD
RL1_STRS2       VEVAYNLNIDVRKADQQIRGAMVLPNGTGKTSRVLVFARGAK-AEEAKAAGADFVGE-DD
RL1_LACLA       VEVAYNLNIDVKKSDQQIRGAMVLPNGTGKTARVLVFAKGAK-AEEATAAGADFVGS-DE
RL1_LACBA       VEVAFKLNVDTKQADQQLRGALVLPNGTGKETTVIVFAKGDQ-AKAAEAAGADVVGE-QD
RL1_LEUMM       VEVVFKLNVDTRQADQQLRGAVVLPNGTGKDKTVVVFAQGDK-AKEAEAAGADVVGA-AD
RL1_PEDPA       VETVYKLNVDTKQADQQLRGAVVLPNGTGKEQTVIVFAKGAK-AEAAKAAGADVVGD-DD
RL1_LACPL       VEVAFKLNVDTKQADQQLRGAVVLPNGTGKDQTVIVFAKGDK-AKEAEEAGADFVGE-TD
RL1_LACS1       IEVAFNLNVDTKQADQQLRGAMVLPNGTGKDQTVVVFAKGAK-AQEAKDAGADVVGD-DD
RL1_OENOB       VEVVFDLNVDTTKADQQLRGAIVLPNGSGNPKTVVVFADGEK-AKDATQAGADFVGT-DD
RL1_LACP3       VEVAYRLNVDPKQADQQIRGAVVLPNGTGKTAKVIVFAQGDQ-AKAAEDAGADIVGA-ED
RL1_LACSS       LEVAYRLNVDPKQADQQIRGAVVLPNGTGKTQRVIVFAQGEQ-AKQAEAAGADVVGA-ED
RL1_LACDB       VEVSYNLSVDPKQADQQIRGSIVLPNGTGKSVKVIVFAEGPQ-AEAAKAAGADEVGA-DD
RL1_LACAC       IDVAYNLSVDPKQADQQIRGSIVLPNGTGKTQTVVVFAEGPQ-AEQAKAAGADFVGS-DD
RL1_LACJO       IEVAYNLNVDPKQADQQIRGALVLPNGTGKSKKVVVFAEGPQ-ADQAKEAGADEVGS-DD
RL1_BACV8       LDIDVRLGVDPRKANQMVRGVVSLPHGTGKQVRVLVLCTPDA-EAAAKEAGADYVGL-DE
RL1_PARD8       VDVDVRLGVDPRKANQMVRGVVSLPHGTGKQVRVLALCTPDK-EAEATAAGADYVGL-DE
RL1_PORGI       VDIDVRLGVDPRKANQMVRGVVTLPHGTGKQIRVLALCSPDK-EAEAKEAGADYVGL-DE
RL1_FLAPJ       VDIAVKLGVDPRKANQMVRGVVALPHGTGKNMRVLALVTPDK-EAEAKEAGADFVGL-DD
RL1_GRAFK       VDLAVRLNVDPRKANQMVRGVVTLPHGTGKDVKVLALVTPDK-EEEAKEAGADYVGL-DE
RL1_CYTH3       VDIDVRLGVDPKKADQMVRGIVTLPHGTGKDVRVLVLCTPDK-AQDAKDAGADHVGL-DD
RL1_CHLPD       IDIAMKLGVDPRHADQVVRGTVMLPHGTGKTVSVLVVCKEAK-AEEAVAAGADFVGF-EE
RL1_PELLD       VDVAVKLGVDPRHADQVVRGTVMLPHGTGKTVSVLVVCKEAK-AAEATEAGADLVGF-EE
RL1_CHLCH       VDVAVKLGVDPRHADQVVRGTVMLPHGTGKTVSVLVICKETK-AEEAKEAGADFVGF-EE
RL1_CHLTE       VDVAIKLGVDPRHADQVVRGTVMLPYGTGKTVSVLVVCKENK-AEEAREAGADFVGF-ED
RL1_ANADE       VDASINLGVDPKHADQVVRGAVVLPHGMGKTVRLAVFAKGDK-AKEAQEAGADIVGA-ED
RL1_MYXXD       VDVSINLGVDPKHADQMVRGAVVLPHGTGATVRVAVFAKGEK-ATDATNAGADVVGA-ED
RL1_BARQU       IEISMNLGVDPRHADQMVRGVAHLPNGTGRNVRVAVFARGEK-AEEAKASGADIVGA-ED
RL1_BARBK       IEISMNLGVDPRHADQMVRGVAHLPNGTGKNIRVAVFARGDK-AEEAKAAGADIVGA-ED
RL1_RHIL3       IEVSMNLGVDPRHADQMVRGVVNLPNGTGRTVRVAVFARGAK-ADEAKAAGADIVGA-ED
RL1_AGRFC       VEVSMNLGVDPRHADQMVRGVVNLPNGTGRDVRVAVFARGVK-ADEATAAGADVVGA-EE
RL1_RHIME       IEVAMNLGVDPRHADQMVRGVVNLPNGTGRSVRVAVFARGAK-ADEAKAAGADVVGA-EE
RL1_BRUME       VEIAMNLGVDPRHADQMVRGVVNLPNGTGRTVRVAVFARGDK-AEEAKKAGADIVGA-EE
RL1_CHESB       IEVAMNLGVDPRHADQMVRGVVNLPNGTGRSVRVAVFAKGDK-ADEAKAAGADIVGA-ED
RL1_RHILO       VEVAMNLGVDPRHADQMVRGVVNLPNGTGRSVRVAVFARGDK-AEEAKAAGADIVGA-ED
RL1_BRADU       IEVAINLGVDPRHADQMVRGVVTLPNGTGRTLRVGVFARGAK-ADEAKAAGADVVGA-ED
RL1_NITWN       IEIAMNLGVDPRHADQMVRGVVTLPNGTGRTLRVGVFARGAK-AEEAKAAGADVVGA-ED
RL1_RHOPA       IEVAINLGVDPRHADQMVRGVVMLPNGTGRTVRVGVFARGAK-ADEAKAAGADVVGA-ED
RL1_MARMM       IELAINLGVDPRHADQMVRGVCNLPNGTGRSVRVAVFAKGPK-AEEATKAGADVVGA-ED
RL1_GRABC       IEISLNLGIDPRHADQMVRGLVSLPNGTGKTLRVGVFARGPK-AEEAKAAGADVVGA-ED
RL1_GLUOX       IEISLNLGIDPRHADQMVRGLISLPNGTGKTLRVGVFARGPK-AEEALAAGAEVVGA-ED
RL1_ROSDO       VEIAMNLGVDPRHADQMVRGVVGLPNGTGKTVRVAVFARGAK-ADEATAAGADIVGA-ED
RL1_RUEST       VEIAMNLGVDTRHADQMVRGVVGLPNGTGKTMRVAVFARGPK-ADEAKEAGADIVGA-ED
RL1_JANSC       IEIAMKLGVDPRHADQMVRGTVNLPNGTGKTVRVAVFARGPK-AEEATAAGADIVGA-ED
RL1_RHOS4       LEVAMNLGVDPRHADQMVRGVVTLPNGTGKTVRVAVFARGAK-ADEAKAAGADIVGA-ED
RL1_RUEPO       VEIAMNLGVDPRHADQMVRGVVGLPNGTGKTVRVAVFARGPK-AEEAQAAGADIVGA-ED
RL1_PARDP       VEIAMNLGVDPRHADQMVRGVVTLPNGTGKDVRVAVFARGPK-ADEAKAAGAEIVGA-ED
RL1_MAGSA       IEIALNLGVDPRHADQMVRGVVELPHGTGKTVRVAVFAKGDK-AEEARKAGADIVGE-QD
RL1_RHORT       IEVAMNLGVDPRHADQMVRGVVELPHGTGKTMRVAVFAKGAK-AEEAKAAGADLVGA-DE
RL1_HYPNA       IEIAINLGVDPKYADQQVRSVVNLPAGTGKTIRVAVFAKDKK-AEEALAAGADIVGA-DD
RL1_CAUVC       IEISVNLGVDPRHADQQVRGVVNLPSGTGRDVRVAVFAKDAK-AAEATAAGAEHVGA-DD
RL1_NOVAD       LEVSLNLGVDPRHADQMVRGMVTLPSGTGKDVKVAVFARGDK-AEAALAAGADKVGA-ED
RL1_SPHAL       LEIAMNLGVDPRHADQMVRGVVTLPAGTGKDVKVAVFARGDN-AEKALAAGADKVGA-ED
RL1_ERYLH       VEVAMNLGVDPRHADQMVRGMVSLPSGTGKTVKVAVFAKGDN-AEKATAAGADKVGA-ED
RL1_ZYMMO       IELAVNLGVDPRHADQMVRGVVTLPKGTGKNVRVGVFARGPK-AEEAKAAGAEVVGA-ED
RL1_MAGMM       IEVAVNLGVDPRHADQMVRGSVSLPKGTGKVVRVLVFAKGEK-AEEAKAAGADVVGA-DD
RL1_GEOSL       VEVAVRLGVDPRHADQMVRGAVVLPNGLGKDVRVLVFAKGEK-EKEAREAGADYVGA-ED
RL1_PELPD       VDVAVRLGVDPRHADQMVRGAVVLPNGLGKDVRVLVFAKGEK-EKEALDAGADYVGA-ED
RL1_PELCD       VEISVRLGVDPRKADQMVRGAVVLPNGLGKDVKVLVFAKGEK-AIEAKEAGADYVGG-DD
RL1_DESVH       VDVAICLGVDPKYSDQMVRGAVTMPNGLGKTVRVAVFCKGEK-EAEAKAAGADVAGA-EE
RL1_LAWIP       VDIAIGLGVDPKYSDQMVRGAVTLPYGLGKTVRVAVFCKGEK-EAEAKEAGADYAGA-EE
RL1_DESAG       VDVAICLGVDPKYSDQMVRGAVTLPNGLGKTVRVAVFCKGEK-QAEAREAGADIVGA-ED
RL1_SYNFM       LDIAVRLGVDPRHADQMVRGTVVLPNGLGKPVRVLVFAKGEK-VKEALDAGADHAGG-DE
RL1_SYNAS       VEAAVRLGVNPAHADQMVRGSVVLPNGLGKTVRVLVFAKGEK-EKEALDAGADYAGS-DE
RL1_DESPS       FDIAIKLGVDPRHADQMIRSSVVLPHGTGKVTRVLVFAKGAK-EAEAREAGADFVGG-DD
RL1_BDEBA       IDVALRLGIDPKQSDQQVRGAIALPHGLGKEVKVVVFAKGPK-EAEAKAAGADFVGA-DD
RL1_CAMJJ       VEIALKLNVDPRHADQMVRGSVVLPAGTGKKVRVAVIAKDAK-ADEAKNAGADIVGS-DD
RL1_CAMFF       VEIALKLNVDPRHADQMVRGSVVLPAGTGKTVRVAVIAKDAK-ADEAKAAGADIVGA-ED
RL1_NITSB       VELALRLGVDPRHADQMVRGSVVLPHGTGKTVRVAVFAKGAK-ADEAKECGADIVGA-ED
RL1_SULNB       VEVALNLNVDPRHADQMVRGSVVLPHGTGKTVRVAVFAKDAK-ADEAKAAGADLVGA-AD
RL1_SULDN       VEVAFNLNVDPRHADQMIRGAIVLPHGTGKTVRVAVFAKGAK-ADEAKAAGADIVGT-DD
RL1_HELAH       VEVALRLGVDPRHADQMVRGAVVLPHGTGKKVRVAVFAKDIK-QDEAKNAGADVVGG-DD
RL1_HELHP       VEVALRLGVDPRHADQMIRGAVVLPHGTGKKVRVAVFAKGIK-ADEAKNAGADVVGA-DD
RL1_WOLSU       VEVALKLGVDPRHADQMIRGAVVLPHGTGKKVRVAVFAKGVK-ADEAKAAGADVVGD-DD
RL1_ACISJ       IDVAVQLGVDAKKSDQVVRGAVVLPNGTGKTTRVAVFAQ-GAKAEEAKAAGADIVGM-DD
RL1_VEREI       IDVAVQLGIDAKKSDQVVRGAVVLPNGTGKITRVAVFAQ-GAKAEEAKAAGADVVGM-DD
RL1_RHOFT       IDVAVQLGIDAKKSDQVVRGAVVLPNGTGKTKRVAVFAQ-GAKAEEAKAAGADIVGM-DD
RL1_POLSJ       IDVAVQLGIDAKKSDQVVRGAVVLPNGTGKTKRVAVFAQ-GAKAEEAKAAGADIVGM-DD
RL1_METPP       IDVSVQLGIDAKKSDQVVRGAVVLPNGTGKTKRVAVFAQ-GAKAEEAKAAGADVVGM-ED
RL1_AZOSB       IDVAVNLGVDARKSDQVVRGSVVLPAGTGKTVRVAVFAQ-GDKAEAARAAGADVVGF-DD
RL1_AROAE       IDIAVNLGIDARKSDQLVRGSVVLPAGTGKSVRVAVFAQ-GDKAEAARAAGADVVGF-ED
RL1_PARXL       IDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQ-GEKAEQARAAGAEVVGM-ED
RL1_RALSO       IDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQ-GEKAEQAKAAGAEIVGM-ED
RL1_HERAR       IDVSVQLGVDAKKSDQVVRGSVVLPAGTGKDVRVAVFAT-GEKAEQAKAAGADIVGM-ED
RL1_BORA1       IDVAVQLGIDPKKSDQLVRGSVVLPAGTGKSVRVAVFAQ-GEKAEAARAAGAEVVGL-DD
RL1_DECAR       IDVAVNLGVDARKSDQVVRGSVVLPAGTGKSVRVAVFAQ-GEKAEAAKAAGAEVVGF-DD
RL1_NEIG1       VDVSFNLGVDSRKSDQVIRGSVVLPKGTGKTTRVAVFTQ-GVNAEAAKEAGADVVGF-ED
RL1_CHRVO       IDIAVNLGVDPRKSDQVVRGSVVLPRGTGKSVRVAVFAQ-GANAEAAKAAGAEVVGF-DD
RL1_METFK       VDAVINLGIDARKSDQLVRGALVLPHGTGKTKRVAVFAQ-GAAAEAAKAAGADIVGF-ED
RL1_THIDA       IDVAVNLGVDARKSDQMVRGAVVLPKGIGKTVRVAVFAQ-GDNAQKARDAGADIVGF-DD
RL1_NITEC       VDIAINLGIDVRKSDQVVRGAVVLPSGTGKTVRVAVFAQ-GDKAKEALDAGADIVGL-ED
RL1_NITEU       VDIAINLGIDVRKSDQVVRGSVVLPSGTGKSVRVAVFAQ-GDKAKEALDAGADIVGF-ED
RL1_NITMU       IDVAVNLGIDAKKSDQAVRGSVVLPAGTGKTVRVAVFAQ-GDKAREAAAAGADIVGF-ED
RL1_ACIAD       LDVSVNLGVDPRKSDQVVRGATTLPAGTGKTVRVAVFAQ-GAAAEAAKAEGADIVGF-DD
RL1_PSYA2       IDIAVNLGVDPRKSDQVVRGATNLPAGTGKTKRVAVFAQ-GAAAEAAKEAGADIVGF-ED
RL1_HAHCH       IDVSVNLGVDARKSDQVVRSSTVLPNGTGKTVRVAVFTQ-GANADKAKAAGADIVGM-DD
RL1_MARHV       VDVAVNLGVDARKSDQVVRSSTVLPHGTGKTVRVAVFTQ-GANAEKATAAGADVVGM-DD
RL1_PSEAE       VDVAVNLGVDPRKSDQVVRGATVLPNGTGKSVRVAVFTQ-GPAAEAALAAGADKVGM-DE
RL1_PSEU5       FDIAINLGVDPRKSDQVVRGATVLPNGTGKTVRVAVFTQ-GPGAEAALAAGADRVGM-DD
RL1_PSEF5       VDVAVNLGVDPRKSDQVVRSATVLPHGTGKTVRVAVFTQ-GPAAEAALAAGADRVGM-DD
RL1_ALCBS       VDVAVNLGVDPRKSDQNVRGASVLPHGTGKTVRVAVFAQ-GAKAEEAKEAGADVVGF-DD
RL1_CHRSD       VEVSINLGVDPRKSDQVVRGATVMPNGTGKDARVAVFAQ-GAAADAAKEAGADVVGM-ED
RL1_MANSM       VDVAVNLGIDPRKSDQNVRGATVLPNGTGRSVRVAVFTQ-GANADAAKEAGADLVGM-ED
RL1_HAES1       VDVAVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQ-GANVDAAKAAGADLVGM-ED
RL1_PASMU       VDVAVNLGIDPRKSDQNVRGATVLPHGTGRSVRVAVFTQ-GANAEAAKEAGADLVGM-ED
RL1_AERS4       VDVAVNLGIDARKSDQNVRGATVLPHGTGRDVRVAVFTQ-GANAEAAKAAGAELVGM-DD
RL1_VIBCH       VDVAVNLGIDARKSDQNVRGATVLPHGTGRDIRVAVFTQ-GANAEAAKAAGAELVGM-ED
RL1_ECOLI       VDVAVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQ-GANAEAAKAAGAELVGM-ED
RL1_PSEHT       VDVAVNLGIDARKSDQNVRGATVLPNGTGRDVRVAVFTQ-GANAEAAKEAGAELVGM-ED
RL1_SHEAM       VDVAVNLGVDPRKSDQNVRGAIVLPHGTGRDVRVAVFTQ-GANAEAAKEAGAELVGM-ED
RL1_SHELP       VDVAVNLGVDPRKSDQNVRGATVLPHGTGREVRVAVFTQ-GANADAAKEAGAELVGM-DE
RL1_SHEFN       VDVAVNLGIDPRKSDQNVRGATVLPHGTGRDVRVAVFTQ-GANAEAAIAAGAELVGM-ED
RL1_PHOPR       VDVAINLGIDARKSDQNVRGATVLPHGTGRDIRVAVFTQ-GANAEAAKEAGADLIGM-DD
RL1_PSEA6       VDVAVNLGIDARKSDQNVRGATVLPNGTGKEVRVAVFTQ-GANAEAAKEAGADIVGM-ED
RL1_IDILO       VDVAVNLGIDARKSDQNVRGATVLPNGTGRDVRVAVFTS-GDNAEKAKAAGADIVGM-ED
RL1_COLP3       VDVAVNLGIDARKSDQNVRGATVLPNGTGREVRVAVFTQ-GENAEKAKAAGADIVGM-ED
RL1_PSYIN       IDVSVNLGVDPRRSDQNVRGATVLPHGTGRTVRVAVFTQ-GANAEAAKAAGADIVGM-DD
RL1_METCA       VDVAVNLGVDPRKSDQAVRGATVLPHGTGKSVRVAVFAQ-GANAEAALAAGADIVGM-DD
RL1_ALKEH       VEVAVNLGVDPRKSDQIVRGSTVLPNGTGKTVRVAVFAQ-GDAAEAAKEAGADIVGM-DD
RL1_NITOC       VDVAVNLGVDPRKSDQVVRGSTVLPNGLGKTVRVGVFTQ-GVNAEAAKNAGADVVGL-ED
RL1_FRATW       VDVSVALGVDPRKSDQVVRGASVLPNGTGKTVRVAVFAK-GPAADAAKEAGAEVVGM-ED
RL1_SACD2       VDAAINLGIDPRKSDQAVRGATSLPHGTGKDVRVAVFTQ-GANAEAAKEAGAEFVGM-ED
RL1_HYDCU       IDVAIKLGIDPRKSDQVVRGATVMPNGTGKDVRVAVFTG-DANAAAAKEAGAEFVGM-DD
RL1_DICNV       VDVAINLGVDPRKSDQVVRGAAVLPHGTGKTVRVAVFAQ-NDNADAAKAAGADIVGM-EE
RL1_LEGPH       LDISINLGVDPRKSDQVVRSSTNLPKGTGKTVRVAVFAQ-GDNAAKATAAGADIVGF-ED
RL1_XANC8       IDVAVRLGVDAKKSDQQVRGSTVLPAGTGKSVRVAVFAPAGAKADEALAAGAEAVGM-DD
RL1_XYLFT       VDVAIRLGVDVKKSDQQVRGSTLLPAGTGRDVRVAVFVPSGAKAEDALAAGADAVGM-DD
RL1_HALHL       IDVAVNLGVDPRKSDQIVRGSTVLPNGTGKSMRVAVFAQ-GENADAAQAEGADAVGM-DD
RL1_COXBU       IDVAINLGIDSRKSDQAIRGATVLPHGSGRTVKVAVFAQ-GDNVEKAKAAGADIVGL-DD
RL1_RUTMC       IDMSINLGIDAKKSDQNVRGAIVLPNGTGKTVCVAVFTQ-GDNIAKAQDAGADVVGM-ED
RL1_VESOH       IDVSINLGIDVKKYDQNIRGSVILPNGTGKVVRVAVFTQ-GDNVIKAQDAGADVVGM-ED
RL1_RICTY       LEIVMKLGIDPRHSDQIVRGVVNLPAGTGKIIRVAVICKEER-EEEAKSAGADLVGS-IN
RL1_RICBR       LEIVMKLGIDPRHSDQMVRGVVNLPAGTGKTVRVAVICKEER-EEEAKVAGADLVGS-TN
RL1_ORITB       VDIAIKLGVNPSHSSQVVRGVAAMPSGTGKTVKVAVICQEEK-LDEFKTTGADIVGS-LD
RL1_PELUB       IDLSFQVNNKQKKGEVNIRTVVNLPGGTGKKVKVAVVCEDTK-AKEAKDAGADIVGS-DE
RL1_ANAMM       VDVAIKLSVADSKSGESIRGAVVLPKGLGREVRVAVFAKGEH-AKQASSAGADVVGD-EE
RL1_ANAPZ       VDVAIKLSTGDSRSGDSIRGVAVLPKGLGREVRVAVLAKGEY-AKQAKDAGADVVGD-SD
RL1_EHRCR       VDVAINLNINSSKSDEQVRGCVVLPKGLGREIKVAVFAKGGY-LEMAREAMADIVGD-EE
RL1_EHRRW       VDVAINLNINSSKSDEQVRGAVVLPKGLGREVKVAVFAKGGH-LDAAKEAMADIVGD-EE
RL1_WOLPM       VDIAVNLGVDSRKSEEQVRGTVVLPKGIGKNIKVAVFAQDKH-LLEAEKAGADIAGG-ED
RL1_WOLTR       IDIAVNLGIDSRKSEEQVRGTVVLPKGIGKDIKVAVFTQGKH-LLEAEKAGANIVGG-ED
                 :               ::    :*        : .                        

RL1_BUCAI       LSEKIK-KEG-VDFDVVIATPDAMKIVT-QLGQILGPRNLMPNTKLGTITT--NIAEAIK
RL1_BUCAP       LAEQIK-KEG-IKFHTAIASPDAMKIVT-QLGQILGPRGLMPNPKLGTVTT--NIEEAIK
RL1_BUCBP       LIETVK-TKT-ILFDVAIATPDVMPYVS-QLGPILGPRGLMPNPKLGTITE--KLEYAIK
RL1_BAUCH       LAAQIT-KGN-INFDVVIASPDTMHLVS-TLGQILGPKGMMPNTKTGTITQ--NIALAIK
RL1_BLOFL       LCQLIKTKGC-TGFDVFIASPDVMNIVS-QLGPILGPKGLMPNPKMSTVTQ--NLTDTIR
RL1_BLOPB       LYDQIKNKNY-RP-DVVIASPDVMNVVS-KLGPILGPRGLMPNLKMGTVSH--DIAESVK
RL1_BUCCC       LANLITNQKK--KIDLVIASPETMHIVG-KLGPILGPKGIMPNPKFGTITK--DIKKAIQ
RL1_WIGBR       VSDKIKNNKK-LKIDHVISTPEAMPIVE-KLGSILGPKGLMPNPKLGTITK--DIKNEIK
RL1_DEHMC       LIKKIE-AGF-LDFDVAISTPDMMSKVG-KLGKVLGRRGLMPNPKSGTVVPAEDFKKVIE
RL1_RHOBA       LAKKIK-DGW-TDFDVCIAAPDMMGLVG-PLGRVLGPRGLMPSPRAGTVTP--DVGKVVS
RL1_TREDE       YIEKVK-GGW-LDFDIAVATPDMMKDVG-RLGMVLGRRGLMPNPKTGTVTT--DIASAIN
RL1_TREPA       YLEKVK-GGW-FDFDVVVASPDMMKDVG-RLGMVLGRRGLMPNPRTGTVSA--DLGAAVC
RL1_BORBU       LINKIK-SGW-DEFDVVVATPDMMKDVG-RLGPILGKRGLMPNPKTQTVTN--NLKDAIN
RL1_LEPIC       LIEKVA-GGW-TDFDACVATPDMMKDVG-KLGPILGRKGLMPKPKAGTVTT--DVAKAVN
RL1_CHLFF       LVEKIK-GGW-VDFDVAVATPDMMREVG-KLGKVLGPRNLMPTPKAGTVTT--DVVKAIA
RL1_CHLPN       LVEKIK-SGW-LEFDVAVATPDMMREVG-KLGKVLGPRNLMPTPKTGTVTT--DVAKAIS
RL1_CHLMU       LVEKIK-GGW-VDFDVAVATPDMMREVG-KLGKVLGPRNLMPTPKSGTVTT--DVVKAIA
RL1_PARUW       LLEKVN-GGW-TDFDAVVATPDMMREVG-KLGKVLGPRGLMPTPKAGTVTT--DIAKAIQ
RL1_DEIGD       LIDRIA-NGF-MDFDAVVATPDMMAQIGQKLARLLGPRGLLPNPKSGTVGP--DVAGMVR
RL1_DEIRA       LIERIA-GGF-MDFDAVVATPDMMAQIGQKLARLLGPRGLLPNPKSGTVGA--DVAGMVR
RL1_THET8       IIQKIL-DGW-MDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGF--NIGEIIR
RL1_PROMP       LVESIN-KGN-MDFDLLIATPDMMPKVA-KLGRVLGPRGLMPNPKAGTVTG--DIASAIK
RL1_PROMT       LVDSIN-KGE-MNFDLLISTPDMMPKVA-KLGRVLGPRGLMPNPKAGTVTT--DLEGAIK
RL1_SYNS3       LVEAIS-KGE-MNFDLLIATPDMMPKVA-KLGRVLGPRGLMPNPKAGTVTT--DLASAIQ
RL1_SYNS9       LVEAIS-KGE-MNFDLLIATPDMMPKVA-KLGRVLGPRGLMPNPKAGTVTT--DLAAAIK
RL1_SYNPW       LVETIS-KGE-MDFDLLIATPDMMPKVA-KLGRVLGPRGLMPNPKAGTVTT--DLAAAIN
RL1_PROMM       LVESIG-KGQ-MDFDLLIATPDMMPKVA-KLGRVLGPRGLMPNPKAGTVTT--DLAAAIK
RL1_PROMA       LIDSIS-KGE-MNFDLLISTPDMMPKVA-KLGRVLGPRGLMPNPKAGTVTT--DLISSIK
RL1_SYNR3       LVDSIA-GGQ-MDFDLLIATPDMMPKVA-KLGRVLGPRGLMPNPKTGTVTT--DVTNAIN
RL1_TRIV2       LIDEIQ-KGR-MDFDKLIATPDVMPQVA-KLGKMLGPRGLMPSPKGGTVTF--DIASAIA
RL1_THEEB       LIDEIQ-KGR-MDFDLLIATPDMMPQVA-KVGRILGPRGLMPSPKAGTVTF--DLPQAIQ
RL1_SYNP6       LIEEIS-KGF-LDFDLLIATPDVMPQVA-KLGRQLGPRGLMPSPKGGTVTF--DLEQAVN
RL1_TRIEI       LIEQIS-KGM-MEFDRLIATPDVMPQVA-KLGRLLGPRGLMPSPKGGTVTF--DLTKAID
RL1_SYNJA       LIEEIG-KGV-IDFDLLIATPDVMPQVA-KLGRLLGPRGLMPSPKGGTVTM--DLAQAIK
RK1_CYAPA       LIDEIQ-NGR-LDFDCLIATPDMMPQVA-KLGRVLGPRGLMPSPKGGTVTF--DLAQAIN
RL1_SYNY3       LIEEIQ-KGM-MDFDVLIATPDMMPKIA-RLGKQLGPRGLMPSPKGGTVTA--DLAAAVN
RL1_GLOVI       LIERIQ-GGF-MEFDLMIATPDIMPQVA-RLGKLLGPRGLMPSPKGGTVTM--DLVGAIR
RK1_RHDSA       LIQNIM-KGD-LDFDRLIATPDMMPAIA-KLGKVLGPRGLMPSPKSGTVTA--DIKEAID
RK1_GUITH       LVQDIM-KGM-LDFDRLIATPDMMPLIA-KLGKVLGPRGLMPSPKSGTVTS--DVKSAIE
RK1_PORPU       LIDEIS-KGR-LDFDKLIATPDIMPLIA-KLGRVLGPRGLMPSPKAGTVTL--DITKSIN
RK1_PYRYE       LIDEIL-KGR-LDFDKLIATPDVMPLIA-KLGRVLGPRGLMPSPKAGTVTL--DVAKAVN
RK1_GRATL       LIDEIK-KGR-LDFDKLIATPDMMMSIA-KLGKILGPKGLMPSPKAGTVTH--NLITTIK
RK1_CYAM1       LCAQIA-QSI-INFDCLIATPDMMPTLA-KLGKILGPRGLMPSPKSGTVTT--NVAEAIQ
RK1_CYACA       LVESIA-NGF-LEFDQLLTTPDMMPVIA-KVGKILGPRGLMPSPKSGSVTS--DIYNAIQ
RK1_TRICV       LIEEIS-QGN-ISFDLLIATPDMMPKLA-KLGRVLGPKGLMPSPKSGTVST--TLTATLS
RK1_THAPS       LIDDIS-QGN-LNFDLLVATPDMMPKLA-KLGRVLGPKGLMPSPKSGTVST--NLTETLS
RK1_PHATC       LIAQIT-QGQ-INFDLLIATPNMMPKLA-KLGRMLGPKGLMPSPKSGTVTS--TLQSTLT
RL1_KORVE       MVEKIAKEGW-TDYDAVISTPDMMRSVG-KLGKVLGPRGLMPNPKTGTVTT--DVASAVR
RL1_SOLUE       MVNKIQSESW-TDYDAVIATPDMMRSVG-KLGKVLGPRGLMPNPKTGTVTV--DVAKAIA
RL1_AQUAE       LINKILKEEW-TDFDVAIATPEMMPKVA-KLGRILGPRGLMPSPKTGTVTT--NVEQAIK
RL1_RUBXD       LAARIQNEGF-MDFDVAVATPDQMSIVG-RLGPILGPRGLMPNPKSGTVTM--DVGRAVE
RL1_SALRD       YIERIEEENW-LDFDVAIATPDVMGQVG-QLGRILGPRGLMPNPKSGTVTM--DVADAIE
RL1_CLOBL       LVEKIQKENW-FDFDVVVATPDMMGVVG-RLGRVLGPKGLMPNPKSGTVTF--DVAKAIA
RL1_CLONN       YLDKIQKENW-FDFDVVVATPDMMGVVG-RLGRVLGPKGLMPNPKSGTVTF--DVAKAIA
RL1_CLOAB       LATKIQSENW-FDFDVVVATPDMMGVVG-RLGRVLGPKGLMPNPKSGTVTF--DVAKALT
RL1_CLOPS       LVQKIQGENW-FDYDVVVATPDMMGVVG-RLGRVLGPKGLMPNPKSGTVTF--DVANAIK
RL1_CLOTE       LVEKIQKENW-FDYDVVVATPDMMGVVG-RLGRVLGPKGLMPNPKSGTVTF--DVAKALN
RL1_HUNT2       LVSKIQNENW-FEFDVVVATPDMMGVVG-RLGKVLGPKGLMPNPKAGTVTM--DVAKAIA
RL1_CLOD6       LVQKIQGENW-FDFDIVVATPDMMGVVG-RLGRVLGPKGLMPNPKSGTVTF--DVAKAID
RL1_CALS4       LVEKIQKENW-FDYDVVIATPDMMGVVG-RLGKLLGPKGLMPNPKSGTVTF--EVEKAVK
RL1_CALS8       LVAKIQNEGW-TDFDVCIATPDMMGLVG-RLGKVLGPKGLMPNPKSGTVTM--DIAKAVK
RL1_DESHY       MIAKIE-QGW-FGFDVVVATPDMMGMVG-KLGRVLGPKGLMPNPKTGTVTF--DVAKAVK
RL1_CARHZ       YIEKIA-QGW-IDFDVVVATPDMMGAVG-RLGKILGPKGLMPSPKTGTVTF--EVAKAIA
RL1_SYNWW       LAEKIQ-GGW-FDFDVAVATPDMMAVVG-KMGKILGPRGLMPNPKAGTVTF--DIERTIK
RL1_MOOTA       LVEKIQ-GGW-LDFDVAIATPDMMGLVG-RLGRILGPRGLMPNPKAGTVTM--DIARAVK
RL1_SYMTH       LVAKIQ-EGW-LDFDVAVATPDMMSLVG-RLGRILGPRGLMPNPKTGTVTF--DVANAIQ
RL1_THEMA       LVEKIEKEGF-LDFDVAIATPDMMRIIG-RLGKILGPRGLMPSPKSGTVTQ--EVAEAVK
RL1_FUSNN       YINQIQ-QGW-LDFDLVIATPDMMPKIG-RLGKILGTKGLMPNPKSGTVTP--DIAAAVS
RL1_ACIC1       LIEQVA-NGF-LDFDAVVATPDLMGKVG-RLGRILGPRGLMPNPKTGTVTN--DVAKAVA
RL1_THEFY       LVERIQ-QGF-LDFDAVVATPDMMGKIG-RLGRILGPRGLMPNPKTGTVTM--DVAKAVS
RL1_MYCUA       LIEKIQ-GGF-LDFDAVIATPDQMAKVG-RIARVLGPRGLMPNPKTGTVTP--DVAKAVA
RL1_MYCLE       LIEKIQ-GGW-LEFDAAVATPDQMAKVG-RIARVLGPRGLMPNPKTGTVTP--DVAKAVA
RL1_MYCSS       LIEQIQ-GGM-LDFDAAIATPDQMAKVG-RIARILGPRGLMPNPKTGTVTA--DVAKAVS
RL1_NOCFA       LIERIQ-GGW-LDFDAAIATPDQMAKVG-RIARVLGPRGLMPNPKTGTVTT--DVAKAVS
RL1_SACEN       LIERIQ-GGW-LDFDAAIATPDQMAKVG-KIARVLGPRGLMPNPKTGTVTP--NVTKAVA
RL1_FRACC       LVARIQ-EGF-LEFDATVATPDQMAKVG-RIARVLGPRGLMPNPKTGTVTL--DIGKAVS
RL1_NOCSJ       LIDKVA-GGW-LDFDAVVATPDMMGKVG-RLGRVLGPRGLMPNPKTGTVTP--DVAKAVS
RL1_CUTAK       LIAKVQ-GGY-LDFDSVVATPDMMGKVG-RLGRVLGPRGLMPNPKTGTVTM--DVAKAVS
RL1_ARTS2       LIEKIA-AGW-TDFDAAVATPDLMGKVG-RLGKVLGPRNLMPNPKTGTVTP--DVTKAVN
RL1_STRCO       LIDEVS-KGR-LDFDAVVATPDLMGKVG-RLGRVLGPRGLMPNPKTGTVTP--DVAKAVN
RL1_CLAM3       LIEKVA-GGY-TSFDSAVSTPELMGKVG-RLGKVLGPRGLMPNPKTGTVTP--DVARAVS
RL1_LEIXX       LIEKVA-GGY-TDFDSAVSTPELMGQVG-RLGKVLGPRGLMPNPKTGTVTP--DVAKAVF
RL1_BIFAA       LVQKVA-DGF-LDFDSVVATPDMMGKVG-RLGRVLGPRGLMPNPKTGTVTM--DVTKAIK
RL1_BIFLO       LIAKVQ-GGF-LDFDAVVATPDMMGKVG-RLGRVLGPRGLMPNPKTGTVTM--DVTKAVK
RL1_CORGL       LVEKIQ-GGW-TDFDVAIATPDQMAKIG-RIARVLGPRGLMPNPKTGTVTN--DVAKAIE
RL1_COREF       LVERIQ-GGW-TDFDVAIATPDQMAKIG-RIARVLGPRGLMPNPKTGTVTN--DVAKAIE
RL1_CORDI       LIEQIT-AGT-IEFDVAIATPDQMAKVG-RVARVLGPRGLMPNPKTGTVTN--DVAKAIA
RL1_CORJK       LIEKIQ-GGW-TDFDAAIATPDQMAKVG-RVARVLGPRGLMPNPKTGTVTT--DVAKAVA
RL1_TROWT       LVARVA-DGY-VDFDVAISTPELMAQVG-QLGRVLGPRGLMPNPKTGTVTA--DVGKAVK
RL1_MYCMS       INRIKN-ENW-FDFDIIVATPEMMAKLG-AIGKILGPKGLMPNPKTGTVTI--DVAKAVD
RL1_MESFL       ITKIQK-ENW-FEFDVIVATPEMMAKLG-AIGKVLGPKGLMPNPKTGTVTM--DVAKAID
RL1_MYCGE       KIEAIK-NGW-LDFDLIITSPKFMGALG-KLGKLLGTRGLMPNPKTETVTD--DVVSAIK
RL1_MYCPN       KINDIK-NGW-LDFDLIITSPKFMAALG-KLGKLLGTKGLMPNPKTETVTD--DVPAAVR
RL1_MYCGA       KINEIK-AGW-MDFDVIITNPKFMIELG-KLGKILGPKGLMPNPKTGTVTQ--DIATAIT
RL1_UREPA       YIQNIE-KML-NQIDVIITNQKMMPLLA-KLGKVLGPRGLMPNPKIGTVTN--DVLKAVE
RL1_MYCHJ       LEQNLK-IDN-FNFDVIVVEPKLMPILG-RYGKKLGPKGLMPNPKTGTVSP--NPEKAVA
RL1_MYCPU       LEEIIK-QNK-FDFDVIVADPKMMPILG-RYGKVLGPKGLMPNPKTGTVTP--NPDKAVV
RL1_MYCS5       FEQKLK-EDD-YNFDVIVADPAMMPILG-KYGKKLGPKGLMPNPKTGTVTP--TPEKAVE
RL1_MYCMO       LEEILK-SEK-FDFDIMVTDPKMMPTLG-KYGKVLGPKGLMPNPKTGTVTP--NIAKAVE
RL1_ONYPE       LIDKIA-KNW-FDFDVLVATPEMMPQLS-KLGRLLGPKGLMPNPKTGTVTN--DVLQAVK
RL1_BACCR       YIGKIQ-QGW-FDFDVVVATPDMMGEVG-KLGRVLGPKGLMPNPKTGTVTF--DVTKAVN
RL1_BACSU       YINKIQ-QGW-FDFDVIVATPDMMGEVG-KIGRVLGPKGLMPNPKTGTVTF--EVEKAIG
RL1_GEOKA       YINKIQ-QGW-FDFDVVVATPDMMGEVG-KLGRILGPKGLMPNPKTGTVTF--DVAKAVQ
RL1_BACSK       LINKIN-QGW-FDFDVIVATPDMMAQVG-RLGRVLGPKGLMPNPKTGTVTF--DVTKAVE
RL1_BACHD       CINKIS-QGW-FDFDVIVATPDMMAQVG-KLGRVLGPKGLMPNPKTGTVTF--EVEKAVN
RL1_OCEIH       YINKIN-QGW-FEFDVIVATPDMMAEVG-KLGRVLGPKGLMPNPKTGTVTF--EVEKAVN
RL1_LISMO       FVEKIN-QGW-FDFDVIVATPDMMGEVG-KLGRVLGPKGLMPNPKTGTVTM--DVTKAVN
RL1_ENTFA       MVAKIQ-GGW-FDFDVVVATPDMMATVG-KLGRVLGPKGLMPNPKTGTVTM--DVTKAVE
RL1_STAEQ       YVQKIQ-QGW-FDFDVVVATPDMMGEVG-KLGRVLGPKGLMPNPKTGTVTM--DVKKAVE
RL1_STAS1       YVEKIQ-QGW-FDFDVVVATPDMMGEVG-KLGRVLGPKGLMPNPKTGTVTM--DVKKAVE
RL1_STRMU       LVQKIN-GGW-LDFDVVIATPDMMAIVG-RLGRVLGPRNLMPNPKTGTVTM--DVAKAVE
RL1_STRS2       LVAKIN-GGW-LDFDVVIATPDMMAVVG-RLGRVLGPRNLMPNPKTGTVTM--DVAKAVE
RL1_LACLA       LVAKIN-GGW-LDFDVVIATPDMMAVVG-RLGRVLGPRNLMPNPKTGTVTM--DVTKAVE
RL1_LACBA       LVERIQ-DGW-LDFDVAIATPDMMAQVG-RLGRVLGPKGLMPNPKTGTVTM--NVEKAVS
RL1_LEUMM       LVQRIQ-GGW-LDFDVAVATPDMMAQVG-RVGRALGPKGLMPNPKTGTVTM--DVTKAVS
RL1_PEDPA       LVQRIQ-DGW-LDFDVAIATPDMMGQVG-RLGRVLGPKNLMPNPKTGTVTM--DVEKAVA
RL1_LACPL       LVQKIQ-DGW-LDFDVAIATPDMMAQVG-RLGRVLGPKGLMPNPKTGTVTM--DVAKAVN
RL1_LACS1       LVARIQ-DGW-LDFDVAIATPDMMAQVG-RLGRVLGPKGLMPNPKTGTVTM--DVTKAVT
RL1_OENOB       LIQKVQ-SGW-TDFDVAIATPDQMAKVG-RVGRALGPKGLMPNPKEGTVTM--DVTKAVS
RL1_LACP3       LVQKIQ-DGW-LDFDVAVATPPMMAQVG-RLGRVLGPKGLMPNPKTGTVTM--DTAKAVK
RL1_LACSS       LVEKIQ-GGW-LDFDVAVATPPMMAQVG-RLGRVLGPKGLMPNPKTGTVTM--DVTKAVN
RL1_LACDB       LVEKVQ-NGY-LDFDVVIATPMMMAKVG-RLGRVLGPKGLMPNPKTGTVTM--DTAKAVQ
RL1_LACAC       LVEKIQ-GGW-LDFDVVVATPMMMAKVG-RLGRVLGPKGLMPNPKTGTVTM--DIEKAVK
RL1_LACJO       LVEKVQ-NGY-LDFDVVIATPMMMAKVG-RLGRILGPKGLMPNPKTGTVTM--DVAKAVE
RL1_BACV8       YIEKIK-GGW-TDIDVIITMPSIMGKIG-ALGRVLGPRGLMPNPKSGTVTM--DVAKAVK
RL1_PARD8       YINKIK-GGW-TDIDVIITMPSIMGKIG-ALGRVLGPRGLMPNPKSGTVTN--EIGNAVK
RL1_PORGI       YIEKIK-AGW-TDIDVIITMPAIMGKIG-ALGRVLGPRGLMPNPKSGTVTN--DVGAAVK
RL1_FLAPJ       YLQKIK-DGW-TDVDVIVTMPAVMGKLG-PLGRILGPRGLMPNPKTGTVTM--EIGKAVT
RL1_GRAFK       YLDKIK-GGW-TDVDVIITMPSVMGKLG-PLGRVLGPRGLMPNPKTGTVTM--DIAKAVS
RL1_CYTH3       YIQKIE-GGW-LDIDVIITMPTVMAKVG-KLGKILGPRNLMPNPKAGTVTL--DVAKAVK
RL1_CHLPD       YVEKIQ-NGW-TGVDVIIATPDVMGQLG-KVAKILGPRGLMPNPKSGTVTM--DVAKAVK
RL1_PELLD       YIEKIQ-NGW-TGVDVIIATPDVMGQLG-KVAKILGPRGLMPNPKSGTVTM--DVAKAVK
RL1_CHLCH       YITKIQ-EGW-TGVDVIIATPDVMGQLG-KVAKILGPRGLMPNPKSGTVTM--DVAKAVK
RL1_CHLTE       YIEKIQ-NGW-TDVDVIVATPDVMGQLG-KVARILGPRGLMPNPKSGTVTM--DVAKAVK
RL1_ANADE       LAEKIQ-GGF-MDFDKLIATPDMMGVVG-RLGKILGPRGLMPNPKVGTVTM--DLARAVK
RL1_MYXXD       LQKRIE-EGF-LDFDTVIATPDMMGVVG-RLGKVLGPRGLMPNPKVGTVTM--DVAKAIR
RL1_BARQU       LFESIN-SGT-IDFDRCIATPDMMLLVG-RLGKILGPRNLMPNPKVGTVTL--DVANAVK
RL1_BARBK       LFETVN-GGT-INFDRCIATPDMMPLVG-RLGKVLGPRSLMPNPKVGTVTT--DIAGAVK
RL1_RHIL3       LVEIVQ-GGK-IEFDRCIATPDMMPLVG-RLGKVLGPRGMMPNPKVGTVTM--DVAGAVK
RL1_AGRFC       LVEIVQ-GGK-IDFDRCIATPDMMPLVG-RLGKVLGPRGMMPNPKVGTVTM--DVAGAVK
RL1_RHIME       LVEIVQ-GGK-IDFDRCIATPDMMPLVG-RLGKVLGPRGMMPNPKVGTVTM--DVTGAVK
RL1_BRUME       LFEIVN-GGK-IEFDRCIATPDMMPLVG-RLGKVLGPRGMMPNPKVGTVTT--DVAAAVA
RL1_CHESB       LVETVQ-KGE-INFDRCIATPDMMPLVG-RLGKVLGPRGLMPNPKVGTVTT--DVAAAVK
RL1_RHILO       LVDIVQ-KGT-IDFDRCIATPDMMPLVG-RLGKVLGPRGMMPNPKVGTVTT--DVAAAVK
RL1_BRADU       LVEKVQ-NGS-IDFDRCIATPDMMPLVG-RLGKVLGPRGLMPNPKIGTVTM--DVTGAVK
RL1_NITWN       LVETVQ-GGT-IAFDRCIATPDMMPLVG-RLGKVLGPRGMMPNPKIGTVTM--DVAGAVK
RL1_RHOPA       LVEQVQ-AGN-INFDRCIATPDMMPLVG-RLGKVLGPRGMMPNPKIGTVTM--DVAGAVK
RL1_MARMM       LMEQIQ-GGN-INFDKVIATPDMMPLVG-RLGKVLGPRGMMPNPKVGTVTM--GVTKAVN
RL1_GRABC       LAELVQ-NGT-IEFDRCIATPDMMALVG-RLGKILGPRGLMPNPKLGTVTM--DVKGAVT
RL1_GLUOX       LAEKIQ-AGE-IDFDRCIATPDMMALVG-RLGKILGPRGLMPNPRLGTVTM--DVKGAIT
RL1_ROSDO       LMETVQ-SGK-IEFDRCIATPDMMPIVG-RLGKVLGPRNLMPNPKVGTVTM--DVEAAVK
RL1_RUEST       LMETIQ-GGT-IDFDRCIATPDMMPVVG-RLGKVLGPRNLMPNPKVGTVTM--DVKAAVE
RL1_JANSC       LMETVQ-GGT-IEFDRCIATPDMMPIVG-RLGKVLGPRNLMPNPKIGTVTM--DVKEAVE
RL1_RHOS4       LMETIQ-SGK-IEFDRCIATPDMMPLVG-RLGKILGPRNLMPNPKVGTVTM--DVKSAVE
RL1_RUEPO       LMETIQ-SGK-IEFDRCIATPDMMPVVG-RLGKILGPRNLMPNPKVGTVTM--DVAQAVQ
RL1_PARDP       LMETIQ-SGK-IEFDRCIATPDMMPLVG-RLGKILGPRNLMPNPKVGTVTM--DVKAAVE
RL1_MAGSA       LFDACN-AGN-MDFDRVIATPDLMGLVG-RLGKVLGPRGLMPNPKLGTVTA--NVTEAVR
RL1_RHORT       LAADIQ-NGT-IDFDRCIATPDMMGVVG-RLGKVLGPRGLMPNPKLGTVTM--DVATAVK
RL1_HYPNA       LFEKVN-GGF-MDFDRVIATPDMMGLVG-RLGKVLGPRGLMPNPKVGTVTP--NVAQAVK
RL1_CAUVC       LYEKIA-GGF-MDFDRVIATPDMMALVG-RLGKVLGPRGLMPNPKVGTVTP--NVAQAVK
RL1_NOVAD       LLEDMQ-AGN-LDYGRVIATPDMMGIVG-RLGKVLGPKGLMPNPKLGTVTP--NVAEAVK
RL1_SPHAL       LMEDML-AGN-LDYGRVIATPDMMGIVG-RLGKTLGPKGLMPNPKLGTVTP--NVAEAVK
RL1_ERYLH       LMEDMQ-NGN-LDYDRVIATPDMMGVVG-RLGKVLGPKGLMPNPKLGTVTP--NVEQAVK
RL1_ZYMMO       LMEAIQ-GGS-IDFDRCIATPDMMGVVG-RLGKILGPKGMMPNPKLGTVTM--NVADAVK
RL1_MAGMM       LLEKIQ-GGW-LEFDRVVATPDVMGVVG-RLGKILGPRNMMPNPKLGTVTF--DVAKVVQ
RL1_GEOSL       LVTKIQ-EGW-FEFDTAIATPDMMGVVG-KIGKLLGPRGLMPNPKVGTVTF--DVGRAVK
RL1_PELPD       LVSKIQ-EGW-FEFDTAIATPDMMGVVG-KIGKLLGPRGLMPNPKVGTVTF--EVSRAVK
RL1_PELCD       LVAKIQ-EGW-FDFDTAIATPDMMGTVG-KIGRLLGPRGLMPNPKVGTVTF--EVGKATS
RL1_DESVH       LVAKIK-EGW-LDFDKAIATPDVMALVG-QIGRVLGPRGLMPNAKTGTVTF--DITTAIK
RL1_LAWIP       LVAKIK-DGW-LDFDAAVATPDVMALVG-QVGRQLGPRGLMPNAKTGTVTF--NVTNAIK
RL1_DESAG       LVEQVK-GGM-LDFDSAIATPDVMALVG-QIGRVLGPRGLMPNAKTGTVTF--DVAKAVS
RL1_SYNFM       LVDRIK-EGW-LEFDKTVATPDMMGAVG-KIGKVLGPRGLMPNAKLGTVTF--DLQKVVK
RL1_SYNAS       FIEKIK-SGW-LEFDRVIATPDMMGNVG-KLGKILGPRGLMPNPKVGTVTF--DVATAVK
RL1_DESPS       LVEKIQ-GGW-LEFDKTVATPDMMGTVG-KIGRVLGPRNLMPNAKLGTVTF--DVAKVIE
RL1_BDEBA       LVAKIQ-GGW-LDFDKCIATPDMMATVS-KVAKILGPRGLMPNPKIGTVTM--NVGEAVT
RL1_CAMJJ       LVEEIQ-KGN-MNFDVLIATPNLMGLVG-KVGRILGPKGLMPNPKTGTVTM--DVAQAVN
RL1_CAMFF       FVDEIA-KGV-INFDVLIATPNLMGLVG-KIGRLLGPKGLMPNPKTGTVTM--DVAQAIK
RL1_NITSB       LVEQIQ-NGN-IDFDIAIATPDMMGLVG-KIGRILGPKGLMPNPKTGTVTM--DVCQAVK
RL1_SULNB       LIEDIQ-AGK-IDFDIVISTPDMMGVLG-KVARVLGPKGLMPNPKTGTVTM--DVAKAVE
RL1_SULDN       LVQQIK-DGI-FNFDIVVAAPDCMGLVG-QIGRILGPKGMMPNPKTGTVTP--DVATAVK
RL1_HELAH       LAEEIK-NGR-IDFDMVIATPDMMAVVG-KVGRILGPKGLMPNPKTGTVTM--DIAKAVT
RL1_HELHP       LAEEIK-NGN-INFDMVIATPDMMALVG-KVGRILGPKGLMPNPKTGTVTI--DVAKAVA
RL1_WOLSU       LAEEIK-NGN-INFDIVIATPDMMALVG-KVGRILGPKGLMPNPKTGTVTA--DVTKAVN
RL1_ACISJ       LAAQVK-AGD-MPFDVVIAAPDAMRVVG-TLGQILGPRGLMPNPKVGTVTP--DVATAVK
RL1_VEREI       LAAMVK-AGD-MPFDVVIAAPDAMRVVG-TLGQILGPRGLMPNPKVGTVTP--DVALAVK
RL1_RHOFT       LAAMIK-AGD-MPFDIVIAAPDAMRVVG-TLGQILGPRGLMPNPKVGTVTP--DVATAVK
RL1_POLSJ       LAAEIK-AGK-MDFDVVIASPDAMRIVG-TLGQILGPRGLMPNPKVGTVTP--DVATAVK
RL1_METPP       LAEQVK-AGN-LNFDVVIASPDTMRIVG-TLGQILGPRGLMPNPKVGTVTP--DVATAVK
RL1_AZOSB       LAEQVK-GGT-IDFDLCIATPDAMRVVG-QLGQILGPRGLMPNPKVGTVTM--DVTTAVK
RL1_AROAE       LAEQVK-AGN-IDFDLCIATPDAMRVVG-QLGQILGPRGLMPNPKVGTVTM--DVTTAVK
RL1_PARXL       LAEQVK-AGK-LDFDIVIASPDTMRVVG-TLGQILGPRGLMPNPKVGTVTP--DVATAVK
RL1_RALSO       LAEQIK-AGN-MDFDVVIASPDTMRVVG-TLGQILGPRGLMPNPKVGTVTP--DVATAVK
RL1_HERAR       LAESIK-AGN-MPFDIVIASPDTMRIVG-TLGQILGPRGMMPNPKVGTVTP--DVATAVK
RL1_BORA1       LAEQIK-AGQ-MDFDVVIASPDTMRVVG-ALGQILGPRGLMPNPKVGTVTP--DVATAVK
RL1_DECAR       LAAEVK-AGN-LNFDVVIATPDAMKVVG-QLGQILGPRGLMPNPKVGTVTM--DVVTAVK
RL1_NEIG1       LAAEIK-AGN-LNFDVVIASPDAMRIVG-QLGTILGPRGLMPNPKIGTVTP--NVAEAVK
RL1_CHRVO       LAEQVK-AGN-LDFDVVIASPDAMRVVG-QLGQILGPRGLMPNPKVGTVTP--NVAEAVK
RL1_METFK       LAEQVK-GGM-LDFDVAIATPDAMRIVG-ALGQVLGPRGLMPNPKVGTVTP--DVATAVK
RL1_THIDA       LAADIK-AGK-MDFDVVIATPDAMRVVG-QLGQILGPRGLMPNPKVGTVSP--DVVGAVK
RL1_NITEC       LAEQVK-ANE-INFDLAIASPDSMRIVG-QLGQILGPRGLMPNPKVGTVTL--DVASAVK
RL1_NITEU       LAERVK-AGE-INFDLAIASPDAMRVVG-QLGQILGPRGLMPNPKVGTVTV--DVINAIR
RL1_NITMU       LAEQIK-AGN-IEFDVAIASPDAMRVVG-QLGQILGPRGLMPNPKVGTVTP--DVAGAVK
RL1_ACIAD       LAESIQ-QGN-LDFDVVIAAPDAMRVVG-KLGTILGPRGLMPNPKVGTVTP--DVANAVK
RL1_PSYA2       LAESIK-AGN-MDFDVVIAAPDAMRVVG-QLGTILGPRGLMPNPKVGTVTP--NVAEAVL
RL1_HAHCH       LAEEVK-KGN-LDFDVVIATPDAMRVVG-QLGQILGPRGLMPNPKVGTVTA--DVEAAVN
RL1_MARHV       LADEVK-KGN-MDFDVVIATPDAMRVVG-QLGQILGPRGLMPNPKVGTVTA--DVETAVK
RL1_PSEAE       LAAEMK-GGD-LNYDVVIASPDAMRVVG-QLGQILGPRGLMPNPKVGTVTP--DVATAVK
RL1_PSEU5       LAAEMK-GGD-LNYDVVIASPDAMRVVG-QLGQVLGPRGLMPNPKVGTVTP--DVATAVK
RL1_PSEF5       LAAEMK-GGD-LNYDVVIASPDAMRVVG-QLGQVLGPRGLMPNPKVGTVTP--DVASAVK
RL1_ALCBS       LAEQVQ-GGE-INFDVVIASPDAMRVVG-KLGTILGPRGLMPNPKVGTVTP--DVAQAVK
RL1_CHRSD       LAEEVK-KGN-LDFDVVVAAPDAMRVVG-QLGQILGPRGLMPNPKVGTVTP--DVATAVK
RL1_MANSM       LAEQIK-KGE-MNFDVVIASPDAMRVVG-QLGQVLGPRGLMPNPKVGTVTP--NVADAVK
RL1_HAES1       LAEQIK-KGE-MNFDVVIASPDAMRVVG-QLGQILGPRGLMPNPKVGTVTP--NVAEAVK
RL1_PASMU       LAELVK-KGE-MNFDVVIASPDAMRVVG-QLGQILGPRGLMPNPKVGTVTP--NVADAVK
RL1_AERS4       LADLVK-KGE-MNFDVVIASPDAMRVVG-QLGQILGPRGLMPNPKVGTVTP--NVAEAVK
RL1_VIBCH       LADLVK-KGE-MNFDVVIASPDAMRVVG-QLGTILGPRGLMPNPKVGTVTP--NVAEAVK
RL1_ECOLI       LADQIK-KGE-MNFDVVIASPDAMRVVG-QLGQVLGPRGLMPNPKVGTVTP--NVAEAVK
RL1_PSEHT       LAELVK-KGE-MNFDVVVASPDAMRVVG-QLGQILGPRGLMPNPKTGTVTP--NVAEAVK
RL1_SHEAM       LAEQVK-AGE-MNFDVVIASPDAMRVVG-MLGQILGPRGLMPNPKTGTVTP--NVAEAVK
RL1_SHELP       LAAQVK-AGE-MNFDVVIASPDAMRVVG-QLGQILGPRGLMPNPKTGTVTP--NVAEAVK
RL1_SHEFN       LAEKVK-AGE-MNFDVVIASPDAMRVVG-MLGQILGPRGLMPNPKTGTVTP--NVAEAVK
RL1_PHOPR       LADQVK-KGI-MDFDVVIASPDAMRVVG-QLGTILGPRGLMPNPKVGTVTP--NVAQAVK
RL1_PSEA6       LAEQVK-KGE-MNFDVVVASPDAMRVVG-MLGQILGPRGLMPNPKTGTVTP--DVATAVK
RL1_IDILO       LAAQVK-KGE-MNFDVVVASPDAMRVVG-QLGQILGPRGLMPNPKTGTVTP--DVATAVK
RL1_COLP3       LAAQVK-AGE-MNFDVVIASPDAMRVVG-QLGQILGPRGLMPNPKVGTVTP--DVAGAVK
RL1_PSYIN       LAAQVK-AGE-LNFDVVIASPDAMRVVG-QLGQILGPRGLMPNPKVGTVTP--DVATAVK
RL1_METCA       LGAQVK-AGE-LNFDVVIAAPDAMRVVG-QLGQILGPRGLMPNPKTGTVTP--DVATAVK
RL1_ALKEH       LAEQVK-GGN-LDFDVVVAAPDAMGVVG-RLGPILGPRGLMPNPKVGTVTP--DVAGAVK
RL1_NITOC       LAETVK-SGQ-IDFDVIIASPDAMRVVG-QLGPILGPRGLMPNPKVGTVTT--DVAGAVT
RL1_FRATW       LADEVK-KGN-MDFDVVIASPDSMRVVG-QLGQILGPKGLMPNPKVGTVTM--DVAKAVR
RL1_SACD2       LAEQIK-GGM-MDFDVVIADPAAMRVVG-MLGQVLGPRGLMPNPKTGTVTP--DVVGAVK
RL1_HYDCU       LAAEVK-GGM-MDFDVVIASPDAMRVVG-MLGQVLGPRGLMPNPKTGTVTP--DVVTAIK
RL1_DICNV       LADEIK-AGR-SDFDVVIAEPAAMRVVG-QLGQILGPRGLMPNPKVGTVTA--DIKAAVE
RL1_LEGPH       LADKIK-AGE-MNFDVVIATPDAMRIVG-QLGQILGPRGLMPNPKVGTVTT--NVEAAVN
RL1_XANC8       LAEKMQ-AGD-LNYDVVIATPDAMRVVG-KLGTLLGPRGLMPNPKVGTVSP--NPGEAVK
RL1_XYLFT       LAEKMQ-AGD-LNYDVVIATPDAMRVVG-KLGTLLGPRGLMPNPKVGTVSQ--NPGEAVK
RL1_HALHL       LAERMQ-GGE-LDYDVVIASPDAMGVVG-KLGPVLGPRGLMPNPKTGTVSA--DVAGAVR
RL1_COXBU       LAERIQ-GGD-IDFDVVIATPETMRVVG-KLGQVLGPRGLMPNPKVGTVTT--DVASAVK
RL1_RUTMC       LMKSMQ-DGD-LNYDVVIASPDAMGVVG-RLGQVLGPRGLMPNPKVGTVTS--DVATAVN
RL1_VESOH       LMKSMQ-GGD-LSYDVVIASPDAMGVVG-RLGQLLGPRGLMPNPKVGTVTS--DVSLAVS
RL1_RICTY       IIDEIK-SGQ-INFDVCIATPDMMSMIS-SVARILGPKGLMPNPKLGTVTL--DIKNAIK
RL1_RICBR       IIDEIK-AGK-INFDVCIATPDMMAVIG-SVARILGPKGLMPNPKLGTVTL--DIKGAVK
RL1_ORITB       IIEAIK-SGN-IDYDVYITTPAMMVAVS-QVARILGPKGLMPNPKLGTVTN--DVAAVVK
RL1_PELUB       FIDKIK-AGE-LNFEKLICTPGMMVKLS-KLGKVLGPKGLMPNPKLGSVSE--DIKQAVT
RL1_ANAMM       LIEEIK-KGRRLDVDWCIATPDFMPQIS-AIAKILGPRGLMPNPKFGTVTL--ELAEMVG
RL1_ANAPZ       LIEEIK-KGRKLDFDWCIATPDFMSQVS-AIAKILGPRGLMPNPKFGTVTF--DIAKMVG
RL1_EHRCR       LIEEVKKKQCKLDVDWCLTTPDFMASVS-SIAKILGPKGLMPNPKFNTVTF--ELAKAIK
RL1_EHRRW       LIEEIKRKKCKLDVDWCLTTPDFMSSVS-SIAKILGPRGLMPNPKFNTVTF--ELSKAIK
RL1_WOLPM       LVEEIK-KGRKLDVDWCITTPDFMAKIT-PIAKVLGVKGLMPNPKFGTVTS--NIAEAIK
RL1_WOLTR       LVQEIK-KGKKLDVDWCITTPDFIAKIT-PIAKILGAKGLMPNPKFGTMTS--NVAEAIK
                                 :     :  :    .  ** :.::*. :  ::           

RL1_BUCAI       NAKTGQVRYRNDKNGIIHATIGRINFHKNEIKENLNVFLESIKKAK-PPQSKGIYIKKIV
RL1_BUCAP       NAKTGQVCYRNDKNGIIHATIGRINFERNQIKENFNVFLESIKKAK-PPQSKGIYIKKVV
RL1_BUCBP       NAKSGQIHYKNDKNGIIHISIGKINFENTKIKENLNALISSLKQSK-PSQSKGTYIKQVV
RL1_BAUCH       EIKSGQIRYHNDKNGIIHTTIGKINFESYQLIENLEALLRALKKDK-PLQTKGIYFKKIC
RL1_BLOFL       NFKLGQVRYKNDKNGIIHAVIGKINFNISCLQENLEALVFSIYQVK-PTQFKGIYIKKIY
RL1_BLOPB       NVKSGQIRYKNDKSGIIHATIGKINFDLIQLKENLEALIVSLKQAK-PILYKGTYIKKVT
RL1_BUCCC       EAKKGKINYRNDKNGIIHSNFGKINFSEKELYENFLTLYQDIKKSQ-PNQFKGIYYKKIN
RL1_WIGBR       KIKSGQLNYKNDKYGIIHTTIGKINFNNLELKINLLYFLNHLVKTK-PTNLKGVFIKKVS
RL1_DEHMC       EARKGRVEFKLDRSGIVHIILGKASFEGQMLLENMTSVVDAIIRSK-PTGAKGQYIKSAY
RL1_RHOBA       EYKAGKVEFRNDKGGNVHAMVGKMSFEANKLEENIASFVDFISAMK-PQSIKGTYIKGVA
RL1_TREDE       ELKKGRVEFRADKGGVVHLPVGKVSMDSSKIVENVQALINETMRKK-PADAKGDYIRSVS
RL1_TREPA       ELKKGRVEFRADKTGVVHLAVGKTTMDSAQIVENVDVFLSEMDRKK-PVDVKAGFVRSIS
RL1_BORBU       SLKKGRTEFRANKNGVISFSFGKSSMDNEKIKENYEEFVKEVVKKR-PSDLKGAFIDSIY
RL1_LEPIC       ELKAGRIEYRPDKGGVVHLGVGKVSFDNTKLIENIRTVVQTLMRDK-PSDAKGEYLKTFS
RL1_CHLFF       ELRKGKIEFKADRAGVCNAGVGKLSFDGQLLKENIEALCSALIKAK-PPAAKGQYLVSFT
RL1_CHLPN       ELRKGKIEFKADRAGVCNVGVGKLSFESSQIKENIEALSSALIKAK-PPAAKGQYLVSFT
RL1_CHLMU       ELRKGKIEFKADRAGVCNVGVAKLSFDSAQIKENIEALCAALVKAK-PATAKGQYLVNFT
RL1_PARUW       ELKAGKIEFKLDRHGVINNGVGKVSFESNKLEENIRAFLIAIQRAK-PASAKGHYMRSLA
RL1_DEIGD       GLKAGRIEFRNDKTGVVHAPIGKASFDPSNLSANYRALLSALEAAK-PAAAKGVYLRSAY
RL1_DEIRA       GLKAGRIEFRNDKTGVVHAPIGKASFESGNLSANYQALISALEGAK-PGTAKGVFLRSAY
RL1_THET8       EIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHK-PEGAKGTFLRSVY
RL1_PROMP       EFKAGKLEFRADKAGIVHVRFGKASFTENALFENLKTLQESIDKNK-PSGAKGKYWRSFY
RL1_PROMT       EFKAGKLEFRADKAGIVHVRFGKASFSEEALLENLKTLQTTIEKNK-PSGAKGKFWRSFF
RL1_SYNS3       EFKAGKLEFRADRTGIVHVRFGKASFTAEALLENLKTLQETIDRNK-PSGAKGRYWKSLY
RL1_SYNS9       DFKAGKLEFRADRTGIVHVRFGKASFTADALLENLKTLQETIDRNK-PSGAKGRYWKSLY
RL1_SYNPW       EFKAGKLEFRADRTGIVHVRFGKASFSEGNLLDNLKTLQETIDRNK-PSGAKGRYWKSLY
RL1_PROMM       EFKAGKLEFRADRAGIVHVRFGKASFSADALLENLKTLQETIDRNK-PSGAKGRYWKSLY
RL1_PROMA       EFKAGKLEFRADRAGIVHVRFGKASFSPEDLLENLKVLHEAIDRNK-PSGAKGRYWKSLY
RL1_SYNR3       EFKAGKLEFRADRSGIVHVQFGKASFSADDLLENLKSVQETVDRNK-PSGAKGRYWKSLY
RL1_TRIV2       EFKAGKLEFRADRTGIVHVMFGKASFSPEDLLVNLKALQETIDRNR-PSGAKGRYWRTFY
RL1_THEEB       EFKAGKVEFRADRSGIVHVLFGKASFSAEDLLVNLKALQESIDRNR-PSGAKGRYWRSVY
RL1_SYNP6       EFKAGKLEFRADRTGIVHVLFGKASFSADDLLANLKALQETIDRNR-PSGAKGRYWRSVY
RL1_TRIEI       EFKAGKLEFRADRSGIVHVMFGKTSFSVEDLLINLKALQECIDRNR-PSGAKGRYWRTIF
RL1_SYNJA       EFKAGKLEYRADKTGIVHLIFGKCKFPVEALLENLKAVQESIDRNR-PPGAKGKYWRALH
RK1_CYAPA       DFKAGKLEFRNDRTGIVHVLFGKANFSEEALLGNLKAVQEAVDRNR-PSGVKGKYWKSIY
RL1_SYNY3       EFKAGKLEFRADRTGIVHVMFGKASFSADDLLANLKALQETIDRNR-PSGAKGRFWRTVF
RL1_GLOVI       EFKAGKLEFRADRTGIVHIPFGKVSFTPEALMDNLKSVQDAIDRAK-PSGAKGRYWRTFH
RK1_RHDSA       EFKKGKLEYRADKSGIVHILFGKTDFSVEDLLANLEAVQESIDKNR-PSGVKGRYWKSFY
RK1_GUITH       EFKKGKLEYRADKSGIVHISFGKTNFSVNDLLLNLEAVQESIDKNR-PAGVKGKYWKSFY
RK1_PORPU       EFKGGKVEYRVDRTGIIHVPFGKSSFPEEDLVMNLQTIKDSIDKNK-PSGSKGKYWKTFF
RK1_PYRYE       EFKGGKVEYRVDRTGIIHVPFGKSSFSQEDLVLNLQTIKESIDRNK-PSGAKGKYWKTFF
RK1_GRATL       EFKAGKLEYKIDRSGILHIPFGKLNFNVEDLHINLITLQESIDRNR-PQGSKGKYWKSVH
RK1_CYAM1       AFRRGQIEYRTDKTGIVHLAFGRMDFNEQHLYDNLVAIKESVETNK-PSGASGLYWKSFA
RK1_CYACA       EFKKGKLEYRTDKSGIVHSIIGKIDFTAEDLLNNLIAIKKSIDQNR-PNGAKGKYWKNMY
RK1_TRICV       EFKKGKFEYKADKAGVVHVSFGKSNFTHSQLMENLTALYKSIEQNR-PSGVKGKYFKSLF
RK1_THAPS       DFKKGKFEYKADKTGVVHVNFGKANFSKDQLMENLTSLYQSIEQNR-PSGVKGKYFKSLF
RK1_PHATC       EFKKGKFEYKADKTGIVHVNFGKSNFTNEQLVENLKALYQSIEQNR-PSGVKGKYFKSVS
RL1_KORVE       EVKAGKVEFRTDKTGLVHVPVGKISFPPDKLVDNATTLITSVVKAK-PSAAKGKYIKGCY
RL1_SOLUE       EIKAGKVEFRVDKTGIIHAPVGKISFSADKLVENASSLIAAVIKAK-PAVAKGKYVRSAT
RL1_AQUAE       DAKRGRVEFKVDKAGNVHMPVGKISFEKEKLIDNLYAAIDAVVRAK-PPGAKGQYIKNMA
RL1_RUBXD       EIKRGKVEYRVDRYGIIHTVLGKKSFDVDSLLENYFALREELVRAR-PAAVKGRYIKSVA
RL1_SALRD       EIKAGKIEFRVDQSGNLHTPIGKASFSPDELYENAQALLREVIRLR-PASAGGLYLRSIT
RL1_CLOBL       DIKAGKVEYRVDKTAIIHVPIGKSSFGEEKLSDNFHVLMEAVVKAK-PAAAKGQYIKSVA
RL1_CLONN       DIKAGKVEYRLDKTAIIHVPIGKKSFGEEKLAENYNVLMEAIVKAK-PAAAKGQYIKSLS
RL1_CLOAB       EIKAGKVEYRVDKTAIVHVPVGKSSFGAEKLKQNFHALMDAIVKAK-PASAKGQYVKSVA
RL1_CLOPS       EIKAGKVEYRVDKTAIVHCPIGKKSFGTEKLVENFKALMDALVKAK-PAAAKGQYLKSVS
RL1_CLOTE       DIKAGKVEYRVDKTAIIHVVIGKKSFGPEKLKDNFRVLMDAIIKAK-PSAAKGQYLKSVS
RL1_HUNT2       DIKAGKIEYRLDKTNIIHCPIGKVSFGTEKLVDNFRTLMSAIIKAK-PAAAKGQYLKSVV
RL1_CLOD6       EIKAGKVEYRLDKTNIIHVPVGKVSFGGEKLTENFTALMDAIIKAK-PAAAKGQYLRSIT
RL1_CALS4       EAKAGKIEYRIDKAGIIHVPIGKKSFGKEKLLENFRTVMDAIIKSK-PAAAKGQYIKSVV
RL1_CALS8       EAKAGRVEFRLDKTAIIHCPIGKVSFGKEKLLENYRTLMDAIIKAR-P-AAKGQFIKSIT
RL1_DESHY       EIKAGKIEYRADKAGIIHAPIGKVSFSEEQLYQNYKVLVETLVKAK-PAAAKGQYIRSVT
RL1_CARHZ       EIKAGKIEYRVDKAGIVHVPIGKVSFPVEKLVENFNTLMDALIKAK-PAGAKGQYLKGVT
RL1_SYNWW       ELKAGRIEYRVDKSAIVHAPIGRISFEVDKLQENLNAFAEALLKAR-PAAAKGQYMRSVT
RL1_MOOTA       EVKAGKIEFRVDKTAIIHAPIGKASFEASKLKENFQALMDALLRAK-PATAKGQYLKSVS
RL1_SYMTH       EIKAGKVEYRTDKAGIVAAPIGKASFDVERLAANFRALTEALLRAK-PAAAKGQYMKSVT
RL1_THEMA       EFKKGRIEVRTDKTGNIHIPVGKRSFDNEKLKENIIAAIKQIMQMK-PAGVKGQFIKKVV
RL1_FUSNN       EFKKGKLAFRVDKLGSIHAPIGKVDFDLDKIEENFKAFMDQIIRLK-PASSKGQYLRTVA
RL1_ACIC1       DIKSGKIEFRVDRQANLHLVIGKTDFTEQQLVENYAAALDEVLRLK-PPTAKGRYLKKVT
RL1_THEFY       DIKGGKIEFRVDRHGNLHLIIGKVSFDEQKLLENYLAAVDEVLRLK-PSAAKGRYIKKIT
RL1_MYCUA       DIKGGKINFRVDKQANLHFVIGKASFEENKLAENYGAAIDEVLRLK-PSASKGRYLKKIT
RL1_MYCLE       DIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLK-PSSSKGRYLKKVT
RL1_MYCSS       DIKGGKINFRVDKQANLHIVIGKASFDEKKLAENYGAALDEILRAK-PSASKGRYLKKIV
RL1_NOCFA       DIKGGKINFRVDKQANLHFVIGKASFDEAKLVENYGAALDEILRAK-PSTAKGRYVKKVT
RL1_SACEN       DIKGGKINFRVDKQANLHIVIGKASFDTDKLVENYAAALDEILRAK-PSTSKGRYLKKVT
RL1_FRACC       DIKGGKINFRVDKQGNLHIVIGKTNFTDTQLIENYTVALDEIVRVK-PSAAKGRYLKKIT
RL1_NOCSJ       DIKGGKIEFRVDRHANLHFIIGKASFGEVQLAENYAAALEEVLRLK-PASSKGRYIKKIT
RL1_CUTAK       DIKGGKIEFRTDRYANLHFLIGKVSFGSEKLAENYFAALDEILRLK-PNAAKGRYLRKIT
RL1_ARTS2       DIKGGKIDFRVDKHSNLHFIIGKVSFDAIKLAENYAAALEEVLRLK-PSASKGRYIQKAT
RL1_STRCO       DIKGGKIEFRVDKHSNLHFIIGKTSFDDTKLVENYGAALEEILRLK-PSAAKGRYIKKAA
RL1_CLAM3       DIKGGKIEFRVDKHANVHFVVGKASFSPEQLSENVGAALEEIVRLK-PSSSKGRYVQKAT
RL1_LEIXX       DIKGGKIEFRVDKHANVHFVVGKAGFTADQLNDNIKVALDEVVRLK-PSAAKGRYIQKGA
RL1_BIFAA       DIKGGKVDFRVDKNGNLSFLIGKMSFTEQALDENFKAVADEVKRLK-PSTVKGRYVTKAT
RL1_BIFLO       DIKGGKIEFRVDKNGNLSFLIGKMSFDESALDENFKAVADEVKRLK-PSTVKGRYLTKAT
RL1_CORGL       EVKGGKISFRVDKASNLHAAIGKASFDAKKLAENYGALLDEIIRIK-PSSAKGIYVKRVT
RL1_COREF       EVKGGKISFRVDKASNLHAAIGKASFDAKALAENYGALIDELLRIK-PSSSKGIYLKKIT
RL1_CORDI       EVKGGKISFRVDKASNLHAIIGKASFDAEKLAENYGALLDEINRIK-PSSAKGIYVKKVT
RL1_CORJK       EIKGGKISFRVDKAANLHAILGKASFTEKQLAENYGALIDELLRLK-PSSSKGRYFKKVT
RL1_TROWT       DALGGRIEFKTDKHANIHFVIGKTSFSVESLSENLSVALDEINRAR-PQKHKGRYIKKMF
RL1_MYCMS       DIKKRKVEYRADKEGNIHLIIGKVSFEIEKLEENFKAVIDEIRRVK-PQTVKGDYIKNIT
RL1_MESFL       EIKKGKIEFRADKEGNIHTIIGKASFTAEQLKENFTTILNEMKRVK-PQTVKGDYIINIT
RL1_MYCGE       AYKKGKKEYRTDSFGNIHLSLGKTDTKTEHLVANAMALIDLIKSKR-PSTVKGTYIKNIA
RL1_MYCPN       AYKKGKKEYRADSFGNIHMSLGRVDSASNHLVENALALLDLIKSRK-PATVKGIYIKNIA
RL1_MYCGA       EYRKGKKEYRTDTFGNIHMTVGKQSTDTNKIVENANALIDLIKSRR-PSAVKGVYIQNIS
RL1_UREPA       EFKRGRIEYRTDTYGNIHMSIGRVSFETTKIEENANALLNLIKSKK-PATVKGQYIQNIA
RL1_MYCHJ       EIKKGKANYRADRYGIIHSLIGKTNMEVPQLVENANTLLRLIKRLK-PNTVKGNYFKNLT
RL1_MYCPU       EIKKGKANYRADKYGIVHSLIGKKSMSDDQLLDNAKVLIDTIKRLK-PSVVKGTYIKNLT
RL1_MYCS5       ELKKGKANYRTDKAGVVHSLIGKVSMPTESLVENAQTLISLIKKLK-PAAVKGTYMQNLT
RL1_MYCMO       EIKKGKANYRADKGGIINSSIGKVSMGTTSLVENAKVLIDTIRKLK-PATVKGIYMQNLT
RL1_ONYPE       EIKNGKIEYRLDKSGNIHAILGKVSFDETKLLENLKTLYLQLMAVK-PRTVKGTYIKSVT
RL1_BACCR       EIKAGKVEYRVDKAGNIHVPIGKVSFEDAKLVENFKTIADTLQKVK-PAAAKGTYMKNVT
RL1_BACSU       EIKAGKVEYRVDKAGNIHVPIGKVSFEDEKLVENFTTMYDTILKAK-PAAAKGVYVKNVA
RL1_GEOKA       EIKAGKVEYRVDKAGNIHVPIGKVSFDNEKLAENFAAVYEAILKAK-PAAAKGTYVKNVT
RL1_BACSK       EIKAGKVEYRVDKSGNIHVPIGKVSFDTPKLLENFQTIVETLHKVK-PAAAKGTYVKNIA
RL1_BACHD       DIKAGKVEYRVDKAGNIHVPIGKVSFDTAKLAENFETIIDTLVKAK-PAAAKGTYLKNIA
RL1_OCEIH       DIKAGKVEYRVDKSANIHVPIGKISFDDQKLVDNFVALTEQLVKVK-PQSSKGIYMKNAS
RL1_LISMO       EIKAGKVEYRVDKAGNVHAAIGKVSFDAAKLVENFRTVNDVLQKAK-PAAAKGTYVKNLS
RL1_ENTFA       EVKAGKVTYRVDKAGNIHVPIGKVSFDNEKLVENFNTINDVLLKAK-PSTAKGQYIKNIS
RL1_STAEQ       EIKAGKVEYRAEKAGIVHASIGKVSFDEEKLVDNFRTLQDVLAKAK-PASAKGTYFKSVA
RL1_STAS1       EIKAGKVEYRAEKSGIVHASIGKTSFDTDKLVENFKTLQDVLTKAK-PASAKGTYFKSVA
RL1_STRMU       ESKGGKITYRADKAGNVQTIIGKVSFDADKLVENFKAFNDVIAKAK-PATAKGTYITNLV
RL1_STRS2       ESKGGKITYRADKAGIVQALIGKVSFDADKLVENFKAFHDVMAKAK-PATAKGTYMTSVS
RL1_LACLA       ESKAGKVNYRADKAGNVHVPIGKVSFDTEKLVENFKALNSVIAAAK-PAASKGAYITNLS
RL1_LACBA       DAKNGQVTYRTDRDGNVAVPFGKVSFDADKLAGNLKSIAETIVRIR-PAAVRGTYVQHVS
RL1_LEUMM       DAKGGQVTYRTDRDGNVAVPVGRVSFEEGKLAENIKSIAETVLKAR-PAAVKGTYVQHVS
RL1_PEDPA       DSKSGKVTYRTDRDGNVHVPIGKVSFDVDQLLGNLQTINDTIVRLR-PASVKGAYVQNVS
RL1_LACPL       DSKAGKVTYRTDRDGNVHVPVGKVSFDTDKLVGNFKTIEDTIVKAR-PASVRGTFIQNLV
RL1_LACS1       DAKSGQVTYRTDRDGNVHVPLGKVSFTEEALEGNFKAVYDVIAKAR-PASVKGVYIKHVS
RL1_OENOB       DAKGGQVTYRTDKNGNVAVPVGKVSFDSDKLAENIKSVSSTILGAR-PSTVKGTYVLSAH
RL1_LACP3       DIKAGQVAYRVDKAGIIHAPIGKKSFDADKLLENFKAMNDIVLKAR-PASTKGIYIKSLA
RL1_LACSS       DIKAGQVAYRVDKAGIVHAPIGKVSFDAAKLVENFKAMQDVIIKAR-PASAKGQYITSLS
RL1_LACDB       NVKAGQVEYRVDRQASIHTAIGKVSFTEEQLTENFRALQNAILRAK-PASAKGQYIKSCA
RL1_LACAC       NVKAGQVEYRVDRQAAIHTPIGKVSFTEDQLVENFDALRDVILRAR-PASAKGQYIKSVA
RL1_LACJO       NQKAGQVEYRVDKQGLIHAPIGKASFDAEKLAQNFDALRDVILRAR-PASTKGQYVKSVA
RL1_BACV8       EVKQGKIDFKVDKSGIVHTSIGKVSFTADQIRDNAKEFIATIIKLK-PSSAKGTYIKSIY
RL1_PARD8       EVKQGKIDFKVDKSGIVHTSVGKVSFTPEQIRDNAKEFISTLIKLK-PTAAKGAYIKSIY
RL1_PORGI       EVKAGKIDFKVDKTGIVHTSIGKVSFSADQIRDNAREFINTIIKLK-PTTAKGTYIKSIY
RL1_FLAPJ       EIKAGKIDFKVDKTGIVHAGIGRISFDADKIMENAHEIIQTLIKLK-PTAAKGTYIKSIH
RL1_GRAFK       DVKAGKIDFKVDKHGIVHAGVGKASFDAEKIAGNARELLTTLVKLK-PQAAKGVYIKTIY
RL1_CYTH3       DVKAGKIDFKVDKFGIVHTSVGKVSFSPEMILENANEVLQVLAKLK-PASAKGTYVRSIT
RL1_CHLPD       EVKAGKIEFRVDKAGNVHAPVGKVSFQSEQLVENITSFLKEVVRLK-PSAAKGQYVQGIA
RL1_PELLD       EVKAGKIEFRVDKAGNVHAPVGKASFPADQLVTNITSFLKEVMRLK-PSAAKGQYVQGIA
RL1_CHLCH       EVKAGKIEFRVDKAGNIHAPVGKVSFDSEHLNTNIVAFLKEVVRLK-PSAAKGQYVQGIA
RL1_CHLTE       EVKAGKIEFRVDKAGNIHAPVGKVSFDSANLAGNITSFIKEVVRLK-PSAAKGQYLQGIT
RL1_ANADE       EQKAGKVEFRVEKAGIVHVPFGKASFDPEKLKANFSAIMEVIYKAK-PQTAKGVYVKNVT
RL1_MYXXD       DAKGGKVDFRAEKAGIVHAKLGKSSFEVEKLEANFNALVDLVMKLK-PAAAKGVYLQGIA
RL1_BARQU       ASKGGAVEFRVEKAGIVHAGIGKASFGVEKIVENIKAFASAVIKAR-PQGAKGEYIKRVA
RL1_BARBK       ASKGGAVEFRVEKAGIVHAGVGKASFGAEQLIENIKTFVSAVIKAK-PQGAKSEYIKRVA
RL1_RHIL3       ASKGGAVEFRVEKAGIVHAGIGKASFDAKALEENIRAFADAVIKAK-PAGAKGNYVKRVA
RL1_AGRFC       ASKGGAVEFRVEKAGIVHAGIGKASFDAKALEENIKAFADAVIKAK-PTGAKGNYVKRVA
RL1_RHIME       ASKGGAVEFRVEKAGIVHAGIGKASFDAKALEENIRAFADAVIKAK-PTGAKGNYVKRVA
RL1_BRUME       ASKGGAVEFRVEKAGIIHAGIGKVSFDNAKLEENIKAFADAVIKAK-PSAAKGEYVKRVS
RL1_CHESB       ASKGGAVEFRVEKAGIVHAGVGKVSFDENAIAENVRAFADAVIKAK-PSGAKGNYLKRVS
RL1_RHILO       ASKGGAVEFRVEKAGIVHAGVGKVSFDVKALEENIRAFADAVTKAK-PAGAKGNYVKKVS
RL1_BRADU       GAKGGSVEFRVEKAGILQAGVGKASFSEEKLVENIKALADAVSKAK-PAGSKGTYIQRVA
RL1_NITWN       GAKGGSVEFRVEKAGIVQAGIGKASFSAEKLVENVKALADAVAKAK-PAGAKGTYVQRIA
RL1_RHOPA       GAKGGSVEFRVEKAGIIQAGVGKASFDADKLVENIKALADAVNKAK-PSGAKGTYIQRVA
RL1_MARMM       DSKGGAVEFRVEKAGIIHAGVGKASFTEAALAENVRALVDAIVKAK-PSGAKGLYVRRIA
RL1_GRABC       AAKSGQIEFRAEKAGIIHAGIGKASFDADKLVENIRALVDAIQKAK-PTGAKGTYLQKAA
RL1_GLUOX       AAKSGQVEYRAEKAGIIHAGVGKASFDEAKLVENINALVDAVQKAR-PTGAKGTYLKKAA
RL1_ROSDO       AAKGGEVQFKAEKGGVVHAGVGKLSFDEAKLVENIRAFVGAVSKAK-PTGAKGAYMKKIA
RL1_RUEST       AAKGGEVQFKAEKGGVVHAGVGKASFDEAKLVENVRAFVSAVAKAK-PSGAKGAYMKKIV
RL1_JANSC       AAKGGQVQFKAEKAGVVHAGVGKASFTEAQLVENVRAFVDAVSKAK-PSGSKGTYMQKIN
RL1_RHOS4       AAKGGEVQFKVEKAGVIHAGVGKMSFEADKLAQNVRAFVDAVNRAK-PAGAKGTYLKKVS
RL1_RUEPO       NAKGGEVQFKVEKAGVIHAGVGKVSFDEAKLVENVRAFVDAVAKAK-PAGAKGTYLKKIA
RL1_PARDP       AAKGGEVQFKAEKAGVVHAGVGKASFEIEKLAENIRAFVDAVNRAK-PSGAKGTYVKKVS
RL1_MAGSA       AAKAGQVQFRVEKAGIVHAGIGKASFSEEKLAENVKAFVDAITKAK-PQGAKGTYLKKVS
RL1_RHORT       AAKAGQVQFRVEKSGIVHAGVGRASFTEEKLVDNVRAFVDAINKAK-PTGAKGTYLKKVS
RL1_HYPNA       DAKGGAVEFKVEKAGIVHAGVGKASFSDADIEKNVQAFISAVVKAR-PSGAKGTFVRKVT
RL1_CAUVC       DAKGGAVEFRVEKAGIVHAGIGKASFTDEALAINVKALIEALNRSK-PSGAKGVFIKRVG
RL1_NOVAD       AAKGGQIEFRVEKAGIIHGGIGKLSFSDEALRANFDAFVDAIVKAK-PAGAKGKYLRKVG
RL1_SPHAL       AAKGGQIEFRVEKVGIIHAGLGKLSFGEEKLRQNFDAFVDAIVKAK-PAGAKGKYVRKVA
RL1_ERYLH       DAKGGQVEFRVEKMGIIHSGIGKMSFKDEDLKANFKSFTDAIVKAK-PSGAKGKYVKKVS
RL1_ZYMMO       AAKGGQVEYRVDRTGIIHSGIGKASFSAEDIRANFDALIDALLKAK-PAGAKGRYVKKVA
RL1_MAGMM       EIKAGQVAFRVEKSGIIHAGVGKASFPVEDLVENITALVEQLRRMK-PAAAKGTYMKKVS
RL1_GEOSL       ESKAGKVEFRVEKAGIVHAPVGKVSFDADKLKENLLALVEALLKAK-PSAAKGTYVKKIS
RL1_PELPD       ESKAGKVEFRVEKAGIVHAPVGKVSFDADSLKGNLLALVEALVKAK-PSAAKGIYIKKIS
RL1_PELCD       EAKSGKVEYRVEKAGIVHAPVGKVSFDAEKLQENLVALFDALVKAK-PATAKGTYFKKMS
RL1_DESVH       EMKAGRVEFKVDKAGVLHAPLGKVSFGSEKILGNLKALIDTVNRLK-PSSAKGTYMQAMA
RL1_LAWIP       ELKAGRIDFKVDKAGVLHAPLGKVSFGSEKILGNLKSLVETVNRLK-PSSAKGTYIKSMA
RL1_DESAG       EVKAGRVEFKVDKAGVLHAPLGKVSFGPQKIAENLKALLDTVQRLK-PSSAKGTYMKTMS
RL1_SYNFM       EIKAGKVDFRVEKTGIVHAPMGKVSFGQEKLIQNISAFIDTLIRLK-PTAAKGTYVRGIA
RL1_SYNAS       EVKAGKVEFRVEKAGIVHSPVGKVSFGPDRLMENIQALIEMIIKLK-PATSKGTYIKGIA
RL1_DESPS       EIKSGKVDFKVEKAGILHAGIGKISFGNEKLTANALAFIEKIIQLK-PSSSKGVYLKSVT
RL1_BDEBA       AEKKGKLDFRVDKAGIVHAGIGKKSMGDAKLKDNFMTLLGAIVKAK-PASSKGIYLRSIA
RL1_CAMJJ       NAKSGQVNFRVDKQGNIHAGLGKVSFSKEQLWDNVSTFVKAINKHK-PAAAKGRYIKNAA
RL1_CAMFF       NAKGGQVNFRVDKQGNIHAGLGKVSFSKDQLNDNISAFIKMINKHK-PAASKGRYIKSAA
RL1_NITSB       NAKAGQVNFRVDKKGNIHAGIGKASFSEEALKENLETFVAQINKLK-PAAAKGRYIQHAA
RL1_SULNB       NAKGGQVNFRVDKKGNIHAGIGKISFDADKIKENFVTLLEKINRAK-PASAKGRYITNAA
RL1_SULDN       NVKGGQVNFRVDKKGNIHAGIGKASFNADKISENLITFVKAINRHK-PSSAKGRYIKNCA
RL1_HELAH       NAKSGQVNFKVDKKGNIHAPIGKVSFPEEKIKENMLELVKTINRLK-PNSAKGKYIRNAA
RL1_HELHP       NAKSGQVNFRVDKKGIIHAPIGKASFNEEKILDNMLELVRAINRLK-PTSAKGKYIRSSS
RL1_WOLSU       NVKSGQVNFRVDKKGNIHAPVGKASFDAEKIKENVLELVKMINRLK-PATAKGKYIRHAA
RL1_ACISJ       NAKAGQVQFRVDKAGIVHSTIGRRSFDNDKLQGNLAALIEALNKAK-PATSKGVYLRKVA
RL1_VEREI       NAKAGQVQFRANKAGIVHSTIGRRSFDDAKLQGNLAALIDALNKTK-PASSKGQYLRKLA
RL1_RHOFT       NAKAGQVQFRVDKAGIVHSTIGRRSFDTDKLQGNLAALVDALTKAK-PATSKGVYLKKVA
RL1_POLSJ       NAKAGQVQFRVDKAGIVHGTIGRRSFDTAKLQGNLAALIDALQKAK-PASSKGVYLKKVA
RL1_METPP       NAKAGQVQFRVDKAGIIHTTLGRRSFDGDKLKGNLQALIEALNKAK-PATSKGIYLRKVA
RL1_AZOSB       NAKAGQVQYRTDKGGLVHATIGRASFGVEALQQNLNAFIEALVKAR-PAAAKGVYLRRVA
RL1_AROAE       NAKAGQVQYRTDKGGIIHATIGRASFSTEALQQNLGALVDALVKAK-PAASKGIYLRRVA
RL1_PARXL       NAKAGQVQFRVDKAGIIHATIGRASFEPTALRSNLNALVDALQKAK-PATSKGVYLRKVA
RL1_RALSO       NAKAGQVQFRVDKAGIIHATIGRRSFEPAALKSNLAALLDALSKAK-PASSKGVYLRKIA
RL1_HERAR       NAKAGQVQYRTDKAGIIHATIGRKSFTDEALKSNLLALIDALTKAK-PATSKGVYLRKVS
RL1_BORA1       NAKAGQVQYRTDKAGIIHATIGRASFGIEQLQTNLAALVDALQKAR-PAAAKGIYLRKIA
RL1_DECAR       NAKAGQVQYRTDKAGIIHATIGRASFSVESLESNLKALIDALAKAK-PASSKGQYLKKIA
RL1_NEIG1       NAKAGQVQYRTDKAGIVHATIGRASFAEADLKENFDALLDAIVKAK-PAAAKGQYLKKVA
RL1_CHRVO       NAKAGQVQYRTDKAGIIHATIGRASFEAEALRENFSALVDALVKAK-PAASKGVYLKKIA
RL1_METFK       NAKAGQVQYRTDKGGIVHCTIGRASFEVDALKENLAALVDALNKAK-PASSKGVYLKKVS
RL1_THIDA       NAKAGQVQYRTDKGGIVHCTIGRASFSVDDLKENLVALLDALQRAK-PASSKGIYFKRLS
RL1_NITEC       NAKAGQIQFRADKAGIVHCTVGRASFSVDALRENIIALVDALNKSK-PATSKGVYLRKMA
RL1_NITEU       NAKAGQVQFRADKAGIVHCTVGRASFDVEALRANIMALVDALNKSK-PTTSKGVYLRKMA
RL1_NITMU       NAKAGQVQYRADKGGIVQCTIGRASFTVDALTQNMMALIDALNKSK-PAASKGIYLRKIS
RL1_ACIAD       NAKAGQARYRVDKAGIIHAAIGQVGFTAEAIRQNVETLVADLKKLK-PATSKGVYIKKIT
RL1_PSYA2       NAKAGQAQYRVDKAGIIHTTIGQVGFTAEQVIQNAEALISDLRRAK-PATSKGTFIKKIT
RL1_HAHCH       NAKAGQIRYRTDKNGIIHAPLGNVEFSAEHIKQNLEALIADLKKIK-PSSAKGVYLKKVT
RL1_MARHV       NAKAGQVRYRTDKNGIIHAPLGNVEFSAQNIKENLEALVADLKKAK-PASSKGVYLKKIT
RL1_PSEAE       NAKAGQVRFRTDKNGIIHSSVGKVDFEPAKLQQNVEALLADLKRLK-PSSSKGVYVKRVT
RL1_PSEU5       NAKAGQVRFRTDKNGIIHTSVGKVGFDAAALKQNVEALLSDLKRLK-PSTSKGIYVKRVT
RL1_PSEF5       NAKAGQVRYRTDKNGIIHTSVGKVGFDAVKLKENVEALIADLKRIK-PASSKGIYVKRVT
RL1_ALCBS       NAKGGQVRYRTDKGGIIHCTVGQVGFDTNAIKENVEALIADLKKAK-PSSAKGTFFKKVT
RL1_CHRSD       NAKAGQVRFRTDKNGIIHAAIGKVDFDASAIKGNLDALVGDLKRLK-PSTSKGVYFKKIT
RL1_MANSM       NAKSGQVRYRNDKNGIIHTTIGKASFSAEALTQNLQALLAALVKAK-PTTAKGIFIKKVS
RL1_HAES1       NAKSGQIRYRNDKNGIIHTTIGKANFSAEQLKENLQALLAALTKAK-PATAKGIFIRKVS
RL1_PASMU       NAKSGQVRYRNDKNGIIHTTIGKVNFSEEQLKENLQALLAALAKAK-PTTSKGVFIKKVS
RL1_AERS4       NAKAGQVRYRNDKNGIIHTTLGKVSFDEVQLKENLESLLVALKKAK-PSSAKGIFIKKVS
RL1_VIBCH       NAKAGQVRYRNDKNGIIHTTIGKVTFEADQLKENLEALLVALKKAK-PSSAKGVFVKKVS
RL1_ECOLI       NAKAGQVRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAK-PTQAKGVYIKKVS
RL1_PSEHT       NAKAGQVRYRNDKNGIIHTTIGKVDFTAEQLQQNLESLIVALKKAK-PSQAKGVYVKKVS
RL1_SHEAM       NAKAGQVRYRNDKNGIIHTTIGKVDFDSVKLKENLEALLVALKKQK-PAAAKGQYVKKVS
RL1_SHELP       NAKAGQVRYRNDKNGIIHTTIGKVDFEPVQLKENLDALLGALIKAK-PAAAKGVFVKKVS
RL1_SHEFN       NAKAGQVRYRNDKNGIIHTTIGKVTFTTEQLKENLESLVSALKKAK-PAVAKGIYVKKIS
RL1_PHOPR       NAKAGQVRYRNDKNGIIHTTIGKVDFDAAQLKENLESLLVALKKSK-PSSAKGIFIKKIS
RL1_PSEA6       NAKAGQVRYRNDKNGIIHASIGKIAFESNQIEENLAALIEAVKKAK-PSSAKGVYIKKIS
RL1_IDILO       NAKAGQVRYRNDKNGIVHATIGRVDFDNDKLKENLEALLAALKKAK-PSSAKGVFVKRIS
RL1_COLP3       NAKSGQIRYRNDKNGIIHTTIGKADFEPAQLQENLESLLEALKKAK-PANAKGQYLKKVS
RL1_PSYIN       NAKAGQIRYRNDKNGIIHSTIGKVTFTPVQIRENLEALLAALIKGK-PSGAKGQFLKRIS
RL1_METCA       NAKAGQVRYRTDKKGIIHCTIGKISFDSAALKENLEALLADLKKLK-PSTAKGVYVKKIT
RL1_ALKEH       NAKAGQVRYRTDKGGIIHCAIGKVDFEVEALQQNLQALITDLQKLK-PANSKGVYLKKVA
RL1_NITOC       KAKAGQVRYRTDKAGIIHCSIGKTSFEVDALKQNLRALVEDLGKLK-PASAKGIYLKKLT
RL1_FRATW       DAKAGQVRYRVDKAGIIHTTIGKVNFTSDALKQNLERLLTDLKKAK-PAVSKGIYLKKVS
RL1_SACD2       NAKAGQVRYRADKGGIIHGGIGKISFDANAIKENLEALISDLKKAK-PASAKGIYVKRVS
RL1_HYDCU       NAKSGQVRFRADKAGIVHASIGKVDFAPEKLKENLNALIEDLNKAK-PAAAKGTYMKKVS
RL1_DICNV       NAKAGQVRFRADKSGIVHAMIGKIDFDAEKLLENLHALIAEINKLR-PTTIKGVYMQKAY
RL1_LEGPH       DAKSGQVRYRTDKNGIIHCTVGKADFAPEDVLENVVALINDLKKAK-PASSKGQYLKKIS
RL1_XANC8       NAKSGQVRYRTDKAGIIHCTIGKASFDDEALKSNLQALLLDLVKAK-PATSKGTYLQKVS
RL1_XYLFT       NAKSGQVRYRADKAGIIHCVIGKVNFDDEALKLNLQALLVDLIKIK-PTASKGTYLQKVS
RL1_HALHL       NAKAGQVRYRTDRGGVIHSAIGRANFDEQALRENLDALLADLNKLK-PSTSKGVYIKGIT
RL1_COXBU       NAKQGQVRYRTDKNGIIHCTIGKVNFEEKALEENFLALLNDIKKAK-PSAAKGTYLKKLT
RL1_RUTMC       NAKTGQVRYRADKAGIVHACVGRVSFNVSALTQNINVLMEALKKIK-PSSAKGVYFKKLS
RL1_VESOH       NAKSGQLRYRADKAGIIHGCVGKVSFNISALAQNINVLIGELKKVK-PSSAKGVYFKKLS
RL1_RICTY       NAKSGQVEYRAEKAGIIHAGLGKLSFSDQDLLKNLNAFIGAVIKAK-PVGLKGSYLKAIY
RL1_RICBR       NAKSGQVEYRAEKAGIIHAGLGKLSFPDQDLLKNLKAFIDAVVKAK-PTGVKGSYLKAIY
RL1_ORITB       KVKSGQVEFKVDKAGNIHAGIGKISFSIDEIEANINALVSAIIKSK-PSEAKGTYLNGIY
RL1_PELUB       NAKSGQAEIRNDKDGNIGVSIGKKSFHDDQLLKNFHAILDTLEKEKGNLTLKGDLIKNTF
RL1_ANAMM       IIKSGQVKFKSDRYGIVHVKIGDIGFTPEDLLENFNAVVAAVQGLR-PTTIKGSYVRGVF
RL1_ANAPZ       IVKSGQVRFRSDKYGIVHVKIGDVGFSREDLMENLRAVVSAVQGLK-PATVKGAFFKAVF
RL1_EHRCR       MIKSGQIKFKSDKTGIVHAKIGNIKFSIEDLLENFNAVISAVKQCK-PASIKGLYFKDVF
RL1_EHRRW       VIKSGQIRFKSDKAGIVHAKIGNVKFSIEDLLQNFNAVIGAIKQSK-PASVKGVYFKDVF
RL1_WOLPM       TIKSGQVKFGTDKNGVIHGKLGNIKFDIDDLLENLKAFLKVIKDNK-PISAKGIYFKGVF
RL1_WOLTR       TIKSGQIKFRTDKNGIIHGKLGNIKFSVDDLLKNLKAFLKVIKSNK-PISVKGVYFKSVF
                           :        ..        :  *           :      .       

RL1_BUCAI       LSTTMGVGLMVDQSTLSL----------
RL1_BUCAP       LSSTMGIGLTLDQSSLSI----------
RL1_BUCBP       ISTTMSSGIKIDLNTLNNAS--------
RL1_BAUCH       LSTTMGPSLTIDQCSLSTLVK-------
RL1_BLOFL       ISTTMGRSILIDKSSLNVLIH-------
RL1_BLOPB       ISTTMGRSISIDRNSLCVVIN-------
RL1_BUCCC       ISTTMGPGIIIDHLSL------------
RL1_WIGBR       LSTTMGGSVIINHNEFLQENNISDNIKK
RL1_DEHMC       LATTMGPGVRLDLRAVSAMGGV------
RL1_RHOBA       ICATMTPSVRVAT---------------
RL1_TREDE       ISSTMGPGVWVDYKVGE-----------
RL1_TREPA       LSSSMGPGIWVVHKSEE-----------
RL1_BORBU       ISSTMGPSIKVNFVWR------------
RL1_LEPIC       ISPTMGVGVKVDVKELVNTSI-------
RL1_CHLFF       VSSTMGPGISVDTRE--LMAS-------
RL1_CHLPN       ISSTMGPGISIDTRE--LMAS-------
RL1_CHLMU       ISSTMGPGVTVDTRE--LIAL-------
RL1_PARUW       ISSTMGPGLKIDLRESDLAAKES-----
RL1_DEIGD       LTSTMGPSIPLTLSAQAQA---------
RL1_DEIRA       LTTTMGPSIPLALGGAALA---------
RL1_THET8       VTTTMGPSVRINPHS-------------
RL1_PROMP       LTSTMGPSVQVDINALQDYQPES-----
RL1_PROMT       ITSTMGPSVEVDINELQDLQKEK-----
RL1_SYNS3       VTSTMGPSVEVDIALLQDIEQEG-----
RL1_SYNS9       VTSTMGPSVEVDFSALQEIGQEG-----
RL1_SYNPW       VTSTMGPSVEVDIAALQDINKDG-----
RL1_PROMM       ITSTMGPSVEVDVTALQDLEEDA-----
RL1_PROMA       ITSTMGPSVEIDIAALQDSKEE------
RL1_SYNR3       ITSTMGPSVEVDFSALQDLSNAE-----
RL1_TRIV2       VSATMGPSIRVDINALRDYKLTEAA---
RL1_THEEB       VAATMGPSIQVDINALRELKLAEAA---
RL1_SYNP6       ISATMGPAIEVDINALRDPKLAEA----
RL1_TRIEI       VSATMGPSIEIDVSSLQDLKLTEAA---
RL1_SYNJA       VCATMGPSIEVDINALRELKLVA-----
RK1_CYAPA       ITSTMSPSIEVDYNLLRDLKLTENT---
RL1_SYNY3       VSSSMGPSIPVDINALRDLKFEDN----
RL1_GLOVI       IKSTMGPSIEIDINALRDLKLEGAA---
RK1_RHDSA       ICSTMGPSIQLDISEFRDKVFS------
RK1_GUITH       ICSTMGPSIQLDISEFRDKNFQ------
RK1_PORPU       LSSTMGPSIQIDITSLL-----------
RK1_PYRYE       LSSTMGPSIQIDITSLL-----------
RK1_GRATL       INSTMGPSIPLDIQLLRNNYVL------
RK1_CYAM1       IATSMSPSIRLNIQQWS-----------
RK1_CYACA       LCTTMSPAIKIDFNKLQELEKNYGQN--
RK1_TRICV       ICTTMGPSIQLDLNIFL-----------
RK1_THAPS       ICTSMGPSIQLDLNTFD-----------
RK1_PHATC       ICTTMGPSVKLDLEIFA-----------
RL1_KORVE       LSSTMGPGISIDTTAIEAASKS------
RL1_SOLUE       VCSTMGPGVAIDTAPFSVKAAAV-----
RL1_AQUAE       VSLTMSPSVKLDINEVLKKLQEKAA---
RL1_RUBXD       FTTTMGPSVKVD-PSVERE---------
RL1_SALRD       LSATMGPPVRVDRSSVLSEAR-------
RL1_CLOBL       ISSTMGPGIKINPGKVLE----------
RL1_CLONN       ISSTMGPGVKINPAKVLA----------
RL1_CLOAB       LSSTMGPGIKINPVKVLD----------
RL1_CLOPS       VSATMGPGAKVNPAKVLD----------
RL1_CLOTE       VSSTMGPGVKINPSKVLD----------
RL1_HUNT2       VTSTMGPGIKVNPLRVSE----------
RL1_CLOD6       VASSMGPGVKINPARTAE----------
RL1_CALS4       LSSTMGPGVKVNPARIFE----------
RL1_CALS8       VATTMGPGIKVNPLKPL-----------
RL1_DESHY       VSSTMGPGVRINPVKAN-----------
RL1_CARHZ       VSSTMGPGIKINHLKLVK----------
RL1_SYNWW       VCSTMSPGVKINPLVLMAANK-------
RL1_MOOTA       LATTMGPGIRVNPLRAVK----------
RL1_SYMTH       ISATMGPGIKVNPARLTATAEK------
RL1_THEMA       LASTMGPGIKLNLQSLLKE---------
RL1_FUSNN       VSLTMGPGVKMDPAIVGKIVG-------
RL1_ACIC1       ISTTMGPGIPVDPNRVRNLLAEETAAA-
RL1_THEFY       LTTTMGPGIPVDPNATR----EAAKAA-
RL1_MYCUA       VSTTTGPGIPVDPSVTRNFTEA------
RL1_MYCLE       VSTTMGPGIPVDPSITRNFTEE------
RL1_MYCSS       VSTTTGPGIPVDPQVTRNFAEA------
RL1_NOCFA       VSTNTGPGIPVDPNRTRNLLDEDA----
RL1_SACEN       FTTTMGPGIPVDPNRTRNLLEPAQV---
RL1_FRACC       FTTTMGPGIPVDPNRTRNLLDEGAAA--
RL1_NOCSJ       VSTTMGPGIQVDPNRTRNVALEDENAQP
RL1_CUTAK       VSSTMGPGVQIDPVAARDAD--------
RL1_ARTS2       VATTFGPGISVDPNVTKVLTEV------
RL1_STRCO       LSTTMGPGIPLDSNRTRNLLVEEDPAAV
RL1_CLAM3       VSTTFGPGIPVDVNSI------------
RL1_LEIXX       VSTTFGPGIPLDVNAI------------
RL1_BIFAA       ITSTMNPGVPVDPAVVA-----------
RL1_BIFLO       ITSTMNPGVPVDPNTLA-----------
RL1_CORGL       LSSTTGPGVEVDTHVTKNYAEEA-----
RL1_COREF       MSSTTGPGVAVDTHITKNYTAEA-----
RL1_CORDI       LTSTFGPGVPVDPSIQKNYTQA------
RL1_CORJK       MSSTNGPGVPVDNTIVKDFTEEA-----
RL1_TROWT       FSSTFGPSVRVALA--------------
RL1_MYCMS       LSTTMGPGIKVQF---------------
RL1_MESFL       ISTTMGPGIKVEIN--------------
RL1_MYCGE       LTTTMGPSLKVKLPD-------------
RL1_MYCPN       LTTTMGPSLKVKLPD-------------
RL1_MYCGA       VSSTMGPGVKVKIN--------------
RL1_UREPA       VSPTMGPGIKVVINNN------------
RL1_MYCHJ       VSASMGPSIKIRFDNL------------
RL1_MYCPU       ISSSMGPSIKIKLD--------------
RL1_MYCS5       VSSSMGPGIKIKLEK-------------
RL1_MYCMO       ISTTMGPSFKIKIEN-------------
RL1_ONYPE       ISTTMAPGIKIDPVTISQ----------
RL1_BACCR       VASTMGPGVRVDVSTLA-----------
RL1_BACSU       VTSTMGPGVKVDSSTFNVK---------
RL1_GEOKA       ITSTMGPGIKVDPSTVAVAQ--------
RL1_BACSK       VASTMGPGIRVTTTAFAK----------
RL1_BACHD       VSSTMGPGVKVSTASFGK----------
RL1_OCEIH       ITSTMGPGIKVDVSNFR-----------
RL1_LISMO       VTTTFGPGIKVDPASL------------
RL1_ENTFA       VTTTFGPGIHVDQASF------------
RL1_STAEQ       VTTTMGPGVKVDTSSFKL----------
RL1_STAS1       VTTTMGPGVKVDTSSFKL----------
RL1_STRMU       LTTTQGPGIKVDANSF------------
RL1_STRS2       ITTTQGVGIKVDPNSL------------
RL1_LACLA       VTTTMGPGVKVDSASF------------
RL1_LACBA       ISSTFGPSVDVDLASLLA----------
RL1_LEUMM       ISSTFGPAVTLDINTL------------
RL1_PEDPA       VASTFGPGVKVDFSQF------------
RL1_LACPL       VTSTFTPAVRVDLASF------------
RL1_LACS1       VASTFGPSVTLDTTAL------------
RL1_OENOB       LASTMGPGVELDVSSL------------
RL1_LACP3       LTATMAPGIKVNPSDF------------
RL1_LACSS       VSSTFGPGVKVDVASF------------
RL1_LACDB       VAATFGPGIKLDPIALMA----------
RL1_LACAC       VSATFGPGIKLDPLNLD-----------
RL1_LACJO       VSATFGPGIHLDPLNLD-----------
RL1_BACV8       LSSTMSKGIKIDPKTVEEN---------
RL1_PARD8       LSSTMSAGIKIDPKSVEEN---------
RL1_PORGI       LSSTMSFGIKVDPKTVDEN---------
RL1_FLAPJ       LTSTMSPAIALDPKAV------------
RL1_GRAFK       MSSTMSPSVQIDTKRFTEQ---------
RL1_CYTH3       LSSTMSPGITIDKSSVAGL---------
RL1_CHLPD       LSSTMSPSVKVKREKFVA----------
RL1_PELLD       VSSTMSPGVRIKREKFVA----------
RL1_CHLCH       LSSTMSPSVKVKMDKFIS----------
RL1_CHLTE       ISSTMSPGVKVKKDKFVA----------
RL1_ANADE       LSTTMGPGIKLDLAELAAQHA-------
RL1_MYXXD       ISSSMGPGIKLDTMEIKTRHG-------
RL1_BARQU       VSSTMGIGIKVDPATVCSE---------
RL1_BARBK       VSSTMGIGIKVDLVTIRSE---------
RL1_RHIL3       ISSTMGPGVKIEPGSVTGAPAA------
RL1_AGRFC       ISSTMGPGVKIEPSSVTA----------
RL1_RHIME       VSSTMGPGLKVDPATISAA---------
RL1_BRUME       ISSTMGVGVKVDPSTVKVVD--------
RL1_CHESB       ITSTMGPGLKIDPSTLAAS---------
RL1_RHILO       VTSTMGPGLKLDVSTLAAS---------
RL1_BRADU       VSSTMGPGVKVEPGTILG----------
RL1_NITWN       VSSTMGPGVKVEPGTVLG----------
RL1_RHOPA       VSSTMGPGVKVEPGTVH-----------
RL1_MARMM       LSSTMGPGVKIDTSAAVSA---------
RL1_GRABC       LSSSMGPGMRLDVSSLTV----------
RL1_GLUOX       LSSTMGPGVRVDVASFEA----------
RL1_ROSDO       LSSTMGPGVSVAIEDANVE---------
RL1_RUEST       LSSTMGPGVTLDVDGAVSE---------
RL1_JANSC       LTSTMGPGVSLSVENATGN---------
RL1_RHOS4       LSSTMGPGVSVDLTSATSH---------
RL1_RUEPO       LSSTMGPGVSVDVASASGN---------
RL1_PARDP       ISSTMGPGVSLDLGSTAAAQ--------
RL1_MAGSA       LSSTMGPGVKLDVATLA-----------
RL1_RHORT       LSSTMGPGLKVNLGTISGAA--------
RL1_HYPNA       LSSTMGTGVAIDLAEAKS----------
RL1_CAUVC       LSSTMGPGFKVDISSIGA----------
RL1_NOVAD       LSSSMGPGLKIDLAQVNGG---------
RL1_SPHAL       LSSSMGPGVKVDTAELTGA---------
RL1_ERYLH       LTSSMGPGLKIDLAEVEGA---------
RL1_ZYMMO       ISSTMGPGVSIDIADLPAAA--------
RL1_MAGMM       ISSTMGPGIKVDQSSI------------
RL1_GEOSL       ISSTMGPGLNLDISDVQAKLV-------
RL1_PELPD       MSSTMGPGINLDIADVTSQI--------
RL1_PELCD       LSSTMGPGINVDLPTVQALVK-------
RL1_DESVH       ISTTMGPGVKVDPTLIKKFIEG------
RL1_LAWIP       ISTTMGPGFKIDTNLVKKFLES------
RL1_DESAG       VSTTMGPGFKVDPNDIRRFLEG------
RL1_SYNFM       ISTTMGPGIQIDPLAVKTIVA-------
RL1_SYNAS       LSSTMGPGVRVDPLDLRNL---------
RL1_DESPS       ISSTMGPGVKVDPVYLRALVKK------
RL1_BDEBA       VASTMGPGVKIEPNAAAAATGAN-----
RL1_CAMJJ       LSLTMSPSVKLETQELLDMK--------
RL1_CAMFF       LSLTMSPSITLEPQELMDLK--------
RL1_NITSB       LSLTMSPAVELNTQELMDIKG-------
RL1_SULNB       VSLTMSPSITLDTSEVMEIK--------
RL1_SULDN       LSLTMSPAIKLDVMQLADMK--------
RL1_HELAH       LSLTMSPSVSLDAQELMDIK--------
RL1_HELHP       LSLTMSPAIKLDSQELMDMK--------
RL1_WOLSU       ISLTMSPSLELDAQELMDAR--------
RL1_ACISJ       VSSTMGVGVRVDTQTIAA----------
RL1_VEREI       LSSTMGVGVRVDTQSITV----------
RL1_RHOFT       VSSTMGVGIRVDLQSIAA----------
RL1_POLSJ       VSSTMGVGVRVDTQTIAA----------
RL1_METPP       VSSTMGVGVRVDVASINAAAQG------
RL1_AZOSB       VSSTMGAGVRVEPTTASA----------
RL1_AROAE       LSSTMGSGVRVEPSSINAA---------
RL1_PARXL       LSSTMGVGVRVDQASLAAQ---------
RL1_RALSO       VSSTMGVGVRIDQATLSA----------
RL1_HERAR       LSSTMGAGVRIDQTTLAA----------
RL1_BORA1       VSSTMGGGARVEIASLSA----------
RL1_DECAR       VSATMGPGVRVDQSTVVA----------
RL1_NEIG1       VSSTMGLGVRVDTSSVNN----------
RL1_CHRVO       VSSTMGIGARVDTATVNA----------
RL1_METFK       VSSTMGAGVRVDQSNLA-----------
RL1_THIDA       VSSTMGVGVRVDQGSVAA----------
RL1_NITEC       ISSTMGAGVRVDHAGIIN----------
RL1_NITEU       ISSTMGVGVRVDHTAIV-----------
RL1_NITMU       VSSTMGIGVRVDQTSMR-----------
RL1_ACIAD       LSSTMGPGLTVDVNNVTN----------
RL1_PSYA2       LSSTMGPGLSIDPVPYRTAK--------
RL1_HAHCH       LSSTMGPGLLIDQNSLAV----------
RL1_MARHV       ISSTMGPGLTIDQGTLSI----------
RL1_PSEAE       LSTTMGPGLQIDLASLEA----------
RL1_PSEU5       LSTTMGPGLVIDQASLEA----------
RL1_PSEF5       LSTTMGPGLVIDQGSLDV----------
RL1_ALCBS       LSTTMGPGLSIDPASLVM----------
RL1_CHRSD       LSTTMGPGLTVDHSAYV-----------
RL1_MANSM       ISTTMGAGVAVDQNSL------------
RL1_HAES1       VSTTQGAGVAVDQSSL------------
RL1_PASMU       LSTTMGAGVAIDQASL------------
RL1_AERS4       ISTTMGAGVAVDQASLEAQG--------
RL1_VIBCH       ISTTMGAGVAVDQNTLSAQV--------
RL1_ECOLI       ISTTMGAGVAVDQAGLSASVN-------
RL1_PSEHT       ISTTMGAGVAVDQNTLSTTVA-------
RL1_SHEAM       ISTTMGAGVAVDQNTLEATA--------
RL1_SHELP       ISTTMGAGVAVDQSTLNPTA--------
RL1_SHEFN       ISTTMGAGVAIDQGSLEEAK--------
RL1_PHOPR       ISTTMGAGVSLDQGTLEASI--------
RL1_PSEA6       LSTTMGAGITIDQASLTAAS--------
RL1_IDILO       LSTTMGAGVSIDQATVAAV---------
RL1_COLP3       LSTTMGAGVVVNQATLTQA---------
RL1_PSYIN       LSTTMGAGLKVDTSSVKATVA-------
RL1_METCA       VSSTMGPGLAVDQSTLAA----------
RL1_ALKEH       VSTTMGPGLAVDLASLET----------
RL1_NITOC       LSTTMGPGIAVDQASLPV----------
RL1_FRATW       VSSTMGPGINVDFSDLNI----------
RL1_SACD2       LSTTMGPGLTIDQSSLTA----------
RL1_HYDCU       ISSTMGPGIVLDQSSL------------
RL1_DICNV       ISTTMGPGIAVDVASLTNA---------
RL1_LEGPH       LSTTMGPGLPIDISSIPV----------
RL1_XANC8       VSSTMGPGVTVDQSSLSLK---------
RL1_XYLFT       LSSTMGPGVMIDQSTLSLK---------
RL1_HALHL       VSSTMGAGVRVDRATLGV----------
RL1_COXBU       LSSTMGPGIAIDRTTVGA----------
RL1_RUTMC       ISSTMGPGLSVDLASLDI----------
RL1_VESOH       ISSTMGPGFSVDLASVDI----------
RL1_RICTY       LSSTMGASVQIDLTSI------------
RL1_RICBR       LSSTMGASVQIDLASIA-----------
RL1_ORITB       LSTTMGPSVRLEISNFTESGNERR----
RL1_PELUB       ITSSMGVSYKVKLGKAI-----------
RL1_ANAMM       VNSTMGRSFRIAGTG-------------
RL1_ANAPZ       LNSTMGKSFRITGLG-------------
RL1_EHRCR       IISTMGKSVKVENLNN------------
RL1_EHRRW       IVSTMGKSVKVESLNN------------
RL1_WOLPM       LNSTMGKAYKIGKVEDII----------
RL1_WOLTR       LNSTMGKAYKMSKVEDII----------
                .  .      :