CLUSTAL format seed alignment for MF_01319

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RESA_BACLD      -----------MKKKR-FYIRTGILLVLLAALGYTLYSAVFQNTESVAVGEKAPIFSL--
RESA_BACSU      -----------MKKKRRLFIRTGILLVLICALGYTIYNAVFAGKESISEGSDAPNFVL--
RESA_BACHD      -----------MDKRKRFWMRLSILAVISVALGYTFYSNFFADRSLARAGEQAVNFVL--
RESA_GEOKA      -----------MKKQQRLVMRTAILLVLLAAIGYTIYTNFFTEKTAVAVGSTAPDFVL--
RESA_GEOTN      -----------MKKQQRLVMRTVILLLLLAALGYTIYANFFTEKTAVAVGSTAPDFVL--
RESA_BACC1      -----------MKKNR-LLFRVIILLILSGAVGFTLYQGYFSKEEKMEIGKEAPNFVV--
RESA_BACHK      -----------MKKNR-LLFRVIILLILCGAVGFTLYQGYFTKEEKMEIGKEAPNFVV--
RESA_BACAN      -----------MKKNR-LLFRVIILLILSGAVGFTLYQGFFADKEKMQIGKEAPNFVV--
RESA_BACAH      -----------MKKNR-LLFRVIILLILSGAVGFTLYQGFFADKEKMQIGKEAPNFVV--
RESA_BACCR      -----------MKKNR-LLFRVIILLILCGAVGFTLYQGFFANKEKMQIGKEAPNFIV--
RESA_BACCZ      -----------MKKNR-LLFRVIILLILCGAVGFTLYQGFFADKEKMQIGKEAPNFVV--
RESA_OCEIH      MDIQQNKTNKQKKKRNRFIFRSSILLILVAAVVFAIVSNMKDDNKIYRVGDAAPDFQLKQ
                            .*.. : :*  ** ::  *: :::             *. *  * :  

RESA_BACLD      --EDVDGNRLKLDELKGKGVFLNFWGTWCEPCKREFPYMANQYKVFKDKGVEIVAVNVGE
RESA_BACSU      --EDTNGKRIELSDLKGKGVFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIVAVNVGE
RESA_BACHD      --EDLEGESIELRELEGKGVFLNFWGTYCPPCEREMPHMEKLYGEYKEQGVEIIAVNANE
RESA_GEOKA      --TDLKGHEHRLSDYRGKGVFLNFWGTWCKPCEREMPYMNELYPIYKKQGVEILAVNVGE
RESA_GEOTN      --SDLEGREHRLTDYRGKGVFLNFWGTWCKPCEREMPYMNELYPIYQKQGVEILAVNVGE
RESA_BACC1      --TDLEGKKIELKDFKGKGVFLNFWGTWCKPCEKEMPYMNELYPKYKEKGVEIIALDADE
RESA_BACHK      --TDLEGKKIELKDFKGKGVFLNFWGTWCKPCEKEMPYMNELYPKYKEKGVEIIALDADE
RESA_BACAN      --TDLEGKKIELKDLKGKGVFLNFWGTWCKPCEKEMPYMNELYPKYKEKGVEIIALDADE
RESA_BACAH      --TDLEGKKIELKDLKGKGVFLNFWGTWCKPCEKEMPYMNELYPKYKEKGVEIIALDADE
RESA_BACCR      --TDLEGKKIELKDLKGKGVFLNFWGTWCKPCEKEMPYMNELYPKYKEKGVEIIALDADE
RESA_BACCZ      --TDLEGKKIELKDLKGKGVFLNFWGTWCKPCEKEMPYMNELYPKYKEKGVEIIALDADE
RESA_OCEIH      ISEEVDQSTVQLSDLEGKGVMLNFWATWCDPCKAEMPYMQDLYAEYKEKGVEIVAVSLDG
                   : .    .* : .****:****.*:* **: *:*:* . *  ::.:****:*:. . 

RESA_BACLD      SNLAVRNFMKDHGVNFPVVLDKDRQVLNAYDVTPLPTTFLINPDGEIVKVVTGEMTERMI
RESA_BACSU      SKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTMTESMI
RESA_BACHD      PELTVQRFVDRYGLSFPIVIDKGLNVIDAYGIRPLPTTILINEHGEIVKVHTGGMTEQMV
RESA_GEOKA      PKLSVEKFAERFGLTFPIVIDRQDQVLNAYNVGPLPTTFLIDKNGEVKQIITGTMTKEDI
RESA_GEOTN      PKLNVEKFAERFGLTFPIVIDRQDQVLNAYGVGPLPTTFLIDKNGKVKKIITGTMTKEDI
RESA_BACC1      TDIAVKNFVKQYDLKFPVAIDKGGEIIKTYGVIPLPTSFLIDKDGKVIQEIKGEQTKEQL
RESA_BACHK      TDIAVKNFVKQYDLKFPVAIDKGGEIIKTYGVIPLPTSFLIDKDGKVIQEIKGEQTKEQL
RESA_BACAN      TDIAVKNFVNQYGLKFPVAIDKGQKIIGTYGVGPLPTSFLIDKDGKVVEQIIGEQTKEQL
RESA_BACAH      TDIAVKNFVNQYGLKFPVAIDKGQKIIGTYGVGPLPTSFLIDKDGKVVEQIIGEQTKEQL
RESA_BACCR      TDIAVKNFVNQYGLKFPVAIDKGQKIIGTYGVGPLPTSFLIDKDGKVVEQIIGEQTKEQL
RESA_BACCZ      TEIAVKNFVKQYDLKFPVAIDKGTKIIGTYSVGPLPTSFLIDKDGKVVEKIIGEQTKEQL
RESA_OCEIH      TELVVDQFIDEYDLTFPVPHDKNGEVKDLYKIGPMPTTYFIKPNGEIEEIVQGALTLDRL
                ..: * .* . ..:.**:  *   ::   * : *:**: :*. .*:: :   *  *   :

RESA_BACLD      HDYMNMIKPEGSS-
RESA_BACSU      HDYMNLIKPGETSG
RESA_BACHD      EEFMELIKPEA---
RESA_GEOKA      ERHLESIKP-----
RESA_GEOTN      KQHLESIKP-----
RESA_BACC1      EEYLKKITP-----
RESA_BACHK      EEYLKKITP-----
RESA_BACAN      EGYLKKITP-----
RESA_BACAH      EGYLKKITP-----
RESA_BACCR      EGYLKKITP-----
RESA_BACCZ      EGYLQKITP-----
RESA_OCEIH      EGYLNDIAPQQN--
                . .:: * *