CLUSTAL format seed alignment for MF_01321

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RPOB_MYCGE       -----------------------MSQKSNFFQKRYSPTATRRYYGKIETNFIQPNLADIQ
RPOB_MYCPN       -----------------------MSQKPSFFQKKYSPTATRRYYGKIATDFVQPNLADIQ
RPOB_MYCGA       -----------------------MKKNSAFHNTQYSPKVVRRDYSKVHNKYNPLNLPGIQ
RPOB_MYCPE       -----------------------MSKK-KFIDKEISKYVLRRDYSKIEKNFNEPNLLNLQ
RPOB_UREPA       -----------------------MQNNKNYTEKFITDKVMRRDYSKIKSNFEGPNLLEIQ
RPOB_ALKEH       ------------------MAYSFTEKK----------RIRKDFGK-LPNILEVPYLLATQ
RPOB_HALHL       ------------------MAYSFTEKK----------RIRKDFGK-LPNILDVPYLLATQ
RPOB_METCA       ------------------MAYSFTEKK----------RIRKSFGK-RQDVLEVPYLLATQ
RPOB_XANC8       -------------MEDLMTSYSFTEKK----------RIRKDFGK-QRSILEVPFLLAIQ
RPOB_XYLFT       -------------MKDLMTSYSFTEKK----------RIRKDFGK-HRSILKVPFLLAIQ
RPOB_LEGPA       -------MAVAEAKPQY----SHAEKK----------RFRKSFGK-QTDIMPIPNLLEIQ
RPOB_COXBU       -------MAQANSRSRNSATISYPEKR----------RARVNLGKREVEILKTPYLLETQ
RPOB_NITOC       ------------------MPYSLTEKK----------RIRKDFSK-LHSILKTPFLLTIQ
RPOB_AROAE       ------------------MAYSYTEKK----------RIRKSFAK-RAAVLNVPFLLATQ
RPOB_AZOSB       ------------------MAYSYTEKK----------RIRKSFAK-RAAVLDAPFLLATQ
RPOB_METFK       ------------------MSYSFTEKK----------RLRKSFAK-RESVQEVPYLLAMQ
RPOB_NITEC       ------------------MSYSFAEKK----------RIRKSFAK-RTSILPFPFLLATQ
RPOB_NITMU       ------------------MSYSFTEKK----------RIRKSFAK-RASVLPIPFLLATQ
RPOB_THIDA       ------------------MAYTFTEKK----------RLRKSFAS-RTNTLPVPFLLATQ
RPOB_DECAR       ------------------MTYSFTEKK----------RIRKSFAK-RASVLDVPYLLATQ
RPOB_PARXL       ------------------MQYSFTEKK----------RIRKSFAK-RPIVHQVPFLLATQ
RPOB_HERAR       ------------------MHYSFTEKK----------RIRKSFAK-RANVHNVPFLLATQ
RPOB_RALSO       ------------------MAYSFTEKK----------RIRKSFAK-RATVHQVPFLLATQ
RPOB_BORA1       ------------------MPYSYTEKK----------RIRKSFAK-REDVQNVPFLLATQ
RPOB_RHOFT       ------------------MAYSYTERK----------RIRKNFGS-RDSVLEIPYLLQMQ
RPOB_POLSJ       ------------------MAYSYTERK----------RIRKSFGN-RESVLTVPYLLQMQ
RPOB_VEREI       ------------------MAYSFTERK----------RIRKSFGT-RDSVLEVPYLLQMQ
RPOB_METPP       --------------MAQATPYSYTERK----------RIRKSFGK-RENVLGVPYLLTMQ
RPOB_NEIG1       ------------------MNYSFTEKK----------RIRKSFAK-RENVLEVPFLLATQ
RPOB_CHRVO       ------------------MSYSFTEKK----------RIRKSFAK-RASVLDVPFLLATQ
RPOB_ACIBT       ------------------MAYSYTEKK----------RIRKNFGK-LPQVMDAPYLLSIQ
RPOB_PSYCK       ------------------MAYSYTEKK----------RIRKSFAE-LPTVMDIPYLLSIQ
RPOB_HAHCH       ------------------MTYSYTEKK----------RIRKDFGK-LPAVMDVPYLLSIQ
RPOB_MARHV       ------------------MTYSYTEKK----------RIRKDFSK-LPSVMEVPYLLSIQ
RPOB_SACD2       ------------------MAYSYTEKK----------RIRKDFGK-LPDVMEVPYLLAIQ
RPOB_PSEU5       ------------------MAYSYTEKK----------RIRKDFSK-LPHVMDVPYLLAIQ
RPOB_CHRSD       ------------------MAYSYTEKK----------RIRKDFGK-LPQVMDVPYLLAIQ
RPOB_ALCBS       ------------------MAYSFTEKK----------RIRKDFGK-LPKVMEVPYLLAIQ
RPOB_SODGM       ------------------MVYSYTEKK----------RIRKDFGK-RPQVLDVSYLLSIQ
RPOB_ECOLI       ------------------MVYSYTEKK----------RIRKDFGK-RPQVLDVPYLLSIQ
RPOB_BAUCH       ------------------MLYSYTEKK----------RIRKDFGK-RSQVLDVPYLLSIQ
RPOB_BLOFL       ------------------MVFSYTEKK----------RIRKDFGK-RPQVLDIPYLLSIQ
RPOB_BLOPB       ------------------MVYSYTEKK----------RIRKDFGK-RPQVLDIPYLLSIQ
RPOB_BUCAI       ------------------MVYSYTEKK----------RIRKDFGK-RPKVLDIPYLLSIQ
RPOB_BUCAP       ------------------MVYSYTEKK----------RIRKDFGK-RPQVLDIPYLLSIQ
RPOB_BUCBP       -----------------MVVYSSTEKK----------RIRKDFGK-RPKVLDIPYLLSIQ
RPOB_WIGBR       ------------------MVYSYTERK----------RIRKDFGK-RPQVLDIPYLLAIQ
RPOB_BUCCC       ------------------MIYSYTEKK----------RIRENFGK-QPKILDIPYLLSIQ
RPOB_ACTP2       ------------------MAYSYSEKK----------RIRKSFGK-RPQVLNVPYLLTIQ
RPOB_MANSM       ------------------MGYSYTEKK----------RIRKDFGK-RPQVLNVPYLLTIQ
RPOB_HAEI8       ------------------MGYSYSEKK----------RIRKDFGK-RPQVLNVPYLLTIQ
RPOB_ALIF1       ------------------MVYSYTEKK----------RIRKDFGK-RPQVLDIPYLLSIQ
RPOB_PHOPR       ------------------MVYSYTEKK----------RIRKDFGK-RPRVLDAPYLLSIQ
RPOB_VIBCH       ------------------MVYSYTEKK----------RIRKDFGT-RPQVLDIPYLLSIQ
RPOB_AERS4       ------------------MVYSYTEKK----------RIRKDFGK-RDQVLDTPYLLSIQ
RPOB_COLP3       ------------------MAYSYFEKK----------RIRKDFGK-SVQVMEYPFLLSIQ
RPOB_PSEA6       ------------------MVYSYSEKK----------RIRKDFGK-RPQVLEIPYLLSIQ
RPOB_PSEHT       ------------------MAYSYSEKK----------RIRKDFGK-RPQVLDIPFLLSTQ
RPOB_SHEAM       ------------------MVYSYSEKK----------RIRKDFGK-RPQVLDIPYLLSIQ
RPOB_IDILO       ------------------MAYSYSEKK----------RIRKDFGK-RPQVLEVPYLLSMQ
RPOB_PSYIN       ------------------MGYSYTEKK----------RIRKDFGK-RPQVMEKPYLLSIQ
RPOB_DICNV       -----------------MTTYSFTEKK----------RIRKNFSK-RPTVLETPYLLSMQ
RPOB_HYDCU       ------------------MTYSLTEKK----------RIRKDFAT-RSSILEVPYLLSLQ
RPOB_VESOH       ------------------MAYSFTEKK----------RIRNNFGS-RESILTEPDLLAIQ
RPOB_FRATO       ------------------MSYSYAEKK----------RIRKEFGV-LPHILDVPYLLSIQ
RPOB_RHIL3       ----------------MAQTLSFNGRR----------RVRKFFGK-IPEVAEMPNLIEVQ
RPOB_RHIME       ----------------MAQTLSFNGRR----------RVRKFFGK-IPEVAEMPNLIEVQ
RPOB_AGRFC       ----------------MAQTLSFNGRR----------RVRKFFGK-IPEVAEMPNLIEVQ
RPOB_RHILO       ----------------MAQTQTFNGRR----------RVRKFFGK-IPEVAEMPNLIEVQ
RPOB_CHESB       ----------------MAQTQTFNGRR----------RVRKFFGK-IPEVAEMPNLIEVQ
RPOB_BRUSU       ----------------MAQTHSFNGRK----------RVRKFFGK-IPEVAEMPNLIEVQ
RPOB_BARBK       ------------MAQTLAMMSQFNGRK----------RVRKFFGK-IPEVAEMPNLIEVQ
RPOB_RHOPB       -----------------MAQQTFTGRK----------RVRKFFGH-IREVAEMPNLIEVQ
RPOB_GLUOX       -----------MNAIT----KSFTGRK----------RIRKSFGR-IPEIAPMPNLIDVQ
RPOB_GRABC       -----------MNAITQRDSKSFTGRK----------RIRKSFAR-IGDVVPMPNLIDVQ
RPOB_MAGSA       ------------------MAKSYTGRK----------RVRKSFGR-IPTVAPMPNLIEVQ
RPOB_RHORT       ------------------MTKSLTSRK----------RIRKDFGR-IPTVAPMPNLIEVQ
RPOB_CAUVC       ------------------MAQSFTGKK----------RIRKSFGR-IPEAVQMPNLIEVQ
RPOB_MARMM       ------------------MGLSFTGKK----------RIRKSFGR-IPETVAMPNLIEVQ
RPOB_HYPNA       ------------------MALSFTEKK----------RIRKNFGR-IPEAIEMPNLIEVQ
RPOB_RHOS1       ------------------MAQSYVGQK----------RIRRYYGK-IREVLEMPNLIEVQ
RPOB_PARDP       ------------------MAQAYVGQK----------RIRRYYGN-IREVLEMPNLIEVQ
RPOB_ROSDO       ------------------MAQSFLGQK----------RLRKYYGK-IREVLDMPNLIEVQ
RPOB_JANSC       ------------------MPQTYAGQK----------RIRKFYGK-IREVLEMPNLIEVQ
RPOB_NOVAD       -------MATKATSSRTTGRPG--VKK----------RIRKIFGD-IHEVVQMPNLIEVQ
RPOB_ERYLH       -------MASKAKNTAAAAKAEGTAKR----------RIRKIFGD-IHEVVKMPNLIEVQ
RPOB_SPHAL       -------MATKAKSVGQALEAT--ATK----------RIRKLFGN-IHEAVEMPNLIEVQ
RPOB_ZYMMO       -MGRLVVKREDYMATKASAIGHASVKK----------RIRKMFGN-IHEVVDMPNLIEVQ
RPOB_PELUB       ------------------MQLSFTQKK----------NVRKSFGK-LAETLSIPNLIEVQ
RPOB_RICBR       ----------MVSLRDNIEVQPLSHNK----------RVRKNFGH-INLVADIPNLIEIQ
RPOB_ORITB       -------------------MQYLLSKK----------RIRKNFGK-INLVSSIPNLIEVQ
RPOB_ANAMM       -------MSSAGGSSGPGYVLNDFDAV----------PRLSYAKS-IDIRDSLTDLIRIQ
RPOB_ANAPZ       -------MSSAG-DSGPGYVLNDFDAV----------PRLSYARS-IDIRDSLSDLIRIQ
RPOB_EHRRW       -------MSSSV---TSKYVLNSFSSV----------PRLSYAKS-IDIKDSLTDLIKIQ
RPOB_NEOSM       -----------------------MSEF----------HRLYFD----ELLFDFPDLVKVQ
RPOB_MAGMM       ------------------MALTFTEKK----------RLRKNFGR-ISSIIDIPNLISVQ
RPOB_ANADE       ------------------MATTIQNNF----------RIRRNFGK-INKIAEIPNLIAIQ
RPOB_MYXXD       ------------------MPTQIQNNF----------RVRKTFAK-IAKIIDIPNLINIQ
RPOB_SYNFM       ------------------MPTALTHEY----------RVRKNFGK-IHKIIDIPNLIQMQ
RPOB_SYNAS       -------------------------MG----------EFRKNFGR-IEEILEVPNLIDIQ
RPOB_GEOSL       ------------------MAYSIANNQ----------LLRKNFAK-IKKIIDIPNLIDIQ
RPOB_PELPD       ------------------MAYSIANNH----------LLRKTFTK-IKNIIDIPNLIDIQ
RPOB_PELCD       ------------------MAYSVANNQ----------LLRKHFST-IKGIIEIPNLIDIQ
RPOB_BDEBA       ------MSDFLITESTLEKTPVTASNI----------RVRKSFAK-NKQVIDIPNLIELQ
RPOB_DESPS       -------------------------ME----------RVRKNFAT-ADNVLEPPHLISMQ
RPOB_DESVV       -------------------------MG----------QLTKKFGK-IDVSLPIPHLLNLQ
RPOB_DESAG       -------------------------MG----------QLTKKFGK-IEVTLPIPHLLNLQ
RPOB_LAWIP       -------------------------MV----------QLTKQFGK-IKVEVPIPHLLNLQ
RPOB_KORVE       -------------------MAEKKIAF----------RNRQDFSK-IPATIQIPNLIEVQ
RPOB_SOLUE       ------------------MDLQNYGAA----------PERVDFSK-IKTSIPIPNLIEVQ
RPOB_CAMJJ       ----------------MCDMLDNKLGN----------RLRVDFSN-ISKQIEIPNLLQLQ
RPOB_CAMFF       ----------------MLNSLYS--GN----------RLRVDFSN-VAKEIDVPNLLQLQ
RPOB_SULDN       ----------------MLNTLYS--GN----------RLRVDFSK-TPQQIEVPNLLQLQ
RPOB_BACV8       ---------------------MSSNTE----------NQRVNFAS-IKNPMKYPDFLEVQ
RPOB_PARD8       ---------------------MSSTAE----------NQRVNFAS-IKNQFPYPDFLEVQ
RPOB_PORGI       ---------------------MTPTTN----------NKRINFAS-IKNPLFYPDFLEVQ
RPOB_FLAPJ       ----------------------MITNQ----------TERLNFAS-TKNIPAYPDFLDVQ
RPOB_GRAFK       ----------------------MLAKQ----------TERLSFSS-VKNKPAYPDFLDLQ
RPOB_CYTH3       --------------------MATNNTQ----------NLRKSFAK-TRSTVEYPDFLDIQ
RPOB_SALRD       ---------MPTFLNGDITTPGHLVDP----------DPRESFAD-IPEVWDYPDFLDVQ
RPOB_PELLD       ---------------------MADATS----------TPSIDFSK-IQSVIEAPDLLKVQ
RPOB_CHLPD       ----------MQFDKSEVHVKVADATP----------TPCIDFSK-IQSVIDPPDLLKVQ
RPOB_CHLCH       ---------------------MADAT-----------TSRIDFSK-IKSIINSPDLLKVQ
RPOB_CHLTE       -------------------MKVADATP----------TPCIDFSK-IQSIINPPDLLKVQ
RPOB_CHLMU       --------------------MFKCPER----------VSIKK----KEDILDLPNLVEVQ
RPOB_CHLPN       --------------------MLKCPER----------VSVKK----KEDIPDLPNLIEIQ
RPOB_PARUW       -------------------MLQRPPHR----------ESFND----KEEIIDLPNLIEIQ
RPOB_RHOBA       ----------------MATTTQRRLEP----------TSIRKFGT-GLGQFDLPDLTALQ
RPOB_TREDE       ------------------MFARGQKID----------RRYYGKD--VPNFMELPNLIDIQ
RPOB_TREPA       ------------------MSARVCKTH----------RVYVGRD--VRNFMDIPDLIEIQ
RPOB_BORAP       ------------------------MIK----------RVHLGQGR-ADEILDLPNLIEIQ
RPOB_LEPBL       ---------------------MYGQVE----------RKRVNFGK-ITNLDYLPNLIQIQ
RPOB_FUSNN       -----------------------MQKL----------IERLDFGK-IKARGEMPHFLEFQ
RPOB_CYAM1       ----------------------------------------------------MRDLIAVQ
RPOB_AQUAE       ----------------------MAKIA----------LPRKFFGR-RFEVLEPPYLLSIP
RPOB_DEIRA       --------------------MTLSKTP----------PRIERFGD-ITEVIPLPNLTEVQ
RPOB_DEIGD       --------------------MSLTDQK----------PRIERFGE-ITEVIPLPNLTEVQ
RPOB_THET8       -------------------------------------MEIKRFGR-IREVIPLPPLTEIQ
RPOB_THEMA       -------------------MKEISCGR----------RTRVSFGK-SREPLPIPDLVEIQ
RPOB_BACCR       ---------------MTGQLVQYGRHR-----------QRRSYARISEV-LELPNLIEIQ
RPOB_BACSU       ---------------MTGQLVQYGRHR-----------QRRSYARISEV-LELPNLIEIQ
RPOB_BACHD       ---------------MTGQLIQYGRHR-----------QRRSYARINEV-LELPNLIEIQ
RPOB_GEOTN       ---------------MTGRLVQYGRHR-----------QRRSYARISEV-LELPNLIEIQ
RPOB_OCEIH       ---------------MTGQLVQYGRHR-----------QRRSYARINEV-LELPNLIEIQ
RPOB_LISIN       ------------MSGHSGHDVKYGRHR-----------TRRSFARISEV-LELPNLIEIQ
RPOB_STAS1       ---------------MAGQFVQYGRHR-----------KRRNYARISEV-LELPNLIEIQ
RPOB_STRS2       ---------------MAGHEVQYGKHR-----------TRRSFSRIKEV-LDLPNLIEIQ
RPOB_LACLA       ---------------MAGHDVKYGKHR-----------TRRSFSRIKEV-IGLPNLIEVQ
RPOB_LACGA       ------------MFSLLGHAVNYGSHR-----------TRRSFSRIKEV-LKLPNLTDVQ
RPOB_LACAC       --------------MLNGHVVNYGKHR-----------TRRSFSRIKEV-LKLPNLTDVQ
RPOB_LACDB       --------------MLNGHVVNYGQHR-----------TRRSFSRIKEI-LPLPNLTDVQ
RPOB_LACPL       ---------------MAGHLVKYGKHR-----------TRRSYARIKEV-LDLPNLIEIQ
RPOB_LACBA       ---------------MAGHLVKYGKHR-----------TRRSYSRIKEV-LDLPNLIEIQ
RPOB_PEDPA       ---------------MAGHLVKYGKHR-----------TRRSYARIKEV-LDLPNLIEIQ
RPOB_LACS1       ------------MNNLAGHLVKYGKHR-----------VRRSYSRIKEV-LDLPNLIEVQ
RPOB_LACSS       ---------------MAGHLVNYGKHR-----------TRRSYARIKEV-LELPNLIEIQ
RPOB_LACP3       ---------------MAGHLVNYGKHR-----------TRRSYARIKEV-LDLPNLIEIQ
RPOB_ENTFA       ------------MKSLAGHVVKYGKHR-----------ERRSFARISEV-LELPNLIEIQ
RPOB_LEUMM       ---------------MVGHLVKYGKHR-----------TRRSYASIKEV-LDVPNLIEIQ
RPOB_OENOB       ---------------MVTHNVKINKHV-----------TRRSYSSAKEV-LEIPPLTEVQ
RPOB_CARHZ       -----------------MIPVQVGKK------------IRYSYAKFPEI-LELPYLIEIQ
RPOB_MOOTA       ----------------MAYPVKVGAR------------ERWTFAKIKET-LELPNLIEIQ
RPOB_SYMTH       ----------------MPKIVQAGRR------------QRLSFSRIDEV-LEMPNLIELQ
RPOB_DESHY       ----------------MFYPVKVGTR------------ERWSYSRIREV-LDMPNLIEIQ
RPOB_CLOAB       ----------------MIHPVQVGKR------------TRMSFSKLDEI-GVMPNLIEVQ
RPOB_CLONN       ----------------MVHPIQIGKR------------TRMSFSKVKEM-CPMPNLIEVQ
RPOB_CLOPS       ----------------MVHPVQVGKR------------TRMSFAKVKDV-AEMPNLIEIQ
RPOB_CLOTE       ----------------MVHPVQVGKR------------TRMSFSKIKEV-CEMSNLIEVQ
RPOB_HUNT2       ----------------MVHPVKLGRN------------VRMSYSKIDEV-IDMPNLIEIQ
RPOB_CLOD6       ----------------MPHPVTIGKR------------TRMSFSKIKEI-ADVPNLIEIQ
RPOB_CALS4       ----------------MVRPVQAGSR------------TRMSFAKIDEV-LEIPDLIEVQ
RPOB_SYNWW       ----------------MAHLEQFGRV------------SRLSYSRIKEP-VELPNLIQIQ
RPOB_ONYPE       ---------------MGYHNVKYGKKA-----------QRRNYSKTIYD-VDLPNLIEIQ
RPOB_COREF       -----MIHPREVLEGPILAVSRQTKSV----VDIPGAPKRYSFAKVSAP-IEVPGLLDLQ
RPOB_CORDI       MVNIAGPPPREVLEGPILAVSRQTKA------NIPGAPERKSFAKITEP-IEVPGLLDIQ
RPOB_CORJK       -----------------MAVSRQTSSV----AGIPGAPQRHSFAKIDAP-IEVPGLLDLQ
RPOB2_NOCFA      -----------MLEGRILAVSTQTKA----VAGIPGAPKRVSFAKIREP-LEVPGLLDLQ
RPOB_RHOJR       -----------MLEGRILAVSSQTKA----VSGIPGAPKRVSFAKIREP-LEVPGLLDVQ
RPOB_MYCS2       -----------MLEGCILAVSSQSKSNAITNNSVPGAPNRVSFAKLREP-LEVPGLLDVQ
RPOB1_NOCFA      -----------MLEGRIVTVSSRTES-PLAAPGVPGAPRRLSFARIREP-LAVPGLLDIQ
RPOB_SACEN       -----------MAVSRATKVSAASNM----MSGIPGAPKRVSFANIREP-LEVPDLLDLQ
RPOB_FRAAA       ------------------MAASRSSS-------------RISFAKIIEP-LEVPDLLALQ
RPOB_STRCO       ------------------MAASRNASTANTNNAASTAPLRISFAKIKEP-LEVPNLLALQ
RPOB_THEFY       ------------------MAASRIASANALG------PNRVSFARIKEP-LEVPNLLALQ
RPOB_ACIC1       -----------MVDREPWKEPHLAASGSTSMINGPLAPHRVSFAKIHEP-LDLPNLLALQ
RPOB_NOCSJ       ----------------MQIEERIVEGHLLAARTTPGNTRRISFAKITEP-LEVPQLLSLQ
RPOB_ARTS2       --------------MVASSTSNVNNATAINADSTDGATRRLSFAKIHEP-LDVPNLLALQ
RPOB_LEIXX       --------------MAAARNATNNDKTLKNGRD----VSRLSFAKITDT-LTVPDLLALQ
RPOB_CUTAK       --------------MAATRTASKNTSAISPQ------SGRISFAKIHEP-LEVPNLLDLQ
RPOB_BIFAA       ------------MAEATTNTTTIIARADQHDIDLHKASDRVNFGSIREP-IDVPYLLGVQ
RPOB_TROWT       --------------MSLFGVGFLASAK----GKRVCAIGRSSLGKISDP-LEVPNLLDLQ
RPOB_RUBXD       --------------MRVRPFFNDSSWRRANLVTPIVRRKRHSYARLQSADAQLPNLIQIQ
RPOB_DEHMC       ---------------MVSMLPKADAAT---------GVIRKSYAQLPEV-VNVPNLIEMQ
RPOB_MYCMS       ------------------MAYKIRKIN--------RNVERRDYTK-VSMNLSLPNLIGIQ
RPOB_MESFL       ------------------MAYKIKKVN--------RGVERRDYRK-VSGNLELPNLIEIQ
RPOB_MYCMO       -----------------MIKHKLRKFG--------PVTERRDYSQ-TNRTWETFDFLETQ
RPOB_MYCPU       --------------MPQKINYELKNFG--------QYTKRRDYSK-TRFSLPLTDVLAIQ
RPOB_MYCS5       -------------MQKDKKNYKLRKFG--------PITERRDYSI-TKHSLPVGDILATS
RPOB_MYCH2       ----------------MNHIYKLKSYG--------IGTDRRFYGV-ANKTLETPDFLDPV
RPOB_CITSI       ----------------------------------------MLGDG-NAGMSTIPGLNQIQ
RPOB_POPTR       ----------------------------------------MLGDG-NGGMSTIPGFNQIQ
RPOB_AETGR       ----------------------------------------MLGDG-KEGTSTIPGFNQIQ
RPOB_OENEH       ----------------------------------------MLGDG-NGGMCTIPGFNQIQ
RPOB_NYMAL       ----------------------------------------MLRDGGDEGMFTIPGFSQIQ
RPOB_PIPCE       ----------------------------------------MLRNR-NEGMSTIPEFSQIQ
RPOB_PHAAO       ----------------------------------------MLQNG-NEGMSTIPGFSQIQ
RPOB_DIOEL       ----------------------------------------MIRDG-NEGMYTIPGFNQIQ
RPOB_PHAVU       ----------------------------------------MLGSG-NEEMSTLPGLNQIQ
RPOB_LOTJA       ----------------------------------------MLGVG-NEGMSTLPGLNQIQ
RPOB_JASNU       ----------------------------------------MLGDG-NEGMSTIPGLNQIQ
RPOB_LACSA       -------------------------------------------------MSTIPGFNQIQ
RPOB_SACHY       ----------------------------------------MLRNG-NEGMSTIPGFSQIQ
RPOB_PELHO       ----------------------------------------MLGDR-NEGMATIPALNQIQ
RPOB_ANTAG       ----------------------------------------MILRK-KIELFVLPEFTEIQ
RPOB_MARPO       -----------------------------------------------MEIFILPEFGKIQ
RPOB_PHYPA       ---------------------------MKKIITLSAPPPSQFSFL-SEFQFSLPELRQIQ
RPOB_PSINU       ----------------------------------------MILEE-NKGMFALPGFDLIQ
RPOB_ANGEV       ----------------------------------------MILKE-NKKMFVLPEFGRIQ
RPOB_PINTH       ----------------------------------------MRLDE-NEGAFTIPEFGKIQ
RPOB_CYCTA       ----------------------------------------MLLDE-NKGTSTIPEFGKIQ
RPOB_ADICA       -------------------------------------------------MPVLPELAQIQ
RPOB_HUPLU       ---------------------------------------MKIDLEQNEDIYVLPDFRKIQ
RPOB_CHAGL       ----------------------------------------MTLQTNQTEKFTLPDLGKIQ
RPOB_CHAVU       -----------------------------------------MKFEKNTDIFILPDFIRIQ
RPOB_STAPU       ---------------------------------------------MEMNMFILPDFLQIQ
RPOB_ZYGCR       ----------------------------------------MLSINRNAGMFVLPDFKQIQ
RPOB_NEPOL       ------------------------------------MIQNLQRKDSQWTPFILPDLISIQ
RPOB_OSTTA       --------------------------------------MTLFRQNS-----ALPNFLDSQ
RPOB_MESVI       ----------------------------------MMIIEEYTPVPNTAFDFKIPDLIEMQ
RPOB_CHLAT       ------------------------------------MIQQYNPFKKDAFDILLPDLVGIQ
RPOB_OLTVI       -----------------------------------------MNIYLRQNSFLVPDFIAVQ
RPOB_BIGNA       ---------------------------------------------MYITPLFFPNLLKLQ
RPOB_PHATC       ----------------------------------------------MNYTNALPDFLAMQ
RPOB_THAPS       ----------------------------------------------MNYTTALPDFIEMQ
RPOB_TRIV2       ----------------------------------------MISENYIEPAFLLPDLIEIQ
RPOB_TRIEI       ----------------------------------MTYQKLNVNTYSNLQIFNMPDLIEIQ
RPOB_SYNY3       --------------------------------------------MTNLATTMLPDLIEIQ
RPOB_SYNE7       ---------------------------------------MAEQTQLAPAAFHLPDLVAIQ
RPOB_THEEB       ---------------------------------------MASNQIYTPPAFTLPDLVEIQ
RPOB_SYNJA       ---------------------------------------MTQLAVPSPAAPTLPDLVEIQ
RPOB_GLOVI       ---------------------------MPDFRYADALPEVRMSNALTTPNYLLPDLVEIQ
RPOB_PROM5       --------------------------------------MSSSALQIAKTATYLPDLVEVQ
RPOB_GUITH       ------------------------------------------MFNTTFANRTLPDLVEIQ
RPOB_RHDSA       ------------------------------------------MSSTKLSTSILPDLVEIQ
RPOB_PYRYE       -----------------------------------------MVQRISLKNKLLPDLVEIQ
RPOB_GRATL       --------------------------------------MRLLMSQEIMFKYIFPDLAAIQ
RPOB_CYAPA       ------------------------------------------MTQLTDTSLIPFDLLEIQ
RPOB_CYACA       -----------------------------------------MKKNQFANKLIVIDLLSVQ
RPOB_EMIHU       ----------------------------------------MLDRNKNIYKYLLPNLLDVQ
RPOB_EUGLO       ---------------------------------------------MINRLKTYSNLLNIQ
                                                                        .    

RPOB_MYCGE       IKSYQKFLDH-----------------------DLEKLIASYFP----IKSPNDRYTINF
RPOB_MYCPN       IRSYQTFLDH-----------------------DLENLIAAYFP----IKSPNDRYTINF
RPOB_MYCGA       VNAYKQFLEK-----------------------ELEEIIGSYFP----IKSPNGKYSVEF
RPOB_MYCPE       KNAFHKFIDT-----------------------ELEGTIKSIFP----IKSIGGRYSLEY
RPOB_UREPA       VESFKRFMEK-----------------------DLKEVISSIFP----LKSPQGKYTLAF
RPOB_ALKEH       IDSYRQFLQEERAAE------------SRE-DVGLHGAFRSVFP----ITS------HSG
RPOB_HALHL       VDSYRQFLQDEVSED------------ARDTEVGLEGAFRSVFP----IQS------HSG
RPOB_METCA       VDSYRRFLQLDKQPA------------ARS-DEGLHAALKSVFP----IKS------HSG
RPOB_XANC8       VDSYREFLQEDVEPN------------KRK-DLGLHAALKSVFP----ISS------YSG
RPOB_XYLFT       VDSYRAFLQGDVESS------------QRK-DIGLHGALKSVFP----IVS------YSG
RPOB_LEGPA       LKSYRDFLQTDTKLS------------EQL-NTGLHAAFSSVFP----IES------FSG
RPOB_COXBU       IESYRKFLQKDIAAE------------KRE-DNGLHAAFKSVFP----ITS------YSG
RPOB_NITOC       IGSFLDFLQMDVPPG------------KRK-DKGLHAAFKSVFP----IKS------YTE
RPOB_AROAE       IESFASFLQADTPPP------------SRL-NHGLQAAFTSIFP----ISS------HSG
RPOB_AZOSB       IESFASFLQAETPPE------------SRY-NQGLQAAFTSIFP----ISS------HSG
RPOB_METFK       LESYAAFLQADTPAD------------KRT-DTGLQAAFSSVFP----IVS------HSG
RPOB_NITEC       IESYADFLQADVAPG------------KRK-NQGLQAAFNAVFP----IES------HSN
RPOB_NITMU       IESYAAFLQANLEPD------------QRA-PEGLQAAFLSIFP----IES------HSR
RPOB_THIDA       LESYRAFLQEGRSRD------------ERL-NEGLQAAFTSIFP----IES------HSK
RPOB_DECAR       LQSFKDFLQDEVAPE------------KRK-NEGLQAAFTSIFP----IVS------HSG
RPOB_PARXL       LESFSTFLQADTSST------------QRK-PEGLQAAFTSVFP----IVS------HNG
RPOB_HERAR       LESYHDFLQEDKIPS------------QRK-NEGLQSAFTSIFP----IVS------HNG
RPOB_RALSO       IQSYAQFLQEHASVA------------QRK-SEGLQAAFNAIFP----IVS------HNG
RPOB_BORA1       LQSYLTFLQAETATA------------DRV-NEGLQAAFTSIFP----IVS------HNG
RPOB_RHOFT       KDAYTAFLQADVHPK------------KRT-AEGLQAAFEAAFP----IIS------HNG
RPOB_POLSJ       KDAYTAFLQADRAPQ------------KRT-VEGLQAAFENAFP----IVS------HNG
RPOB_VEREI       KDAYTAFLQADKEPR------------KRT-IEGLQAAFDAAFP----IVS------HNG
RPOB_METPP       KDSYVAFLQKDVPPQ------------KRK-PEGLQAAFLSAFP----IVS------HNG
RPOB_NEIG1       IDSYAKFLQLENAFD------------KRT-DDGLQAAFNSIFP----IVS------HNG
RPOB_CHRVO       IDSYTEFLQLGTPLD------------ERK-DVGLQAAFKSIFP----IVS------HNG
RPOB_ACIBT       VDSYRTFLQDGKSPK------------NRE-DIGLQAAFRSVFP----IES------YSG
RPOB_PSYCK       VDSYEQFLQEHKKPK------------ARE-NTGLQAAYSSIFP----IES------HSG
RPOB_HAHCH       LDSYHDFLQQDVAIE------------DRQ-EVGLHAAFKSVFP----IVS------FSG
RPOB_MARHV       LDSFRDYLQMETAPE------------DRR-ETGLHAAFKSVFP----IVS------YSG
RPOB_SACD2       LDSYRKFTQADTPFD------------QRK-DMGLHAAFKSIFP----IVS------YSG
RPOB_PSEU5       LDSYREFLQAGATKD------------QFR-DIGLHAAFKSVFP----IIS------YSG
RPOB_CHRSD       LDSYFDFLQQDRAIE------------ERL-DVGLHAAFKSVFP----IES------FSG
RPOB_ALCBS       LDSYRKFLQQDKSAE------------ERL-EEGLEAAFRSVFP----IAS------YSG
RPOB_SODGM       LDSFQKFIER----D------------PEG-QYGLEAAFRSVFP----IQS------YSG
RPOB_ECOLI       LDSFQKFIEQ----D------------PEG-QYGLEAAFRSVFP----IQS------YSG
RPOB_BAUCH       LESFQKFIER----D------------NEG-QHGLEAAFRSVFP----IQS------YSG
RPOB_BLOFL       LGSFQKFVKK----D------------PEG-QNGLESAFRSVFP----IKS------YNG
RPOB_BLOPB       IDSFQKFIKQ----D------------PEE-PCGLEAAFRSVFP----IKS------YNG
RPOB_BUCAI       LNSFKKFIQP----D------------LSG-QHGLEAAFRSVFP----IRG------YNG
RPOB_BUCAP       LDSFKKFIKI----D------------PEG-LHGLEAAFRSVFP----ICG------YNG
RPOB_BUCBP       LNSFQKFIKH----D------------PNG-IHGLESAFRSIFP----IRS------YNG
RPOB_WIGBR       INSFKKFIEK----D------------PEG-LYGLEAAFKSIFP----IKS------YSG
RPOB_BUCCC       IDSFKKFIEP----K------------KNN-YQGLESAFQSIFP----IRS------YNG
RPOB_ACTP2       LDSYEKFIQR----D------------SDG-QQGLEAAFRSVFP----IVS------NNG
RPOB_MANSM       LDSFEKFIQR----D------------PEG-QQGLEAAFRSVFP----IVS------NNG
RPOB_HAEI8       LDSFDKFIQK----D------------PEG-QQGLEAAFRSVFP----IVS------NNG
RPOB_ALIF1       LDSFTKFIEQDPEGQ-----------------YGLEAAFRSVFP----IQS------YNG
RPOB_PHOPR       LDSFKKFIEQ----D------------PEG-HYGLEAAFRSVFP----IQS------YNG
RPOB_VIBCH       LDSFEKFIEQ----D------------PEG-QYGLEAAFRSVFP----IQS------YNG
RPOB_AERS4       LDSFKQFIEA----D------------PEG-EYGLEAAFRSVFP----ITS------YSG
RPOB_COLP3       LDSFRKFIDT----D------------PTG-ETGLEAAFRSIFP----IKA------YSG
RPOB_PSEA6       LDSFKKFIDL----D------------VDG-QHGLEAAFRSVFP----IKS------YSG
RPOB_PSEHT       LKSFKKFLVP----D------------ADG-DHGLEAAFRSVFP----IKS------YSG
RPOB_SHEAM       LDSFKKFTDQ----D------------PTG-ERGLEAAFRSVFP----IKS------FSG
RPOB_IDILO       LDSFKKFIEV----D------------PEA-NNGLEAAFRSVFP----IAS------YSG
RPOB_PSYIN       LDSFKRFIEV----D------------LTG-EVGLEAAFNSIFP----IAS------YSG
RPOB_DICNV       IDSYNDFLQQHVPMQ------------SRA-KKGLQEAFESIFP----IKS------HNE
RPOB_HYDCU       KESFKEFLQKDKKPL------------ERD-PIGLHSAFSSVFP----IHG------VAG
RPOB_VESOH       IDSFNSFIQADNK--------------IKQ-DIGLHNVLQSVFP----ITA------VNG
RPOB_FRATO       TESYKKFLTVDAAKG------------RLH--SGLEIVLKQSFP----VES------KNG
RPOB_RHIL3       KASYDQ-FLMVEEPK------------GGRPDEGLQAVFKSVFP----ITD------FSG
RPOB_RHIME       KASYDQ-FLMVDEPQ------------GGRPDEGLQAVFKSVFP----IKD------FSG
RPOB_AGRFC       KASYDQ-FLMVDEPK------------GGRPDEGLNAVFKSVFP----ITD------FSG
RPOB_RHILO       KASYDQ-FLMVDEPK------------GGRPDEGLQAVFKSVFP----ISD------FSG
RPOB_CHESB       KASYDQ-FLMVEEPQ------------GGRPDEGLQAVFKSVFP----ISD------FAG
RPOB_BRUSU       KASYDQ-FLMVEEPS------------GGRPDEGLQAVFKSVFP----IQD------FSG
RPOB_BARBK       KASYDQ-FLMIKEPK------------GGRPDEGLQAVFKSVFP----ISD------FSG
RPOB_RHOPB       KASYDQ-FLMVDEPV------------GGRLDEGLQAVFRSVFP----ISD------FSN
RPOB_GLUOX       RASYEA-FLQMNVSP------------DSRQDAGLQEVFRSVFP----IND------FAG
RPOB_GRABC       RASYEA-FLQMNVHP------------DNRTPTGLQEVFRSVFP----IDD------FAG
RPOB_MAGSA       KSSYDH-FLQMDTAP------------EQRGNVGLQEVFKSVFP----IKD------FSE
RPOB_RHORT       KSSYDQ-FLQIGVPV------------DKRTDSGLQEVFKSVFP----IRD------FSG
RPOB_CAUVC       RSSYEQ-FLQRETRP------------GLRRDEGVEAVFKSVFP----IKD------FNE
RPOB_MARMM       KSSYEH-FLMKEVPA------------AERDDTGMQAVFKSVFP----VKD------FAE
RPOB_HYPNA       RESYEA-FLQMNTPR------------EQRTDDGLGGVFKSVFP----ITD------FSE
RPOB_RHOS1       KSSYDL-FLKSGDGP------------KAADGEGIQGVFQSVFP----IKD------FNE
RPOB_PARDP       KSSYDL-FLRSGDAE------------GHQDGEGIQGVFQSVFP----IKD------FNE
RPOB_ROSDO       KSSYDL-FLNSGEAE------------VPTDGEGIAGVFQSVFP----IKD------FNE
RPOB_JANSC       KSSYDL-FLKSGDQL------------EPMDGEGIKGVFQSVFP----IKD------FNE
RPOB_NOVAD       RESYEQ-FLRSDPAT------------G--YVSGLEKTLRSVFP----IQD------FAG
RPOB_ERYLH       RESYEQ-FLRSNKEI------------D--YVSGLEKTLRSVFP----IRD------FAG
RPOB_SPHAL       RESYEQ-FLRSDPSI------------G--YVSGLEKTLRSVFP----IRD------FAG
RPOB_ZYMMO       RDSYEN-FLRSRPED------------G--YVSGLEKTLRSVFP----IRD------FGG
RPOB_PELUB       KNSYKQ-LTDFDSEA------------GD-LSKGFDRVFKSIFP----IED------LND
RPOB_RICBR       KNSYEKNFLQLDTKD------------SERKNKGLQSILNSIFP----ISD------PSN
RPOB_ORITB       KNSYNKEFLQLGVPV------------DCRENKGLQGVLNSIFP----IHD------LDG
RPOB_ANAMM       RDSYDA-FIGIDR----------------DGSSGIQSIFEAMFP----IRD------LLG
RPOB_ANAPZ       RDSYDA-FIGIDE----------------GSSGGIQSIFQSMFP----IRD------PLG
RPOB_EHRRW       RDSYNA-FIGIDQ----------------DVDSGIKNIFQSMFP----IQD------LLG
RPOB_NEOSM       KDSYAS-FVGGG-----------------DTVFSISDIFASVFP----VND------GYG
RPOB_MAGMM       KESFVR-FLQTGTEF------------EKMKDTGLHGVFLSVFP----IHD------YAG
RPOB_ANADE       KFSYDKFLQADVP-P------------EKRDDTGLQGVFKSVFP----IKD------FNE
RPOB_MYXXD       KQSYEKFLQADIA-A------------DKREDLGLQGVFKSVFP----IRD------FNE
RPOB_SYNFM       KESYELFLQRDVP-S------------EARSERGLQEVFKSVFP----IED------FSG
RPOB_SYNAS       TRSYETFLQEDVA-P------------ENRKNFGLQGAFKSVFP----ISD------FSG
RPOB_GEOSL       KNSYKRFLQIDTP-P------------EARKNSGLEAVFKSVFP----IKD------FSD
RPOB_PELPD       KNSYRRFLQQEGV-S------------ESRNNTGLEAVFRSVFP----IKD------FSE
RPOB_PELCD       KNSYKRFLQAGLP-P------------SARKNIGLEAVFRSVFP----IRD------FSE
RPOB_BDEBA       KSSYEAFIQKDMD-P------------DRRGDAGLNGVFKSVFP----ITD------FNN
RPOB_DESPS       RISYEEFLQIDRA-P------------EEREDVGLQAILKNIFP----IND------FNG
RPOB_DESVV       VDSYVKFLQEGAT-E------------RRHDE-GLEGVFRSVFP----IED------FNR
RPOB_DESAG       VDSYKKFLQEGAA-A------------LAPDE-GLEGVFRSVFP----IED------FNR
RPOB_LAWIP       VDSYKKFLQEGLL-E------------PLPEE-GLESVFRSVFP----IED------FNR
RPOB_KORVE       KRSYDRFLQMDLLPS------------ERD-DAGLQAVFQSVFP----ITD------FRN
RPOB_SOLUE       KKSYERFLQMDLLPN------------ERE-DIGLQTVFNSVFP----ISD------FRG
RPOB_CAMJJ       KKSFDYFLNLDNG------------------ESGIEKVFKSIFP----IHD------PQN
RPOB_CAMFF       KKSFDHFLNLDNSQ----------------TESGIEKVFKSIFP----IHD------PQN
RPOB_SULDN       QSSYNKFLMLEEKDR---------------SQSGVETVFQSVFP----IHD------TQN
RPOB_BACV8       LKSFQDFLQLDTPPE------------KRK-NDGLYKVFAENFP----IAD------TRN
RPOB_PARD8       LKSFQDFLQLDTPPE------------KRK-KEGLYKVFAENFP----IAD------TRN
RPOB_PORGI       LKSFHDFLQLDTPPE------------RRK-KEGLYKVFAENFP----ITD------TRN
RPOB_FLAPJ       VKSFQDFFQLETKSD------------ERG-NEGLYNTFMENFP----ITD------TRN
RPOB_GRAFK       IKSFQDFFQLETKSE------------ERG-NEGLYNTFLENFP----ITD------TRN
RPOB_CYTH3       VRSFKDFFQIDTPAE------------NRF-KEGLYKVFAENFP----ISD------SRD
RPOB_SALRD       LKTFHDFVQDDVPPA------------DRE-DVGLQAVFNEHFP----IKD------NRD
RPOB_PELLD       LDSFHNFIQDSVPLA------------KRR-EQGLEKVLRSAFP----ITD------TRG
RPOB_CHLPD       LDSFHNFIQDSVPLA------------KRR-DQGLERVLRSAFP----ITD------TRG
RPOB_CHLCH       LDSFHNFIQDSVPLA------------KRK-DQGLERVLRGAFP----ITD------TRG
RPOB_CHLTE       LDSFHNFIQDSVPLE------------KRK-DQGLEKVLRSAFP----ITD------TRG
RPOB_CHLMU       IKSYKQFLQIGKLAE------------ERE-NIGLEEVFREIFP----IKS------YNE
RPOB_CHLPN       IKSYKQFLQIGKLAE------------ERE-NIGLEEVFREIFP----IKS------YNE
RPOB_PARUW       IKSYNQFLQADKFPD------------ERE-NIGLQEVFTEIFP----IKS------YDE
RPOB_RHOBA       TVSYAAFLQEDAASN------------ARK-DHGLESVLREIFP----IAS------YDG
RPOB_TREDE       IQSYNKFLNKEKK---------T----DETEIEGLESVFHTTFP----IES------TNE
RPOB_TREPA       LRSYDTFLHGARNTPSGADTLIS----GTREELGLEDVFKTTFP----IES------STG
RPOB_BORAP       LNSYEKFLQLDKLKN-------K----KPLLNEGLESVFRNIFP----IKS------GNG
RPOB_LEPBL       KRSFDWFLQADVKDE------------TKRKHQGLEAVFRETFP----IES------PNN
RPOB_FUSNN       LNSYEDFLQTNMSPN-------------KREEKGFELAFKEIFP----IES------SNG
RPOB_CYAM1       RNSYYTFLT-----------------------KSLKEEFDKISP----IVD------YTG
RPOB_AQUAE       KNSFENFVQLKVNPY-------------KRKNVGLEHIFRTSFP----FKD------PDE
RPOB_DEIRA       VNSFKAFLQDDKAPD-------------QREDVGLQSAFREVFP----IDESEKG--RST
RPOB_DEIGD       VNSFKAFLQADKAPD-------------ERDDTGLQSAFREVFP----IDETEKG--RST
RPOB_THET8       VESYRRALQADVPPE-------------KRENVGIQAAFRETFP----IEEEDKG--K-G
RPOB_THEMA       KSSYRRFLEEGLLEV------------LKKFSPIYSQATRSDLR----KSD--------R
RPOB_BACCR       TSSYQWFLDE-----------------------GLREMFQDISP----IEDF-----TGN
RPOB_BACSU       TSSYQWFLDE-----------------------GLREMFQDISP----IEDF-----TGN
RPOB_BACHD       TASYQWFLDE-----------------------GLREMFQDISP----IQDF-----TGN
RPOB_GEOTN       TSSYQWFLDE-----------------------GLREMFKEISP----IEDF-----SGN
RPOB_OCEIH       TASYDWFLEE-----------------------GLREMFQDISP----IEDF-----TGN
RPOB_LISIN       TASYQWFLDE-----------------------GLREMFRDISP----IEDF-----AGN
RPOB_STAS1       TKSYDWFLEE-----------------------GLLEMFRDISP----IEDF-----TGN
RPOB_STRS2       TDSFQDFLDY-----------------------GLKEVFEDVLP----VSNF-----TDT
RPOB_LACLA       TLSYKNFLDE-----------------------GLANVFKEMFP----IDNF-----AGT
RPOB_LACGA       TQSYKWFLNE-----------------------GIREMFDDIMP----ISDF-----SGK
RPOB_LACAC       TESYKWFLDK-----------------------GIKEVFDDIMP----ISDF-----SGK
RPOB_LACDB       TESYKWFLDE-----------------------GVKEVFDDILP----ISDT-----SGR
RPOB_LACPL       TDSYQWFLDE-----------------------GLREMFEDIMP----IDDF-----AGK
RPOB_LACBA       TNSYNWFLDE-----------------------GLRDMFDDIMP----IEDF-----QGN
RPOB_PEDPA       SDSYQWFLDE-----------------------GLREMFNDIMP----IEDF-----AGK
RPOB_LACS1       TDSYKWFLDE-----------------------GLREMFDDIMP----IEDF-----QGK
RPOB_LACSS       SNSYQWFLDE-----------------------GLREMFDDIMP----IDDF-----AGN
RPOB_LACP3       TNSYQWFLDE-----------------------GLKEMFDDIMP----IDDF-----QGK
RPOB_ENTFA       TDSYQWFLDE-----------------------GLREMFEDILP----IDDF-----QGN
RPOB_LEUMM       TASYQWFLND-----------------------GIKEMFGDIMP----IDDF-----QGT
RPOB_OENOB       TASYKWFMDK-----------------------GIKEMFNDIMP----IEDF-----AGK
RPOB_CARHZ       KKSYQWFLDE-----------------------GLREVFREISP----ITDF-----TGN
RPOB_MOOTA       RNSYQWFIDT-----------------------GLRELFHDISP----IQDF-----TGN
RPOB_SYMTH       RNSYQWFLRE-----------------------GLQEMFQDISP----IQDF-----TGN
RPOB_DESHY       QNSYQWFLDE-----------------------GLREMFRDISP----IQDF-----TGN
RPOB_CLOAB       LDSYQWFLDN-----------------------GLQEIFDDINP----IQDY-----TGN
RPOB_CLONN       LNSYDWFWKE-----------------------GLNEVFDDVNP----IQDY-----TGN
RPOB_CLOPS       LDSYKWFLDA-----------------------GLYEVFDDINP----ISNF-----TGN
RPOB_CLOTE       LDSYEWFLQE-----------------------GLQEVFDDINP----IQDY-----TGN
RPOB_HUNT2       KNSYEQFLKE-----------------------GFKEVFKDVNP----ITDY-----TGN
RPOB_CLOD6       VDSYEWFLKE-----------------------GLKEVFDDISP----IEDY-----TGN
RPOB_CALS4       KKSYQWFLEE-----------------------GLKEVFQEISP----IESF-----TGN
RPOB_SYNWW       KNSYDWFLEH-----------------------GLREALQEVFP----ISDF-----TGN
RPOB_ONYPE       NQSFDWFLKH-----------------------GIKELLQDFCP----IESY-----NGD
RPOB_COREF       LDSFAWLIGTPEWRARQQEEF----GEGARITSGLENILEELSP----IQDY-----SGN
RPOB_CORDI       LNSFAWLIGTPEWRARQQEEL----GDSVRVTSGLEDILEELSP----IQDY-----SGN
RPOB_CORJK       RESFAWLVGTPEWRARAQAEA----GEDVRIMSGLEEILEELSP----IEDY-----SEN
RPOB2_NOCFA      TESFAWLIGSPEWRERAAA------RGDVGLVGGLEEVLEELSP----IEDF-----SGS
RPOB_RHOJR       TDSFEWLIGAQSWRERAAA------RGDSAISGGLEDILAELSP----IEDF-----SGS
RPOB_MYCS2       TDSFEWLVGSDRWRQAAID------RGEENPVGGLEEVLAELSP----IEDF-----SGS
RPOB1_NOCFA      TESFGWLIGAPDWCARAAA------RGTE-PVAGLAEVLAEISP----IEDF-----AGT
RPOB_SACEN       VQSFEWLVGDETWFQRRVD------AGDENPVGGLEEVLSEISP----IEDF-----SGS
RPOB_FRAAA       TQSFDWLIGSDAWAERVQEAIDS-GRDDVPITSGLEEVFEEISP----IEDF-----SGS
RPOB_STRCO       TESFDWLLGNDAWKARVESALES-GQD-VPTKSGLEEIFEEISP----IEDF-----SGS
RPOB_THEFY       TESFDWLLGNERWRARVEAARKA-GRKDIPEQSGLEEIFEEISP----IEDF-----SGT
RPOB_ACIC1       IESFDWLVGNDAWKARVEAALAA-GRTDVNTSSGLEEIFEEISP----IEDI-----SGT
RPOB_NOCSJ       TDSFDWLVGNDKWNAAVERRRSE-GED-VSSKSGLQEIFEEISP----IEDF-----SET
RPOB_ARTS2       TDSFDWLVGNERWQARVAKAVEE-GDLSVATSSGLSDIFEEISP----IEDF-----QGT
RPOB_LEIXX       TESFDWLVGNDAWQARVAAAEAQ-GRQDLPAATGLEEIFEEISP----IEDL-----GET
RPOB_CUTAK       VESFNWLVGNEIWQSRVDAALAE-GRTDINTKSGLEEIFEEISP----IEDY-----SQT
RPOB_BIFAA       TDSFDWLIGNERWQKRVQEDLEN-GTNTVPHTSGLDEVFQEISP----IENF-----AQT
RPOB_TROWT       LDSFDWLIGGPRWRVALDAYRKNPSGAPIAEKSGLDEVFDEISP----IEDS-----AGN
RPOB_RUBXD       LSSFQKFMDE-----------------------GIRRTLEDISP----IEDY-----SGS
RPOB_DEHMC       LQSFVWFQEE-----------------------GLRELIEEISP----IKDF-----VGN
RPOB_MYCMS       TETFEWFKTK-----------------------GIQEVLDEFFP----ILS------FDG
RPOB_MESFL       TKTFEWFKTK-----------------------GIDEVLNEFFA----MSS------NDA
RPOB_MYCMO       KKSFKWFIDE-----------------------GINQALNDIYP----IHS------NNG
RPOB_MYCPU       KESFDWFLNK-----------------------AIEATLRKYYP----IKS------SNN
RPOB_MYCS5       KKSYQDFINK-----------------------KIEELLNEIYP----IEA------SNK
RPOB_MYCH2       RESFDWFLHV-----------------------GIPEAFDRIFP----IVS------ANG
RPOB_CITSI       FEGFCRFIDQ-----------------------GLTEELYKFPK----IED------TDQ
RPOB_POPTR       FEGFCRFIDQ-----------------------GLAEELYKFPK----IED------RDQ
RPOB_AETGR       FEGFYRFIDQ-----------------------GLIEEVSKFPK----IED------IDQ
RPOB_OENEH       FEGFCRFIDQ-----------------------GLTEELSKFPK----IEDD-----TDQ
RPOB_NYMAL       FEGFCRFIDQ-----------------------GLMEELHQFPK----IED------TDQ
RPOB_PIPCE       FEGFCRFIDW-----------------------GLAEELHKFPK----IED------TDQ
RPOB_PHAAO       FEGFCRFINQ-----------------------GLTEEFHKFQK----IED------RDQ
RPOB_DIOEL       FEGFCRFINQ-----------------------GLMEELHKFPK----IED------TDQ
RPOB_PHAVU       LEGFCRFIDR-----------------------GLTEGLFKFPK----IED------TDQ
RPOB_LOTJA       FEGFCRFIDR-----------------------GLTEELFKFPK----IED------TDQ
RPOB_JASNU       FEGFCRFIDQ-----------------------GLTEELSKFPK----IED------TDQ
RPOB_LACSA       FEGFCRFIDQ-----------------------GLTEELSKFPK----IED------TNQ
RPOB_SACHY       FEGFCRFINQ-----------------------GLAEELEKFPT----IKD------PDH
RPOB_PELHO       FEGFCRFLDQ-----------------------GLIEELSQFPKGNSFLEYF-----RDE
RPOB_ANTAG       FEGFHRFIKY-----------------------GLVKELNDFPK----IED------TDQ
RPOB_MARPO       FEGFNRFINQ-----------------------GLSEELSNFPI----IED------IDQ
RPOB_PHYPA       FKSYYYFIYK-----------------------NLISELNIFPE----IFD------LNQ
RPOB_PSINU       YEGFKRFINQ-----------------------GLMEELLKFPK----IQD------ADQ
RPOB_ANGEV       FEGFQRFIHQ-----------------------DLVEELTNFPK----IED------IDQ
RPOB_PINTH       FEGFCRFIDQ-----------------------GLMEELHNFPK----IED------IDK
RPOB_CYCTA       FEGFCRFIDQ-----------------------GLIEELQNFPK----IED------TDQ
RPOB_ADICA       FKGFSRFVHQ-----------------------KLLKELENFPK----IED------TDK
RPOB_HUPLU       LEAFHRFINQ-----------------------GIMEELDNFPK----IED------TDQ
RPOB_CHAGL       LQNFYNFLTK-----------------------IIYKELKAFPK----IYD------SEH
RPOB_CHAVU       LESFHRFIEK-----------------------GLLEEFQRFPV----IRD------SSG
RPOB_STAPU       IESFRRFLHN-----------------------CIFEELSKFPI----IYD------SNQ
RPOB_ZYGCR       IDSFRHFLTD-----------------------LLRLELQRFGT----IKH------ANQ
RPOB_NEPOL       RDSFLLFLER-----------------------GLATELSHVTPLTGSHF----------
RPOB_OSTTA       RDSFRYFLET-----------------------GIREELDFFSPIVGQSLGSSSKRPTDR
RPOB_MESVI       LSSFRIFLKK-----------------------GLIEELKDFSV----ISN------SKK
RPOB_CHLAT       LESFSTFLKK-----------------------GLIEQLRDFSV----ITD------PTN
RPOB_OLTVI       RNSFSQFLES-----------------------GLIQEISKRNP----ITN------STK
RPOB_BIGNA       RKSFLTFLKY-----------------------GIKKEIKKLDI----TKN------KKK
RPOB_PHATC       RISFCWFITQ-----------------------GLTEELALFSR----IQD------FSQ
RPOB_THAPS       RVSFCWFIAQ-----------------------GLNEELNTFSR----IYD------FSQ
RPOB_TRIV2       RSSFRWFLEE-----------------------GLIEELNSFSP----ITD------YTG
RPOB_TRIEI       RASFRWFLEY-----------------------GLIEELDSYSP----ITD------YTG
RPOB_SYNY3       HASFHWFLEE-----------------------GLIEELNSFSP----ISD------YTG
RPOB_SYNE7       RNSFRWFLEE-----------------------GLIEELESFSP----ITD------YTG
RPOB_THEEB       RASFRWFLEE-----------------------GLIEELESFSP----ITD------YTG
RPOB_SYNJA       RESFLWFLRE-----------------------GFEEELLSFSP----IVD------YTG
RPOB_GLOVI       RESFRWFLEE-----------------------GLIEELLSFSP----ITD------YTG
RPOB_PROM5       RASFKWFLEK-----------------------GLIEELKSFSP----ITD------YTG
RPOB_GUITH       RASFCWFLNE-----------------------GLAEEIQSFSP----IVN------YTG
RPOB_RHDSA       RASFCWFLEE-----------------------GLAEEIKSFSP----ITD------YTG
RPOB_PYRYE       RASFKWFLLE-----------------------GLTEVLEIFPK----ISD------PTS
RPOB_GRATL       KESFKSFLLE-----------------------GLSEVLDSFPI----IVD------PTG
RPOB_CYAPA       KASFKWFFEE-----------------------GLIEEIENFSP----VID------LRG
RPOB_CYACA       RESFYSFLTE-----------------------GLAKELNNFSP----IID------YTG
RPOB_EMIHU       RASYCWFLEK-----------------------GFVQELRTFSV----IRD------YLG
RPOB_EUGLO       SKSFKNFLKIGIINE----------------LKKIQKIIHSNFEI------------NFH
                    :                                                    .   

RPOB_MYCGE       RG----------------LHRTE-------------------------------------
RPOB_MYCPN       KG----------------LRRTA-------------------------------------
RPOB_MYCGA       HG----------------MKILD-------------------------------------
RPOB_MYCPE       IG----------------MKLEK-------------------------------------
RPOB_UREPA       KG----------------LKIKQ-------------------------------------
RPOB_ALKEH       TAALEYVS----------YRIG--------------------------------------
RPOB_HALHL       NAELQYVS----------YRIG--------------------------------------
RPOB_METCA       NIVLEYVS----------YRLG--------------------------------------
RPOB_XANC8       NAALEYVG----------YKLG--------------------------------------
RPOB_XYLFT       NAALEYVG----------YKLG--------------------------------------
RPOB_LEGPA       NARLEYVG----------YKLG--------------------------------------
RPOB_COXBU       YAVLEYVG----------YSLGGE------------------------------------
RPOB_NITOC       YAELQYSS----------YHLG--------------------------------------
RPOB_AROAE       NARLEFVQ----------YMLG--------------------------------------
RPOB_AZOSB       NARLEFVQ----------YMLG--------------------------------------
RPOB_METFK       NARLDFVS----------YNLG--------------------------------------
RPOB_NITEC       NARLDFIS----------YMLG--------------------------------------
RPOB_NITMU       NARLDFVN----------YVLG--------------------------------------
RPOB_THIDA       NARLEYVS----------YQLG--------------------------------------
RPOB_DECAR       NARLEFVS----------YMLG--------------------------------------
RPOB_PARXL       FARLEFVS----------YMLS--------------------------------------
RPOB_HERAR       FARLEFLS----------YVLG--------------------------------------
RPOB_RALSO       LARMEFVS----------YHLS--------------------------------------
RPOB_BORA1       MARLEFVS----------YALG--------------------------------------
RPOB_RHOFT       FVEMKYLE----------YNLA--------------------------------------
RPOB_POLSJ       FVEMKFIE----------YNLA--------------------------------------
RPOB_VEREI       FVEMKFIE----------YNLA--------------------------------------
RPOB_METPP       FVEMKYIE----------FNMA--------------------------------------
RPOB_NEIG1       YARLEFVY----------YTLG--------------------------------------
RPOB_CHRVO       YARLDFAH----------YVLG--------------------------------------
RPOB_ACIBT       NAALEFVE----------YSLG--------------------------------------
RPOB_PSYCK       NAELQFVE----------YYLG--------------------------------------
RPOB_HAHCH       NAALEYVS----------YRLG--------------------------------------
RPOB_MARHV       NAALEYVS----------YRIG--------------------------------------
RPOB_SACD2       NAALEYVS----------YALG--------------------------------------
RPOB_PSEU5       NAALEYVG----------YRLG--------------------------------------
RPOB_CHRSD       NAALEYVS----------YRFG--------------------------------------
RPOB_ALCBS       NAALEYAG----------YEFG--------------------------------------
RPOB_SODGM       NSELQYVS----------YRLG--------------------------------------
RPOB_ECOLI       NSELQYVS----------YRLG--------------------------------------
RPOB_BAUCH       NAELQYVS----------YHLG--------------------------------------
RPOB_BLOFL       NAELRYLD----------YKLG--------------------------------------
RPOB_BLOPB       NAELQYIK----------YQLG--------------------------------------
RPOB_BUCAI       NSELQYVS----------YRLG--------------------------------------
RPOB_BUCAP       NSELQYVS----------YRLG--------------------------------------
RPOB_BUCBP       NSELQYIN----------YKLG--------------------------------------
RPOB_WIGBR       NAELKYIS----------YRLG--------------------------------------
RPOB_BUCCC       CAELQYVS----------YTLG--------------------------------------
RPOB_ACTP2       STELQYVS----------YELG--------------------------------------
RPOB_MANSM       STELQYVS----------YKLG--------------------------------------
RPOB_HAEI8       YTELQYVD----------YRLE--------------------------------------
RPOB_ALIF1       NSKLEYVS----------YNLRE-------------------------------------
RPOB_PHOPR       NSELQYVS----------YRLG--------------------------------------
RPOB_VIBCH       NSELQYVS----------YRLG--------------------------------------
RPOB_AERS4       SAELQYVS----------YRLG--------------------------------------
RPOB_COLP3       SSELQYVS----------YRLG--------------------------------------
RPOB_PSEA6       NAELQYVS----------YRLG--------------------------------------
RPOB_PSEHT       NSELQYVS----------YRIG--------------------------------------
RPOB_SHEAM       NSELQYVS----------YKLG--------------------------------------
RPOB_IDILO       TAELQYVS----------YHMG--------------------------------------
RPOB_PSYIN       TSELQYVS----------YRLG--------------------------------------
RPOB_DICNV       MVELQFVG----------YEFG--------------------------------------
RPOB_HYDCU       TADLEYVS----------YTMG--------------------------------------
RPOB_VESOH       YAQIEYVD----------YQLK--------------------------------------
RPOB_FRATO       QYELHYVD----------YQIG--------------------------------------
RPOB_RHIL3       ASMLEFVS----------YEFEP-------------------------------------
RPOB_RHIME       ASMLEFVS----------YEFEA-------------------------------------
RPOB_AGRFC       ASMLEFVS----------YEFEA-------------------------------------
RPOB_RHILO       SSMLEFVK----------YEFEG-------------------------------------
RPOB_CHESB       TAMLEFVK----------YEFEA-------------------------------------
RPOB_BRUSU       ASMLEFVR----------YEFDP-------------------------------------
RPOB_BARBK       TAMLEFVR----------YEFDA-------------------------------------
RPOB_RHOPB       TSMLEFVR----------YEFEP-------------------------------------
RPOB_GLUOX       RGRLDFMS----------YEFED-------------------------------------
RPOB_GRABC       RGRLEFVN----------YELEE-------------------------------------
RPOB_MAGSA       RGTLEFVR----------YELEQ-------------------------------------
RPOB_RHORT       KGELEFVA----------YELEE-------------------------------------
RPOB_CAUVC       RAVLEYVS----------YEFEE-------------------------------------
RPOB_MARMM       RAVLDFVS----------YEFEP-------------------------------------
RPOB_HYPNA       RATLEYVS----------YEFEQ-------------------------------------
RPOB_RHOS1       TAVLEFVK----------YELEK-------------------------------------
RPOB_PARDP       TATLEFVK----------YELEK-------------------------------------
RPOB_ROSDO       TSVLEYVK----------YELEK-------------------------------------
RPOB_JANSC       TAILEFVK----------YELET-------------------------------------
RPOB_NOVAD       TASLDIKEKD-------GYVLES-------------------------------------
RPOB_ERYLH       TAELDFVH----------YELEP-------------------------------------
RPOB_SPHAL       TAELDFVH----------YELEA-------------------------------------
RPOB_ZYMMO       VAELDFVQ----------YELEE-------------------------------------
RPOB_PELUB       KATLEYVS----------YRLEK-------------------------------------
RPOB_RICBR       IANLEFVK----------YEFDT-------------------------------------
RPOB_ORITB       SAILEFVR----------YDFDE-------------------------------------
RPOB_ANAMM       RAVLEFVG----------YNIGE-------------------------------------
RPOB_ANAPZ       RAVLEFVS----------CNIGE-------------------------------------
RPOB_EHRRW       RAVLQFVS----------YSIGE-------------------------------------
RPOB_NEOSM       RASLEFVS----------CRMGE-------------------------------------
RPOB_MAGMM       TVSLEYVS----------YALGE-------------------------------------
RPOB_ANADE       TSSLEFVS----------YHLEK-------------------------------------
RPOB_MYXXD       TSSLEFVS----------YHLER-------------------------------------
RPOB_SYNFM       TASLEFVQ----------YSFGE-------------------------------------
RPOB_SYNAS       KCSLEFVS----------YKIGA-------------------------------------
RPOB_GEOSL       TASLEYVT----------YTLGA-------------------------------------
RPOB_PELPD       SASLEYVS----------YSLSK-------------------------------------
RPOB_PELCD       TCSLDYVS----------YSLGT-------------------------------------
RPOB_BDEBA       TASLEFVS----------YTLEP-------------------------------------
RPOB_DESPS       LCSLEFLK----------YKFGE-------------------------------------
RPOB_DESVV       TASLEFVS----------YEVGE-------------------------------------
RPOB_DESAG       TASLEYVS----------YEIGE-------------------------------------
RPOB_LAWIP       TSSLEFVN----------YKIGE-------------------------------------
RPOB_KORVE       VSQLEFVD----------YAIGNWECKCGHLKGLHHLRTTCKNCGATVVTDPFHPGDVLC
RPOB_SOLUE       VSDLEFVD----------YSIGNWECKCGNLKGLHHLRSTCRNCGATIRTDPFHAGDILC
RPOB_CAMJJ       RLSLEYVS----------SEIGK-------------------------------------
RPOB_CAMFF       RLTLEYVS----------SEISK-------------------------------------
RPOB_SULDN       RLTVEYID----------SEVGK-------------------------------------
RPOB_BACV8       NFVLEFLD----------YYIDP-------------------------------------
RPOB_PARD8       NFVLEFLD----------YYIDP-------------------------------------
RPOB_PORGI       NFVLEFLD----------YYIDP-------------------------------------
RPOB_FLAPJ       NFVLEFID----------YFVDP-------------------------------------
RPOB_GRAFK       QFVLEFLD----------YFVDP-------------------------------------
RPOB_CYTH3       NFILDFID----------YNIDT-------------------------------------
RPOB_SALRD       RYTLEFVN----------YELDA-------------------------------------
RPOB_PELLD       LYLLEYIS----------YSFDK-------------------------------------
RPOB_CHLPD       LYLLEYIS----------YSFDK-------------------------------------
RPOB_CHLCH       LYLLEYIS----------YAFDK-------------------------------------
RPOB_CHLTE       LYLLEYIS----------YSFDK-------------------------------------
RPOB_CHLMU       ATILEYLS----------YNLGV-------------------------------------
RPOB_CHLPN       ATVLEYLS----------YNLGV-------------------------------------
RPOB_PARUW       KTILEFLS----------YNLGV-------------------------------------
RPOB_RHOBA       NTTLEYLY----------YELGK-------------------------------------
RPOB_TREDE       DMALQYLSYSLDYD--S-------------------------------------------
RPOB_TREPA       DMTLEYQSYSLDEK--N-------------------------------------------
RPOB_BORAP       DVALEYERYYIEND--T-------------------------------------------
RPOB_LEPBL       DMIMEYSHYILGEP----------------------------------------------
RPOB_FUSNN       DVRLEYIGYELHEA--E-------------------------------------------
RPOB_CYAM1       QLELHLITSKMELK--P-------------------------------------------
RPOB_AQUAE       NFILEYLG----------YEIGDWECNRCGYKPKDD------------------------
RPOB_DEIRA       GMVLDFIE----------YRLGE-------------------------------------
RPOB_DEIGD       GLVLDFLE----------YRLGE-------------------------------------
RPOB_THET8       GLVLDFLE----------YRLGE-------------------------------------
RPOB_THEMA       GFALEFVS----------TRTGE-------------------------------------
RPOB_BACCR       -LSLEFID----------YSLG--------------------------------------
RPOB_BACSU       -LSLEFID----------YSLG--------------------------------------
RPOB_BACHD       -LVLEFID----------YSLG--------------------------------------
RPOB_GEOTN       -LSLEFID----------YSLG--------------------------------------
RPOB_OCEIH       -LSLEFVD----------YSLG--------------------------------------
RPOB_LISIN       -LSLEFID----------YDLG--------------------------------------
RPOB_STAS1       -LSLEFVD----------YRLG--------------------------------------
RPOB_STRS2       -MELEFVG----------YELK--------------------------------------
RPOB_LACLA       -MELEFVG----------YEMK--------------------------------------
RPOB_LACGA       -LSLEFVD----------YKLL--------------------------------------
RPOB_LACAC       -LSLEYVG----------YKLQ--------------------------------------
RPOB_LACDB       -LTLEYVD----------YKLQ--------------------------------------
RPOB_LACPL       -LSLEFVD----------YQLL--------------------------------------
RPOB_LACBA       -LSLEFVD----------YQLL--------------------------------------
RPOB_PEDPA       -LSLEFVD----------YQLL--------------------------------------
RPOB_LACS1       -LSLEFVD----------YQLL--------------------------------------
RPOB_LACSS       -LSLEFVD----------YQLL--------------------------------------
RPOB_LACP3       -LSLEFVG----------YQLL--------------------------------------
RPOB_ENTFA       -LSLEFVD----------YELK--------------------------------------
RPOB_LEUMM       -LSLEYVD----------YQLM--------------------------------------
RPOB_OENOB       -LSLEYVD----------YSLG--------------------------------------
RPOB_CARHZ       -LSLEFLD----------YYLG--------------------------------------
RPOB_MOOTA       -LILQFVD----------YSLG--------------------------------------
RPOB_SYMTH       -LVLEFID----------YSLG--------------------------------------
RPOB_DESHY       -LVLEFID----------YSLG--------------------------------------
RPOB_CLOAB       -LILEFIG----------YKLDM-------------------------------------
RPOB_CLONN       -LILEFID----------YNLDK-------------------------------------
RPOB_CLOPS       -LVLEFVG----------YTLDM-------------------------------------
RPOB_CLOTE       -LSLEFVG----------YKLDM-------------------------------------
RPOB_HUNT2       -LILEFVD----------YSLD--------------------------------------
RPOB_CLOD6       -LILEFVD----------YSLD--------------------------------------
RPOB_CALS4       -LALEFVD----------YRLE--------------------------------------
RPOB_SYNWW       -LELGFLD----------YSMG--------------------------------------
RPOB_ONYPE       -LKIHFDD----------YFLA--------------------------------------
RPOB_COREF       -MSLSLSE----------PRFE--------------------------------------
RPOB_CORDI       -MSLSLSE----------PRFE--------------------------------------
RPOB_CORJK       -MSLTLSE----------PRFD--------------------------------------
RPOB2_NOCFA      -MSLSFSD----------PRFE--------------------------------------
RPOB_RHOJR       -MSLSFSD----------PRFD--------------------------------------
RPOB_MYCS2       -MSLSFSD----------PRFD--------------------------------------
RPOB1_NOCFA      -MSLTLSD----------PRFE--------------------------------------
RPOB_SACEN       -MSLSFSD----------PRFD--------------------------------------
RPOB_FRAAA       -MSLSFRD----------HRFE--------------------------------------
RPOB_STRCO       -MSLTFRD----------HRFE--------------------------------------
RPOB_THEFY       -MSLSFRD----------HRFE--------------------------------------
RPOB_ACIC1       -MSLSFRD----------HRFE--------------------------------------
RPOB_NOCSJ       -MSLSFEN----------PVFY--------------------------------------
RPOB_ARTS2       -MSLSFSD----------PEFA--------------------------------------
RPOB_LEIXX       -MQLSFTN----------PFLE--------------------------------------
RPOB_CUTAK       -MSLSFRD----------HRFE--------------------------------------
RPOB_BIFAA       -MSLTFSD----------PYFE--------------------------------------
RPOB_TROWT       -MQLNFSK----------PVLE--------------------------------------
RPOB_RUBXD       -YAVEFGE----------HRFE--------------------------------------
RPOB_DEHMC       RLELEFIG----------YEFR--------------------------------------
RPOB_MYCMS       SSVLTLENWG--------FKEP--------------------------------------
RPOB_MESFL       SASLFLEGWE--------IKEA--------------------------------------
RPOB_MYCMO       KVIIEYVNNS--------AKLE--------------------------------------
RPOB_MYCPU       KVEIKYVLGS--------KRIE--------------------------------------
RPOB_MYCS5       EASLEYEKKS--------VKFELPF-----------------------------------
RPOB_MYCH2       KLEISFRRGS--------LRVE--------------------------------------
RPOB_CITSI       EIEFQLFV--------ETYQLVE-------------------------------------
RPOB_POPTR       EIEFQLFV--------ETYQLVE-------------------------------------
RPOB_AETGR       EIEFQLFV--------ETYQLVE-------------------------------------
RPOB_OENEH       EIEFQLFV--------ETYHLVE-------------------------------------
RPOB_NYMAL       EIEFQLFG--------ESYQLVE-------------------------------------
RPOB_PIPCE       EIEFQLFV--------ETYQLAE-------------------------------------
RPOB_PHAAO       EIEFQLFV--------ETYQLVE-------------------------------------
RPOB_DIOEL       EIEFQLFV--------ETYQLVE-------------------------------------
RPOB_PHAVU       EIEFQLFA--------ETYQLLE-------------------------------------
RPOB_LOTJA       EIEFQLFV--------ETYQLVE-------------------------------------
RPOB_JASNU       EIEFQLFM--------ERYQLVE-------------------------------------
RPOB_LACSA       EIDFELFL--------ERYQLVE-------------------------------------
RPOB_SACHY       EIAFQLFA--------KGYQLLE-------------------------------------
RPOB_PELHO       EIDFQLFS--------KTYHLVK-------------------------------------
RPOB_ANTAG       EFEFQLFS--------RQYQLAE-------------------------------------
RPOB_MARPO       EFEFQIFG--------EQYKLAE-------------------------------------
RPOB_PHYPA       EFQFELLN--------KEYKLIK-------------------------------------
RPOB_PSINU       EVEFLLVG--------DQYKLRE-------------------------------------
RPOB_ANGEV       EVEFRLFG--------ERYRLTE-------------------------------------
RPOB_PINTH       EIEFRLFG--------NEYELAE-------------------------------------
RPOB_CYCTA       EIESQLFG--------NKYELAE-------------------------------------
RPOB_ADICA       EVEFRSIG--------NQYQLTE-------------------------------------
RPOB_HUPLU       EFEFQLFG--------EKYYLLE-------------------------------------
RPOB_CHAGL       NFEFKIYP--------EEFFLVE-------------------------------------
RPOB_CHAVU       ELSYFLNG--------KRYKLQE-------------------------------------
RPOB_STAPU       GIEFKLIP--------EKYLLTE-------------------------------------
RPOB_ZYGCR       QLEFKLLG--------ELYRLEI-------------------------------------
RPOB_NEPOL       --RITLCS--------HGYRLKR-------------------------------------
RPOB_OSTTA       FISVSFHS--------KDFYFKK-------------------------------------
RPOB_MESVI       NLELRFFP--------EKYKLKR-------------------------------------
RPOB_CHLAT       NLELRLLV--------EQYKLKR-------------------------------------
RPOB_OLTVI       ELELCFYP--------QYYKLSP-------------------------------------
RPOB_BIGNA       ---LLVYP--------NLFQLNL-------------------------------------
RPOB_PHATC       NTEYVMFG--------EEYSLIK-------------------------------------
RPOB_THAPS       NTEYVLFG--------QEYSLVK-------------------------------------
RPOB_TRIV2       KLELHFL--------GHNYKLKE-------------------------------------
RPOB_TRIEI       KLELHFI--------AKNYKLKQ-------------------------------------
RPOB_SYNY3       KLELHFL--------GKDYKLKQ-------------------------------------
RPOB_SYNE7       KLELHFL--------GKQYKLKR-------------------------------------
RPOB_THEEB       KIELHFL--------AKDYRLKE-------------------------------------
RPOB_SYNJA       KLELHFLPEYRPGDPSKGYKINK-------------------------------------
RPOB_GLOVI       KMELHFL---------QDYKLKE-------------------------------------
RPOB_PROM5       KLELHFI--------GEEYRLKR-------------------------------------
RPOB_GUITH       NLELHLF--------GDQYTLRY-------------------------------------
RPOB_RHDSA       NLELHFF--------GDQFKLKC-------------------------------------
RPOB_PYRYE       RLELQLF--------GNEYKIKF-------------------------------------
RPOB_GRATL       KLELQFF--------GKDYKLKF-------------------------------------
RPOB_CYAPA       NFEVHFY--------LKNYELEA-------------------------------------
RPOB_CYACA       KLELHLV--------TNQLVIKK-------------------------------------
RPOB_EMIHU       DLELNFA--------TKFYTINP-------------------------------------
RPOB_EUGLO       INALKYKK----------------------------------------------------
                                                                             

RPOB_MYCGE       ------------------------PERDEAQSRAQSK-TYEVGIYADLELVDNDKGTVKK
RPOB_MYCPN       ------------------------PERNEAQSRSESK-TYEIGIYADLELIDSATGTIKK
RPOB_MYCGA       ------------------------PQITKEEASAESK-TYDASLYVNLSLVNHQTGTVKK
RPOB_MYCPE       ------------------------PKRSEKEARNEGK-TYDRPLYVDLAIVDNESGEVKK
RPOB_UREPA       ------------------------PTKDESACRDEGK-TFETPIYIDLELTDNYTGEVKR
RPOB_ALKEH       -----------------------DPGFDVKECQSRGL-TYAAPLRMLVRLVIYDKDG---
RPOB_HALHL       -----------------------DPPFEVKECQSRGL-TYAAPLRMLVRLALYDKEG---
RPOB_METCA       -----------------------DPVFDVKECQQRGT-TYAAPLRVLVRLVVYDKDAPVG
RPOB_XANC8       -----------------------EPVFDERECRQRGM-SYGAPLRVTVRLVIYDRESS--
RPOB_XYLFT       -----------------------EPMFDERECRQRGM-SYGAPLRVTVRLVIYDRESS--
RPOB_LEGPA       -----------------------EPAFDVRECKLRGL-TYSAPLRVKIRLVVLDKDASDD
RPOB_COXBU       -----------------------STLFDVEECKLRGL-TYAAPLKVNMRLVIYDKEAPAG
RPOB_NITOC       -----------------------VPSFEVKECQVRGL-TYAAPLRVKLRLVIYDKESPAS
RPOB_AROAE       -----------------------EPAFDVKECQQRGL-TFASPLRARVRLVILDRDAPKE
RPOB_AZOSB       -----------------------EPAFDVKECQQRGL-TFASPLRARVRLVIMDREAPKE
RPOB_METFK       -----------------------QEPFDVKECQQRGL-TYAAPLRVKVRLTIMDKEASKP
RPOB_NITEC       -----------------------TSVFDVKECQQRGL-TYASPLRARVRLTIMDKEASKP
RPOB_NITMU       -----------------------APPFDVKECQQRGL-TYASPLRAKVRLTIMDKEASKP
RPOB_THIDA       -----------------------EPVFDIKECQQRGL-TYCAPLRAKVRLVIMDKEASKP
RPOB_DECAR       -----------------------EPAFDVTECQQRGL-TFASSLRARVRLVIMDREAPD-
RPOB_PARXL       -----------------------PPAFNIKECQQRGL-TYCSALRAKVRLVLLDKESPSK
RPOB_HERAR       -----------------------DPPFNIKECQQRGL-TYASPLRAKVRLVILDKESPTK
RPOB_RALSO       -----------------------NPPFDVKECQQRGL-TFHSALRAKVRLIINDRENPTK
RPOB_BORA1       -----------------------EPVFDVKECQQRGL-TYASPLRAKVRLVLLDRE-VSK
RPOB_RHOFT       -----------------------KPAFDVRECQTRGL-TFASAVRAKVQLFIYDRESSTS
RPOB_POLSJ       -----------------------KPAFDVRECQTRGL-TFASAVRAKVQLIIYDRESSTS
RPOB_VEREI       -----------------------RPAFDVRECQTRGL-TFASAVRAKVQLIIYDRESSTS
RPOB_METPP       -----------------------KPAFDTRECQQRGL-TYAAAVRAKLQMIIYDRETSTS
RPOB_NEIG1       -----------------------EPLFDIPECQLRGI-TYAAPLRARIRLVILDKEASKP
RPOB_CHRVO       -----------------------EPPFDVQECQLRGI-TFAAPLRARIRLTIFDKESSKP
RPOB_ACIBT       -----------------------KPEFDVRECILRGS-TYAAPMRVKIRLIIKDRETK--
RPOB_PSYCK       -----------------------TPEFDERECILRGS-TFAAPMRVKIRLIIKDKDSKDK
RPOB_HAHCH       -----------------------QPVFDVAECQLRGV-TYAAPLRVKVRLIIYDKESSTK
RPOB_MARHV       -----------------------EPVFDVKECQLRGV-TYAAPLRVKVRLIIYDKESSNK
RPOB_SACD2       -----------------------KPVFDVKECVLRGA-TYAVPLRVKVRLIIYDKDSSSK
RPOB_PSEU5       -----------------------EPAFDVKECVLRGV-TFAVPLRVKVRLIIFDKESSNK
RPOB_CHRSD       -----------------------TPAFDVKECQLRGV-TYSAPLRVKVRLIIYDKDSSTK
RPOB_ALCBS       -----------------------KPVFDVKECIIRGT-TYAAPLRVRIRLVIYDRESSG-
RPOB_SODGM       -----------------------EPVFDVKECQIRGV-TFSAPLRVKLRLIIYEREA-PE
RPOB_ECOLI       -----------------------EPVFDVQECQIRGV-TYSAPLRVKLRLVIYEREA-PE
RPOB_BAUCH       -----------------------EPVFDVKECQTRGL-TFSAPLRVILRLIIRDAT----
RPOB_BLOFL       -----------------------EPVFDVKECQIRGM-TFAAPLRVQLCLVIYERDGSAY
RPOB_BLOPB       -----------------------EPTFDVKECQTRGA-TFSAPLRVRLCLIIYEREG-LN
RPOB_BUCAI       -----------------------ETIFDVKECQIRGA-TYSAALRVKLRLVIYERDIL-E
RPOB_BUCAP       -----------------------DAIFDVKECQIRGA-TYSAPLRVRLRLVIYERDVL-E
RPOB_BUCBP       -----------------------QPIFNVKECQTRGM-TYSSPLRVKLRLVIYEKETL-D
RPOB_WIGBR       -----------------------CSVFNVKECQTRGT-TFSAPLRVILQLIIYCDES--K
RPOB_BUCCC       -----------------------KKLFDMYESKTRGT-TYSVPLRVKLQLIIYEKDSK-N
RPOB_ACTP2       -----------------------EPVFDVRECQIRGT-TYAAPLRVKLRLVTFDREAA-A
RPOB_MANSM       -----------------------EPVFDVRECQIRGT-TFAAPLRVNLRLVSYDRDAA-P
RPOB_HAEI8       -----------------------EPEFDVRECQIRGS-TYAAGLRVKLRLVSYDKESS-S
RPOB_ALIF1       ------------------------PEFDVKECQIRGV-TYSAPLRVKLRLVVYDKDAPAN
RPOB_PHOPR       -----------------------EPVFDVKECQIRGV-TYSAPLRVKLRLVMYDKDAP-A
RPOB_VIBCH       -----------------------EPVFDVKECQIRGV-TYSKPLRVKLRLVIFDKDAP-A
RPOB_AERS4       -----------------------EPVFDVKECQIRGV-TYSAPLRVKLRMVLYDREAA-A
RPOB_COLP3       -----------------------EPLFDVKECQIRGV-TYSAPLRVKLRLVVYDKEAA-A
RPOB_PSEA6       -----------------------EPVFDVKECQIRGV-TFSAPLRVKLRLVLFDREAA-P
RPOB_PSEHT       -----------------------EPVFDVKECQIRGV-TYSAPLRVKLRLVVMDKEA--P
RPOB_SHEAM       -----------------------EPVFDVKECQIRGV-TYSAPLRVKLRMVLFDREAA-P
RPOB_IDILO       -----------------------EPAFDVEECQIRGI-TYSAPLRVKLRLVLFDKEAA-A
RPOB_PSYIN       -----------------------EPVFDVKECQIRGV-TYSASLRVKLRLVIYDRDAP-A
RPOB_DICNV       -----------------------KPEFDVRECQLRGV-TYAAPLRVRMRLAIYDKNSTKK
RPOB_HYDCU       -----------------------QPEFDVKECKQRGV-TYSSPLRVKMRLVLFDKDAPAG
RPOB_VESOH       -----------------------EPKFNVEECKLRGV-TFASTLRVKLNLVLFDKNGSTL
RPOB_FRATO       -----------------------EPTFDETECQVRGA-TYDAPLNVKLRLVVYNKDALPN
RPOB_RHIL3       ------------------------PKFDVDECRQRDL-TYAAPLKVTLRLIVFDIDE---
RPOB_RHIME       ------------------------PKFDVEECRQRDL-TYAAPLKVTLRLIVFDIDE---
RPOB_AGRFC       ------------------------PKFDVEECRQRDL-TYAAPLKVTLRLIVFDIDE---
RPOB_RHILO       ------------------------PKFDVDECRQRDL-TYAAPLKVTLRLIVFDIDE---
RPOB_CHESB       ------------------------PKFDTEECRQRDL-TYAAPLKVTLRLIVFDIDE---
RPOB_BRUSU       ------------------------PKFDVDECRQRDL-TYSAPLKVTLRLIVFDIDE---
RPOB_BARBK       ------------------------PKFDVEECRQRDL-TYAAPLKVILRLIVFDIDE---
RPOB_RHOPB       ------------------------PKYDVDECRQRGM-TYAAPLKVTLRLIVFDIDE---
RPOB_GLUOX       ------------------------PKYDVEECIQRGL-TYAAPLKVILRLTTWDIDE---
RPOB_GRABC       ------------------------PKYDVEECIQRGM-TFAAPLKVILRLIVWDVDE---
RPOB_MAGSA       ------------------------PKYDVEECQQRGM-TFAAPLKVTLRLVVWDIDE---
RPOB_RHORT       ------------------------PKYDTDECQQRGM-TFAAPLKVTLRLLVWDVDE---
RPOB_CAUVC       ------------------------PKYDVEECIQRDM-TFAAPLKVKLRLIVFETEE---
RPOB_MARMM       ------------------------PKFDVEECQQRDM-TFAAPLKVKMRLIVFDVDE---
RPOB_HYPNA       ------------------------PKFDVEECVQRDL-TFQAPLKVRLQLVVFDVDE---
RPOB_RHOS1       ------------------------PKYDVDECQQRDM-TYAAPLKVTLRLIVFDVDE---
RPOB_PARDP       ------------------------PKYDVEECQSRDM-TYAAPLKVTLRLIVFDVDE---
RPOB_ROSDO       ------------------------PKYDVEECQQRDM-TYSAPLKVTLRLIVFDVDE---
RPOB_JANSC       ------------------------PKFDVEECQQRDL-TYAAPLKVTLRLIVFDIDE---
RPOB_NOVAD       ------------------------PKYDVNECRQRGI-TYAAPMKVTLKLATFEVDA---
RPOB_ERYLH       ------------------------PKYDTTECRQRGI-TYAAPMKVTLRLIVFEVDQ---
RPOB_SPHAL       ------------------------PKYDVEECRQRGI-TYAAPMKVTLRLIVFEVDS---
RPOB_ZYMMO       ------------------------PKFDVDECRQRGI-TYAAPMRVTLRLIVFEVDP---
RPOB_PELUB       ------------------------PKFDTEECIQRGL-SFTSALKCTLRLVVYEIDQ---
RPOB_RICBR       ------------------------PKYDVEECTQRSL-SYDSALKVTLRLSIWDIDE---
RPOB_ORITB       ------------------------PKYDVEECIQRGL-SYTAALKITLSLIVLDDSD---
RPOB_ANAMM       ------------------------PQYDEYECIKRGI-TFSVPIRITLRFVVWKVQEVSF
RPOB_ANAPZ       ------------------------PQYDEYECIKRGI-TFSVPMRITLRFVVWKVQEVSF
RPOB_EHRRW       ------------------------PQYDEYECIKRGI-TYSVPIRIVLRFIVWKVQEVSF
RPOB_NEOSM       ------------------------PKHDEYGCVERGI-TYSAPLRAILRLVVFGDETSGE
RPOB_MAGMM       ------------------------PKYDVDECLQRGM-TFSAPLKVAFRLVIWDENE---
RPOB_ANADE       ------------------------PKYDVDECHQRGM-TYSAPIKVVVRLVVWDKDEETG
RPOB_MYXXD       ------------------------PKYDVDECHQRGM-TYSAPIKVVVRLVVWDKDEETG
RPOB_SYNFM       ------------------------VKYEVEECLARGM-TYEAPVKIVVRLVVYDVDKEAG
RPOB_SYNAS       ------------------------VRYDVNECIQKGM-TYAAPLKIVVRLVVFDTDRLSD
RPOB_GEOSL       ------------------------PKYDVEECHQRGM-TFAAPMKVKVRLVVWDVNKDTG
RPOB_PELPD       ------------------------PKYDVVECHQRGM-TFAAPMKVKVRLVIWDTGKESG
RPOB_PELCD       ------------------------PKYDVGECHQRGM-TFAAPVKVCVRLVSWDVDKESG
RPOB_BDEBA       ------------------------AKYDVDECRQRGM-TFAAPIKVTLRLIVFDVDEETE
RPOB_DESPS       ------------------------PKYTVQECQQRGM-SYEIPLKIVVRLITFDVDEETG
RPOB_DESVV       ------------------------PKYDQPECISKGL-TYEAPIRIKVRLVVYDVDEDSG
RPOB_DESAG       ------------------------PKYDQAECISKGL-TYEAPIRIKVRLVVYDVDEDSE
RPOB_LAWIP       ------------------------PKYDQAECIAKGL-TYEAPIRIKVRLIIYDVDSDTE
RPOB_KORVE       HKCGTFNANTPDFCNKCGDPVGLQLKYDVAECEERGM-TYSAPLKVTMRLTIFDKDPETN
RPOB_SOLUE       HHCGTFNKNVVTFCNKCGDPVGLQLKYDMQECQERGM-TYAAPLKVTIRLTVYSKDPETQ
RPOB_CAMJJ       ------------------------PKYTIRECMERGL-TYSVNLKMKIRLTLHEKDEKTG
RPOB_CAMFF       ------------------------PRYTVRECMERGL-TYCVNLKIKIRLIVHDRDEKTS
RPOB_SULDN       ------------------------PKYTVRECMERGL-TYAVSLRMKTRLILWDRDENTK
RPOB_BACV8       ------------------------PHYSIDECLERGL-TYSVPLKAKLKLYCTDPD----
RPOB_PARD8       ------------------------PRYCIDECIARGL-TYSVPLKAKLKLYCTDPD----
RPOB_PORGI       ------------------------PKYSIEECLSRGL-TYSVPLKAKLKLYCTDPD----
RPOB_FLAPJ       ------------------------PRYTIQECIERGL-TYSVPLKARLKLYCTDPE----
RPOB_GRAFK       ------------------------PRYSIQECIERGL-TYSVPLKARLKLYCTDPE----
RPOB_CYTH3       ------------------------PKYNVDECIDRGL-TYAVPLKAKLRLTCNDKD----
RPOB_SALRD       ------------------------PKHTVEECIAQGL-TYSIPLKATLRLTSKEEEGG--
RPOB_PELLD       ------------------------PKYTVEDCIERGL-TYDVSLKVKLKLSYKDEADE--
RPOB_CHLPD       ------------------------PKYTVEDCIERGL-TYDVSLKVKLKLSYKDEPDE--
RPOB_CHLCH       ------------------------PKYTVEECIERGL-TYDVSLKVKLKLSYKDEADE--
RPOB_CHLTE       ------------------------PKYTVEECIERGL-TYDVSLKIKLKLSYKDEADE--
RPOB_CHLMU       ------------------------PKYSPEECIRRGI-TYSVTLKVRFRLT---------
RPOB_CHLPN       ------------------------PKYSPEECIRRGI-TYSVTLKVRFRLT---------
RPOB_PARUW       ------------------------PKYNPEECIRRGI-TYNVTLKVKFRLT---------
RPOB_RHOBA       ------------------------PRYTIQECRQLRL-TYGRPLRIWLRLN---------
RPOB_TREDE       -----------------------IKFSEI-ECKQKGL-TYSVPLKAEIDLFFKETK----
RPOB_TREPA       -----------------------IKFSEA-ECKQKGL-TYAIPLKALVDLRFNNTG----
RPOB_BORAP       -----------------------LNFTEK-ECKRKGQ-SYEAVLKVRLNLQFLTTG----
RPOB_LEPBL       ------------------------KRSPQ-ECKDTDA-TFAMPLKAVIRLIIKETG----
RPOB_FUSNN       -----------------------APLNDELECKKRGK-TYSNSLKVRLRLINKKMGN---
RPOB_CYAM1       -----------------------PKITPV-QAKRQDI-TYSVGMYMPVQLWNHQTG----
RPOB_AQUAE       -----LLGGWDVDCPQCGAKLVYKEKFTPEECKLKGL-TYSAPLRVMLQLKAKTKNG---
RPOB_DEIRA       ------------------------PEYSPEECREKDL-TYEAPLYVKLELIHKDTGVIKG
RPOB_DEIGD       ------------------------PPYTPEECREKDL-TYQAPLYAKLQLIHKDSGLIK-
RPOB_THET8       ------------------------PPFPQDECREKDL-TYQAPLYARLQLIHKDTGLIK-
RPOB_THEMA       ------------------------PAIDPLECKAKGL-TYSVPIYATARLTDMKSGE---
RPOB_BACCR       -----------------------EPKYSVDECKERDV-TYAAPLRVKVRLINKETGE---
RPOB_BACSU       -----------------------EPKYPVEESKERDV-TYSAPLRVKVRLINKETGE---
RPOB_BACHD       -----------------------EPKYPVDESKERDV-TYAAPLRVKVRLINKETGE---
RPOB_GEOTN       -----------------------EPKYSVEEAKERDV-TYAAPLRVKVRLINKETGE---
RPOB_OCEIH       -----------------------DPKYPVDEAKERDV-TYNAPLRVKVRLINNETGE---
RPOB_LISIN       -----------------------EPKYSVEESKNRDA-NYAAPLRVKLRLINKETGE---
RPOB_STAS1       -----------------------EPKYDLEESKNRDT-TYSAPLRVKVRLIIKETGE---
RPOB_STRS2       -----------------------EPKYTLEEARAHDA-NYSAPIYVTFRLVNKETGE---
RPOB_LACLA       -----------------------TPKYTVEEARAHDA-NYSAPIYVTFRLVNKETGE---
RPOB_LACGA       -----------------------KPKYTLEEARDHDA-NYSAPLHVTLKLTNHETGE---
RPOB_LACAC       -----------------------KPKYTVDEARDHDA-TYAAPMHVTLKLTNQETGE---
RPOB_LACDB       -----------------------EPKYTVDESRKHDA-TYSAPMHVTLKLTNHETGE---
RPOB_LACPL       -----------------------EPKYTVEEAREHDA-NYSAPLHVTLRLTNHETGE---
RPOB_LACBA       -----------------------EPKYSVDEAREHDA-NYSAPLHVTLRLTNHETGE---
RPOB_PEDPA       -----------------------EPKYTVDEAREHEA-NYSAPLHVTLRLTNHETGE---
RPOB_LACS1       -----------------------EPKYTVEEARQHDA-NYSAPLHVTLRLINHETGE---
RPOB_LACSS       -----------------------EPKYTVEEARQHDA-NYSAPLHVTLKLTNHETGE---
RPOB_LACP3       -----------------------EPKYTVEEARQHDA-NYSAPLHVTLRLTNHETGE---
RPOB_ENTFA       -----------------------EPKYTVEEARAHDA-NYSAPLHVTLRLTNRETGE---
RPOB_LEUMM       -----------------------EPKYNIDEAREHDA-NYSAPLHVTLRLTNHETGE---
RPOB_OENOB       -----------------------EPKYSLKESREQAV-NYAAPLHVTLRLTNKETGE---
RPOB_CARHZ       -----------------------KPKYSVEECKERDF-TYSAPLRVKVRLLNKETGE---
RPOB_MOOTA       -----------------------EPKYSEDECKERDM-TYAAPLRVKVRLINRETGE---
RPOB_SYMTH       -----------------------EPKYSIEECKERDV-TYAAPLRVRVRLINKETGE---
RPOB_DESHY       -----------------------EPKYEVEECKERDV-TYAAPLRVKVRLINKETGE---
RPOB_CLOAB       ----------------------DNIKYSVEECKERDT-TYAAPLKVKVRLLNKETGE---
RPOB_CLONN       ----------------------DAIKYSVEECKERDA-TYAAPLKVKVRLLNKETGE---
RPOB_CLOPS       ----------------------DNIKYSVEECKERDT-TYAAPLKVAVRLQNKETGE---
RPOB_CLOTE       ----------------------ENIKYSVEECKERDA-TYAAPLKVSVRLINKETGE---
RPOB_HUNT2       ----------------------EPPKYSVDECKERDA-TYAAPLKVKVRLINKETGE---
RPOB_CLOD6       ----------------------DKPKYDIEECKERDA-TYCAPLKVKVRLINKETGE---
RPOB_CALS4       ----------------------NNPKYSVEECKDRDT-TYAAPLKVKVRLTNRETGE---
RPOB_SYNWW       -----------------------EPKYSINECKERDV-SYQAPLKLKVRLTDKENGE---
RPOB_ONYPE       -----------------------PPKYSIEETKIKDI-SYVAQLFVKTTLENVLTGE---
RPOB_COREF       -----------------------PVKNTIDEAKEKDI-NYAAPLYVTAEFVNNTTGE---
RPOB_CORDI       -----------------------DMKNTIDECKDKDI-NYSAPLYVTAEFINNETQE---
RPOB_CORJK       -----------------------DVKSTIDEAKDKDI-NYAAPLYVTAEFTNSMSGE---
RPOB2_NOCFA      -----------------------EVKASIDECKEKDM-TYAAPLFVTAEFINNNTGE---
RPOB_RHOJR       -----------------------EVKASTDECKDKDM-TYAAPLFVTAEFINNNTGE---
RPOB_MYCS2       -----------------------EVKASVDECKDKDM-TYAAPLFVTAEFINNNTGE---
RPOB1_NOCFA      -----------------------EVKASVEECKDKDL-TYAAPWFVTAEFVNNNTGE---
RPOB_SACEN       -----------------------EVKASVEECKDKDM-TYAAPLFVTAEFTNHTTGE---
RPOB_FRAAA       -----------------------PPKYSVEECKDKDM-TFSAPLFVTAEFTNNTTGE---
RPOB_STRCO       -----------------------PPKNSIDECKDRDF-TYAAPLFVTAEFTNNETGE---
RPOB_THEFY       -----------------------PPKYSEEECKDKDM-TYSAPMFVTAEFINNDTGE---
RPOB_ACIC1       -----------------------PPKNTPDECRERDF-TYSAPLFVTAEFVNNTTGE---
RPOB_NOCSJ       -----------------------DPKYTVDECKEKDF-TYSAPLYVSAEFTNNDTGE---
RPOB_ARTS2       -----------------------DPKYTMAECKDRDA-TYSAPLYVKAEFMNNNTGE---
RPOB_LEIXX       -----------------------EKKYSIDECKEKGR-TYAAPLYVEAEFMNHLTGE---
RPOB_CUTAK       -----------------------DPKHSVDECKDRDT-TYAAPLFVTAEFMNNETEE---
RPOB_BIFAA       -----------------------EPRHTVQECKEKDY-TYSAPLYVNAEFENGDTGE---
RPOB_TROWT       -----------------------AEELSVRECRVRGR-TYSAPLYVEAEFMNHDTGE---
RPOB_RUBXD       -----------------------EPPVSIEECMSKDK-TYAAPLFVRVRFVIKETGE---
RPOB_DEHMC       -----------------------EPRLSEYECTQRDQ-TYSVPLYVKARLIVKTTGE---
RPOB_MYCMS       -------------------------RLSVRQAKEESK-IYDAPIYANLKLSVNKTEEIQK
RPOB_MESFL       -------------------------KISPSKAKEQSK-IYDAPIYVDLQLMFTKTEDISK
RPOB_MYCMO       -------------------YKTDNEYKILAEARQKGT-TYSGILKAKLTKTIVETGEIET
RPOB_MYCPU       -------------------KPLVTEQKAVKEAKQKGI-SYSARLYVKLQKHITETGEISF
RPOB_MYCS5       -------------------KKAEHENLQIKTCKAKKT-NFSMKVYITLKKVVSQTGVVKK
RPOB_MYCH2       --------------------KPENEYLAIREAKIKGK-TYSARVYVTLVKVHSEDGEMEE
RPOB_CITSI       ------------------------PLLKERDAVYESF-TYSSELYVSAGLIWKSRGD---
RPOB_POPTR       ------------------------PSIKERDAVYESL-TYSSELYVSGGLIWKNSRD---
RPOB_AETGR       ------------------------PLRKERDAVYESL-TYSSELYVSAGLIWKTSRK---
RPOB_OENEH       ------------------------PLIKERDAVYELL-TYSSELYISAGLIWKSSRD---
RPOB_NYMAL       ------------------------PLIKERDAVYESI-TYSSELYVPAGLIWRTGRN---
RPOB_PIPCE       ------------------------PLIKERDAVYESL-TYSSELYVPAGLIWKPGKD---
RPOB_PHAAO       ------------------------PLITERDAVYESL-TYSSELYVPAVLIWKTGRN---
RPOB_DIOEL       ------------------------PLIKERDAVYESL-TYSSELYVPAGLIWKTSRA---
RPOB_PHAVU       ------------------------PLINEKDAVYESL-TYSAELYVSTGLIWKSSRD---
RPOB_LOTJA       ------------------------PSIKEKDAVYESL-TYSSELYVSAGLIWKNSKN---
RPOB_JASNU       ------------------------PLRKERDAVYESL-TYSSEFYVSAGLIWKTSRD---
RPOB_LACSA       ------------------------PSIKERDAVYESL-TYSSELYVSARLIWKNDRRRY-
RPOB_SACHY       ------------------------PSIKERNAVYESL-TYSSELYVSARLIFGFDVQ---
RPOB_PELHO       ------------------------PLIKERDARYESL-TYSSKLYVSAGFLWKDKRP---
RPOB_ANTAG       ------------------------PPIEERDAIYQSI-TYSSDLYVPAQLTE-RKK-GR-
RPOB_MARPO       ------------------------PLLKERDAVYQSI-TYSSDVYVPAQLTQ-KKK-GK-
RPOB_PHYPA       ------------------------P--EKTTIKFHYN-TYSSDLYVTCRLLR-RKKKIE-
RPOB_PSINU       ------------------------PSIKEKDAVYKCV-TYSSELYVPARLTQ-KRN-RR-
RPOB_ANGEV       ------------------------PCIKERDAVYQSF-TYSSDLYVPAQLMR-RRN-GR-
RPOB_PINTH       ------------------------PFIKERDAVYQSL-TYYSELYVPARSIR-RNS-RK-
RPOB_CYCTA       ------------------------PLIKERNAVYQSL-TYSSELYVPARLIQ-RNS-RK-
RPOB_ADICA       ------------------------PSLEERDAAYQCI-TYSADLYVPAQLICKEDQI---
RPOB_HUPLU       ------------------------PSVKEGDSLYESIITNSCKLYVPARLTQRKKGK---
RPOB_CHAGL       ------------------------PILNERESIYKSI-TYSTELYVTAELNCIKNQTK--
RPOB_CHAVU       ------------------------PSFNEQEAIYQAS-TYSSELYVPAQITHTKSEK---
RPOB_STAPU       ------------------------PLFTEREAVYKFT-TYSSDLYVPIQLTLTKEKK---
RPOB_ZYGCR       ------------------------PKFNEREAVYQSA-TYSSNLYAPAYLVDKKRGI---
RPOB_NEPOL       ------------------------PKVSIQEAVYQAT-SYSAALYVNVETNQSNLGTQE-
RPOB_OSTTA       ------------------------PHYTPQEAVQKLG-TYKSSLIVPVHVYSKYLNLNA-
RPOB_MESVI       ------------------------PKYNERTSIRRAS-TYTCQLYVPAKLTNKRTGEIQ-
RPOB_CHLAT       ------------------------PRYNEKKCIRRAC-TYASQLYIPAQLINKKTGKVQ-
RPOB_OLTVI       ------------------------PELNAKQSILKNK-TYSCRLYIPVKLTNKRTKTLK-
RPOB_BIGNA       ------------------------PTYTCNECVITSK-TYNCELVIPIRLISYKDE----
RPOB_PHATC       ------------------------PSYSLLIARKYSG-NYRAQLVIPIEVRNKVVNSIRY
RPOB_THAPS       ------------------------PIYNIVRAKKYTA-NYSAQLVIPLEVRNKKTNIIKY
RPOB_TRIV2       ------------------------PKYSVEEAKRRDS-TYAVQMYVPTRLLNKETGDIK-
RPOB_TRIEI       ------------------------PKYSVEESKRRDS-SYAVQMYVPTRLINKETGEIK-
RPOB_SYNY3       ------------------------PKYDVDESKRRDA-SYSVQMYVPTRLINKETGEIK-
RPOB_SYNE7       ------------------------PKYDVDEAKRRDG-TYSVQMYVPTRLINKETGEIK-
RPOB_THEEB       ------------------------PKYSVDEAKRRDA-TYSMQMYVPTRLINKENGNII-
RPOB_SYNJA       ------------------------PRYDPEEAKRRDA-TYQAQIRVPTRLINKETGEIK-
RPOB_GLOVI       ------------------------PKYSVEEAKRRDS-TYSVQMYVSTRLVNKETGEIK-
RPOB_PROM5       ------------------------PRHDVEEAKRRDA-TFASQMYVTCRLINKETGEIK-
RPOB_GUITH       ------------------------PKHNINECKRRDT-TYSVQIYVPAQLINRETGVIK-
RPOB_RHDSA       ------------------------PKYNLLESKRRDA-TYSVQVYVPARLINRDTGIIK-
RPOB_PYRYE       ------------------------PRYSVRQAKNRDK-TYSAQIYVPAKLTRKDIDLPSK
RPOB_GRATL       ------------------------PRYSVRKAKSRDK-TYSAQIYIPAKLTRRDIEVIKE
RPOB_CYAPA       ------------------------PTFTLEEAKQRDL-TYAAQLYIPVELRDLETGIVK-
RPOB_CYACA       ------------------------PKFSFEEAKRRDC-SYTISINIVTQLFNKNSGDVK-
RPOB_EMIHU       ------------------------PRYTLEEAKRKDA-TYSVRIFIRAQLNYLEGADPQ-
RPOB_EUGLO       ------------------------PKLSSESCLIKNE-TYNIDIKIPMEIKYEGKIIF--
                                                                             

RPOB_MYCGE       ARKSKKN-----------------------------------------------------
RPOB_MYCPN       PRKSKKNS----------------------------------------------------
RPOB_MYCGA       ISK---KS----------------------------------------------------
RPOB_MYCPE       TTKSSKN-----------------------------------------------------
RPOB_UREPA       AQRN--------------------------------------------------------
RPOB_ALKEH       ------------------------------------------------------------
RPOB_HALHL       ------------------------------------------------------------
RPOB_METCA       ------------------------------------------------------------
RPOB_XANC8       ------------------------------------------------------------
RPOB_XYLFT       ------------------------------------------------------------
RPOB_LEGPA       ------------------------------------------------------------
RPOB_COXBU       ------------------------------------------------------------
RPOB_NITOC       ------------------------------------------------------------
RPOB_AROAE       ------------------------------------------------------------
RPOB_AZOSB       ------------------------------------------------------------
RPOB_METFK       ------------------------------------------------------------
RPOB_NITEC       ------------------------------------------------------------
RPOB_NITMU       ------------------------------------------------------------
RPOB_THIDA       ------------------------------------------------------------
RPOB_DECAR       ------------------------------------------------------------
RPOB_PARXL       P-----------------------------------------------------------
RPOB_HERAR       P-----------------------------------------------------------
RPOB_RALSO       ------------------------------------------------------------
RPOB_BORA1       P-----------------------------------------------------------
RPOB_RHOFT       Q-----------------------------------------------------------
RPOB_POLSJ       Q-----------------------------------------------------------
RPOB_VEREI       Q-----------------------------------------------------------
RPOB_METPP       Q-----------------------------------------------------------
RPOB_NEIG1       ------------------------------------------------------------
RPOB_CHRVO       ------------------------------------------------------------
RPOB_ACIBT       ------------------------------------------------------------
RPOB_PSYCK       DS----------------------------------------------------------
RPOB_HAHCH       ------------------------------------------------------------
RPOB_MARHV       ------------------------------------------------------------
RPOB_SACD2       ------------------------------------------------------------
RPOB_PSEU5       ------------------------------------------------------------
RPOB_CHRSD       ------------------------------------------------------------
RPOB_ALCBS       ------------------------------------------------------------
RPOB_SODGM       ------------------------------------------------------------
RPOB_ECOLI       ------------------------------------------------------------
RPOB_BAUCH       ------------------------------------------------------------
RPOB_BLOFL       ------------------------------------------------------------
RPOB_BLOPB       ------------------------------------------------------------
RPOB_BUCAI       ------------------------------------------------------------
RPOB_BUCAP       ------------------------------------------------------------
RPOB_BUCBP       ------------------------------------------------------------
RPOB_WIGBR       ------------------------------------------------------------
RPOB_BUCCC       ------------------------------------------------------------
RPOB_ACTP2       ------------------------------------------------------------
RPOB_MANSM       ------------------------------------------------------------
RPOB_HAEI8       ------------------------------------------------------------
RPOB_ALIF1       ------------------------------------------------------------
RPOB_PHOPR       ------------------------------------------------------------
RPOB_VIBCH       ------------------------------------------------------------
RPOB_AERS4       ------------------------------------------------------------
RPOB_COLP3       ------------------------------------------------------------
RPOB_PSEA6       ------------------------------------------------------------
RPOB_PSEHT       ------------------------------------------------------------
RPOB_SHEAM       ------------------------------------------------------------
RPOB_IDILO       ------------------------------------------------------------
RPOB_PSYIN       ------------------------------------------------------------
RPOB_DICNV       ------------------------------------------------------------
RPOB_HYDCU       K-----------------------------------------------------------
RPOB_VESOH       KK----------------------------------------------------------
RPOB_FRATO       E-----------------------------------------------------------
RPOB_RHIL3       ------------------------------------------------------------
RPOB_RHIME       ------------------------------------------------------------
RPOB_AGRFC       ------------------------------------------------------------
RPOB_RHILO       ------------------------------------------------------------
RPOB_CHESB       ------------------------------------------------------------
RPOB_BRUSU       ------------------------------------------------------------
RPOB_BARBK       ------------------------------------------------------------
RPOB_RHOPB       ------------------------------------------------------------
RPOB_GLUOX       ------------------------------------------------------------
RPOB_GRABC       ------------------------------------------------------------
RPOB_MAGSA       ------------------------------------------------------------
RPOB_RHORT       ------------------------------------------------------------
RPOB_CAUVC       ------------------------------------------------------------
RPOB_MARMM       ------------------------------------------------------------
RPOB_HYPNA       ------------------------------------------------------------
RPOB_RHOS1       ------------------------------------------------------------
RPOB_PARDP       ------------------------------------------------------------
RPOB_ROSDO       ------------------------------------------------------------
RPOB_JANSC       ------------------------------------------------------------
RPOB_NOVAD       ------------------------------------------------------------
RPOB_ERYLH       ------------------------------------------------------------
RPOB_SPHAL       ------------------------------------------------------------
RPOB_ZYMMO       ------------------------------------------------------------
RPOB_PELUB       ------------------------------------------------------------
RPOB_RICBR       ------------------------------------------------------------
RPOB_ORITB       ------------------------------------------------------------
RPOB_ANAMM       KEVKYVV---------------------------------------------------DE
RPOB_ANAPZ       KEVKYVV---------------------------------------------------DE
RPOB_EHRRW       KEVKYVV---------------------------------------------------DE
RPOB_NEOSM       GS--------------------------------------------------------EG
RPOB_MAGMM       ------------------------------------------------------------
RPOB_ANADE       A-----------------------------------------------------------
RPOB_MYXXD       A-----------------------------------------------------------
RPOB_SYNFM       T-----------------------------------------------------------
RPOB_SYNAS       Q-----------------------------------------------------------
RPOB_GEOSL       V-----------------------------------------------------------
RPOB_PELPD       I-----------------------------------------------------------
RPOB_PELCD       V-----------------------------------------------------------
RPOB_BDEBA       A-----------------------------------------------------------
RPOB_DESPS       V-----------------------------------------------------------
RPOB_DESVV       N-----------------------------------------------------------
RPOB_DESAG       N-----------------------------------------------------------
RPOB_LAWIP       S-----------------------------------------------------------
RPOB_KORVE       N-----------------------------------------------------------
RPOB_SOLUE       K-----------------------------------------------------------
RPOB_CAMJJ       E-----------------------------------------------------------
RPOB_CAMFF       E-----------------------------------------------------------
RPOB_SULDN       E-----------------------------------------------------------
RPOB_BACV8       ------------------------------------------------------------
RPOB_PARD8       ------------------------------------------------------------
RPOB_PORGI       ------------------------------------------------------------
RPOB_FLAPJ       ------------------------------------------------------------
RPOB_GRAFK       ------------------------------------------------------------
RPOB_CYTH3       ------------------------------------------------------------
RPOB_SALRD       ------------------------------------------------------------
RPOB_PELLD       ------------------------------------------------------------
RPOB_CHLPD       ------------------------------------------------------------
RPOB_CHLCH       ------------------------------------------------------------
RPOB_CHLTE       ------------------------------------------------------------
RPOB_CHLMU       ------------------------------------------------------------
RPOB_CHLPN       ------------------------------------------------------------
RPOB_PARUW       ------------------------------------------------------------
RPOB_RHOBA       ------------------------------------------------------------
RPOB_TREDE       ------------------------------------------------------------
RPOB_TREPA       ------------------------------------------------------------
RPOB_BORAP       ------------------------------------------------------------
RPOB_LEPBL       ------------------------------------------------------------
RPOB_FUSNN       ------------------------------------------------------------
RPOB_CYAM1       ------------------------------------------------------------
RPOB_AQUAE       ------------------------------------------------------------
RPOB_DEIRA       F-----------------------------------------------------------
RPOB_DEIGD       ------------------------------------------------------------
RPOB_THET8       ------------------------------------------------------------
RPOB_THEMA       ------------------------------------------------------------
RPOB_BACCR       ------------------------------------------------------------
RPOB_BACSU       ------------------------------------------------------------
RPOB_BACHD       ------------------------------------------------------------
RPOB_GEOTN       ------------------------------------------------------------
RPOB_OCEIH       ------------------------------------------------------------
RPOB_LISIN       ------------------------------------------------------------
RPOB_STAS1       ------------------------------------------------------------
RPOB_STRS2       ------------------------------------------------------------
RPOB_LACLA       ------------------------------------------------------------
RPOB_LACGA       ------------------------------------------------------------
RPOB_LACAC       ------------------------------------------------------------
RPOB_LACDB       ------------------------------------------------------------
RPOB_LACPL       ------------------------------------------------------------
RPOB_LACBA       ------------------------------------------------------------
RPOB_PEDPA       ------------------------------------------------------------
RPOB_LACS1       ------------------------------------------------------------
RPOB_LACSS       ------------------------------------------------------------
RPOB_LACP3       ------------------------------------------------------------
RPOB_ENTFA       ------------------------------------------------------------
RPOB_LEUMM       ------------------------------------------------------------
RPOB_OENOB       ------------------------------------------------------------
RPOB_CARHZ       ------------------------------------------------------------
RPOB_MOOTA       ------------------------------------------------------------
RPOB_SYMTH       ------------------------------------------------------------
RPOB_DESHY       ------------------------------------------------------------
RPOB_CLOAB       ------------------------------------------------------------
RPOB_CLONN       ------------------------------------------------------------
RPOB_CLOPS       ------------------------------------------------------------
RPOB_CLOTE       ------------------------------------------------------------
RPOB_HUNT2       ------------------------------------------------------------
RPOB_CLOD6       ------------------------------------------------------------
RPOB_CALS4       ------------------------------------------------------------
RPOB_SYNWW       ------------------------------------------------------------
RPOB_ONYPE       ------------------------------------------------------------
RPOB_COREF       ------------------------------------------------------------
RPOB_CORDI       ------------------------------------------------------------
RPOB_CORJK       ------------------------------------------------------------
RPOB2_NOCFA      ------------------------------------------------------------
RPOB_RHOJR       ------------------------------------------------------------
RPOB_MYCS2       ------------------------------------------------------------
RPOB1_NOCFA      ------------------------------------------------------------
RPOB_SACEN       ------------------------------------------------------------
RPOB_FRAAA       ------------------------------------------------------------
RPOB_STRCO       ------------------------------------------------------------
RPOB_THEFY       ------------------------------------------------------------
RPOB_ACIC1       ------------------------------------------------------------
RPOB_NOCSJ       ------------------------------------------------------------
RPOB_ARTS2       ------------------------------------------------------------
RPOB_LEIXX       ------------------------------------------------------------
RPOB_CUTAK       ------------------------------------------------------------
RPOB_BIFAA       ------------------------------------------------------------
RPOB_TROWT       ------------------------------------------------------------
RPOB_RUBXD       ------------------------------------------------------------
RPOB_DEHMC       ------------------------------------------------------------
RPOB_MYCMS       EFDGVVLDDALQILSKWLEEKTVSKNITFKQQSQNSYFFELTIKKSEKPDLIQIDIIEDK
RPOB_MESFL       EFEEIVEKDVKKVLSNWIAEKTDSKNVSLVKNTDNIYFFDVKLKGTEKNDLFQITILEEK
RPOB_MYCMO       A-----------------------------------------------------------
RPOB_MYCPU       D-----------------------------------------------------------
RPOB_MYCS5       E-----------------------------------------------------------
RPOB_MYCH2       Q-----------------------------------------------------------
RPOB_CITSI       ------------------------------------------------------------
RPOB_POPTR       ------------------------------------------------------------
RPOB_AETGR       ------------------------------------------------------------
RPOB_OENEH       ------------------------------------------------------------
RPOB_NYMAL       ------------------------------------------------------------
RPOB_PIPCE       ------------------------------------------------------------
RPOB_PHAAO       ------------------------------------------------------------
RPOB_DIOEL       ------------------------------------------------------------
RPOB_PHAVU       ------------------------------------------------------------
RPOB_LOTJA       ------------------------------------------------------------
RPOB_JASNU       ------------------------------------------------------------
RPOB_LACSA       ------------------------------------------------------------
RPOB_SACHY       ------------------------------------------------------------
RPOB_PELHO       ------------------------------------------------------------
RPOB_ANTAG       ------------------------------------------------------------
RPOB_MARPO       ------------------------------------------------------------
RPOB_PHYPA       ------------------------------------------------------------
RPOB_PSINU       ------------------------------------------------------------
RPOB_ANGEV       ------------------------------------------------------------
RPOB_PINTH       ------------------------------------------------------------
RPOB_CYCTA       ------------------------------------------------------------
RPOB_ADICA       ------------------------------------------------------------
RPOB_HUPLU       ------------------------------------------------------------
RPOB_CHAGL       ------------------------------------------------------------
RPOB_CHAVU       ------------------------------------------------------------
RPOB_STAPU       ------------------------------------------------------------
RPOB_ZYGCR       ------------------------------------------------------------
RPOB_NEPOL       ------------------------------------------------------------
RPOB_OSTTA       ------------------------------------------------------------
RPOB_MESVI       ------------------------------------------------------------
RPOB_CHLAT       ------------------------------------------------------------
RPOB_OLTVI       ------------------------------------------------------------
RPOB_BIGNA       ------------------------------------------------------------
RPOB_PHATC       ------------------------------------------------------------
RPOB_THAPS       ------------------------------------------------------------
RPOB_TRIV2       ------------------------------------------------------------
RPOB_TRIEI       ------------------------------------------------------------
RPOB_SYNY3       ------------------------------------------------------------
RPOB_SYNE7       ------------------------------------------------------------
RPOB_THEEB       ------------------------------------------------------------
RPOB_SYNJA       ------------------------------------------------------------
RPOB_GLOVI       ------------------------------------------------------------
RPOB_PROM5       ------------------------------------------------------------
RPOB_GUITH       ------------------------------------------------------------
RPOB_RHDSA       ------------------------------------------------------------
RPOB_PYRYE       NQEKNIKSLDL------------------------------------------SSTHLQL
RPOB_GRATL       NIS--------------------------------------------------TSKDLSY
RPOB_CYAPA       ------------------------------------------------------------
RPOB_CYACA       ------------------------------------------------------------
RPOB_EMIHU       ------------------------------------------------------------
RPOB_EUGLO       ------------------------------------------------------------
                                                                             

RPOB_MYCGE       --------IASNTNGVFLASMPLITHDGVFIINGIEKFVISQITRSPGIYMLTKSQLKLS
RPOB_MYCPN       --------ATSSVDGVFLTNLPLITRDGVFIVNGIEKFVIAQITRSPGIYMLTKSQLKLS
RPOB_MYCGA       --------AKSKAEGIYFADIPLMTENGAFIVNGIEKFVVAQIVRSPGAYILNKSQVKLS
RPOB_MYCPE       --------KASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLS
RPOB_UREPA       --------TKTGEDGIYLGAIPKMTEKGTFVINGIEKFVISQIVRSPGIYVLGKSSIKLN
RPOB_ALKEH       ----QSVKDIKEQE-VYMGELPLMTRNGTFVINGTERVIVSQLHRSPGVFFD--HDKGKT
RPOB_HALHL       ----GGVKDIKEQE-VYMGEMPLMTSTGTFVVNGTERVIVNQLHRSPGVFFD--HDKGKS
RPOB_METCA       ---AKVVRDIKEQE-IYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFD--HDRGKT
RPOB_XANC8       ---TKAIKYVKEQE-VYLGEIPLMTENGTFIVNGTERVIVSQLHRSPGVFFD--HDRGKT
RPOB_XYLFT       ---TKAVKYIKEQE-VYLGEIPLMTENGTFIVNGTERVIVSQLHRSPGVFFD--HDRGKT
RPOB_LEGPA       ---PKPIKDIREQD-VFMGEIPLMTDVGTFVVNGTERVVVSQLHRSPGVIFE--HDKGKT
RPOB_COXBU       ---KKAIKDIKEQE-VYMGEIPLMTETGSLVINGTERVVVSQLHRSPGVFFE--HDKGKT
RPOB_NITOC       ---EQVVKDVKEQE-VYMGEIPLMTPKGNFVINGTERVIVSQLHRSPGVIFE--HDKGKT
RPOB_AROAE       -----TVKEVKEQE-VYMGEIPLMTTTGSFVINGTERVIVSQLHRSPGVFFE--HDRGKT
RPOB_AZOSB       -----TIKEVKEQE-VYMGEIPLMTTTGSFVINGTERVIVSQLHRSPGVFFE--HDRGKT
RPOB_METFK       -----TVKEVKEQE-VYMGELPLMTENGSFVINGTERVIVSQLHRSPGVFFE--HDRGKT
RPOB_NITEC       -----TVKEVKEQE-VYMGEIPLMTETGSFVVNGTERVIVSQLHRSPGVFFE--HDRGKT
RPOB_NITMU       -----TVREVKEQE-VYMGEIPLMTNTGSFVINGTERVIVSQLHRSPGVFFE--HDRGKT
RPOB_THIDA       -----TIKEVKEQE-VYMGEIPLMTPTGSFVINGTERVIVSQLHRSPGVFFE--HDRGKT
RPOB_DECAR       -----TVKEVKEQE-VYMGEIPLMTTNGSFVINGTERVIVSQLHRSPGVFFE--HDRGKT
RPOB_PARXL       -----VVKEVKEQE-VYMGEIPLMTPTGSFVINGTERVIVSQLHRSPGVFFE--HDKGKT
RPOB_HERAR       -----VVKEMKEQE-VYMGELPLMTSTGSFVINGTERVIVSQLHRSPGVFFE--HDRGKT
RPOB_RALSO       ------VKEIKEQE-VYMGEIPLMTSTGSFVINGTERVIVSQLHRSPGVFFE--HDKGKT
RPOB_BORA1       -----TIKEVKEQE-VYMGEIPLMTTTGSFVINGTERVIVSQLHRSPGVFFE--HDRGKT
RPOB_RHOFT       ---NKVIKEVKEQE-VYMGEVPLMTTKGSFIINGTERVIVSQLHRSPGVFFE--HDKGKT
RPOB_POLSJ       ---SKVVKEVKEQE-VYMGEVPLMTDKGSFVINGTERVIVSQLHRSPGVFFE--HDKGKT
RPOB_VEREI       ---SKVVKEVKEQE-VYMGEVPLMTDKGSFIINGTERVIVSQLHRSPGVFFE--HDKGKT
RPOB_METPP       ---SKVVKEIKEQE-VYMGEVPLMTDYGSFIVNGTERVIVSQLHRSPGVFFE--HDKGKT
RPOB_NEIG1       -----TVKEVRENE-VYMGEIPLMTPSGSFVINGTERVIVSQLHRSPGVFFE--HDKGKT
RPOB_CHRVO       -----VVKEVRENE-VYMGEIPLMTANGSFIINGTERVIVSQLHRSPGVFFE--HDRGKT
RPOB_ACIBT       -----SIKDVREQE-VYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFD--HDKGKT
RPOB_PSYCK       ---KAAIKDIREQS-VYMGEMPLMTANGTFIINGTERVIVSQLHRSPGVFFD--HDKGKS
RPOB_HAHCH       -----AIKDIKEQE-VYMGEVPLMTENGTFVINGTERVIVSQLHRSPGVFFD--HDKGKT
RPOB_MARHV       -----AIKDIKEQE-VYMGEMPLMTENGTFVVNGTERVIVSQLHRSPGVFFD--HDKGKT
RPOB_SACD2       -----AIKDIKEQE-VYMGEIPLMTDNGTFVVNGTERVIVSQLHRSPGVFFE--HDKGKT
RPOB_PSEU5       -----AIKDIKEQE-VYMGEIPLMTENGTFIINGTERVIVSQLHRSPGVFFD--HDRGKT
RPOB_CHRSD       -----AIKDIKEQE-VYMGEIPLMTENGTFVVNGTERVIVSQLHRSPGVFFD--HDKGKS
RPOB_ALCBS       -----AIKDIREQQ-VYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFD--HDKGKT
RPOB_SODGM       ----GTVKDIKEQE-VYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFD--SDKGKT
RPOB_ECOLI       ----GTVKDIKEQE-VYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFD--SDKGKT
RPOB_BAUCH       -----TETPIKEQE-VYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFD--SDKGKI
RPOB_BLOFL       ----NTIKRTQQQE-VYMGEIPLMTDNGTFIINGIERVVVSQLHRSPGVFFD--SDKGKT
RPOB_BLOPB       ----NIIKNTKEQE-VYMGEIPLMTNNGTFIINGIERVIVSQLHRSPGVFFD--SDKGKT
RPOB_BUCAI       ----ATVKDIKEQE-VYMGEIPLMTNNGTFIINGTERVVVSQLHRSPGVFFD--SDKGKT
RPOB_BUCAP       ----PTVKDIKEQE-VYMGEIPLMTNNGTFIINGTERVVVSQLHRSPGVFFD--SDKGKT
RPOB_BUCBP       ----ITVKDIKEQE-VYMGEIPLMTTNGTFIINGTERVVVSQLHRSPGVFFD--SDKGKT
RPOB_WIGBR       ----HVVKNIKEQE-VYMGEIPLMTDNGTFIINGTERVVVSQLHRSPGVFFD--SDKGKT
RPOB_BUCCC       ----TNVKHIKEQE-VYMGELPLMTHNGTFIINGTERVVVSQLHRSPGVFFD--SDKGKT
RPOB_ACTP2       ----GTVKDIKEQN-VYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFD--SDKGKT
RPOB_MANSM       ----GTIKDIKEQD-VYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFD--SDKGKT
RPOB_HAEI8       ----RAVKDIKENE-VYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFD--SDKGKT
RPOB_ALIF1       -----TVKDIKEQE-VYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFD--SDKGKT
RPOB_PHOPR       ----GTVKDIKEQE-VYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFD--SDKGKT
RPOB_VIBCH       ----GTVKDIKEQE-VYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFD--SDKGKT
RPOB_AERS4       ----GTVKDIKEQE-VYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFD--HDKGKT
RPOB_COLP3       ----GTVKDIKEQE-VYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFD--HDKGKT
RPOB_PSEA6       ----GTVKDIKEQE-VYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFD--HDKGKT
RPOB_PSEHT       ----GTVKDIKEQE-VYMGEIPLMTDTGTFVINGTERVIVSQLHRSPGVFFD--NDRGKT
RPOB_SHEAM       ----GTVKDIKEQE-VYMGDIPLMTENGTFVINGTERVIVSQLHRSPGVFFD--HDRGKT
RPOB_IDILO       ----GTVKDIKEQE-VYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFD--HDKGKS
RPOB_PSYIN       ----GTVKDIREQE-VYMGEMPLMTENGTFVINGTERVIVSQLHRSPGVFFD--HDKGKT
RPOB_DICNV       -----KLKQVVESESVYMGDIPLMTDDGTFVINGTERVIVSQLHRSPGVFFG--DDDGQG
RPOB_HYDCU       ----RPVKDVKEQE-VYLGDVPLMTENGTFVINGTERVIVTQLHRSPGVIFD--SDKGKS
RPOB_VESOH       ---KRKVKQIIEED-VYLGQLPLMTETGTFVINGTERVVVSQLHRSPGVIFE--HDKGKT
RPOB_FRATO       ----KIVEDIREEY-VYMGDIPLMTTNGTFIINGTERVVVSQLHRSPGVFFS--KD----
RPOB_RHIL3       DTGAKSIKDIKEQS-VYMGDMPLMTNNGTFIVNGTERVIVSQMHRSPGVFFD--HDKGKS
RPOB_RHIME       DTGAKSIKDIKEQN-VYMGDMPLMTDNGTFIVNGTERVIVSQMHRSPGVFFD--HDKGKS
RPOB_AGRFC       DTGAKSIKDIKEQS-VYMGDMPLMTNNGTFIVNGTERVIVSQMHRSPGVFFD--HDKGKS
RPOB_RHILO       DTGAKSIKDIKEQD-VYMGDMPLMTLNGTFIVNGTERVIVSQMHRSPGVFFD--HDKGKS
RPOB_CHESB       DTGSKSIKDIKEQD-VYMGDMPLMTDNGTFIINGTERVIVSQMHRSPGVFFD--HDKGKS
RPOB_BRUSU       DTGAKSIKDIKEQD-VYMGDMPLMTDNGTFIVNGTERVIVSQMHRSPGVFFD--HDKGKT
RPOB_BARBK       DTGSKDIKDIKEQG-VYMGDMPLMTSNGTFIINGTERVIVSQMHRSPGVFFD--HDKGKS
RPOB_RHOPB       ETGARSVKDIKEQD-VYMGDIPLMTMNGTFVVNGTERVIVSQMHRSPGVFFD--HDKGKT
RPOB_GLUOX       DTGSRSIHDMKEQP-VYMGDMPLMTDNGTFIINGTERVIVSQMHRSPGVFFD--HDKGKT
RPOB_GRABC       DTGSRSIRDIKEQP-VYMGDMPLMTDNGTFIINGTERVIVSQMHRSPGVFFD--HDKGKT
RPOB_MAGSA       DTGSRSIRDIKEQD-VYMGDMPLMTSNGTFVINGTERVIVSQMHRSPGVFFD--HDKGKT
RPOB_RHORT       ETGARSIRDIKEQD-VYMGDMPLMTSNGTFIINGTERVIVSQMHRSPGVFFD--HDKGKT
RPOB_CAUVC       ETGARSVKDIKEQD-VYMGDIPLMTDKGTFIVNGTERVIVSQMHRSPGVFFD--HDKGKT
RPOB_MARMM       ETGARSVKDIKEQD-VYMGDIPLMTDKGTFVVNGTERVIVSQMHRSPGVFFD--HDRGKT
RPOB_HYPNA       DTGARSVKEVKEQE-CYLGDIPLMTDKGTFVINGTERVIVSQMHRSPGVFFD--HDKGKT
RPOB_RHOS1       TTGARSVKDIKEQD-VYMGDMPLMTANGTFIVNGTERVIVSQMHRSPGVFFD--HDKGKT
RPOB_PARDP       TTGAKSVKDIKEQD-VYMGDMPLMTQNGTFIVNGTERVVVSQMHRSPGVFFD--HDRGKT
RPOB_ROSDO       DTGAKSVKDIKEQD-VFMGDMPLMTPNGTFVVNGTERVIVSQMHRSPGVFFD--HDKGKT
RPOB_JANSC       DTGAKSVKDIKEQD-VFMGDMPLMTPNGTFVVNGTERVIVSQMHRSPGVFFD--HDKGKT
RPOB_NOVAD       ETETKSLIDIKEQD-VYMGDIPLMTENGTFFINGTERVIVSQMHRSPGVLFD--HDRGKT
RPOB_ERYLH       ETETRSVLDIKEQD-VYMGDMPLMTGNGTFIINGTERVIVSQMHRSPGVLFD--HDRGKT
RPOB_SPHAL       ETDTRSVLDIKEQD-VYMGDMPLMTENGTFFVNGTERVIVSQMHRSPGVLFD--HDRGKT
RPOB_ZYMMO       DTETRSVLDIKEQD-VYMGDMPLMTRNGTFFINGTERVIVSQMHRSPGVLFD--HDKGKT
RPOB_PELUB       ENNTKDILSAKEQE-VYMGEVPMMTDSGTFITNGVQRVVVNQMHRSPGVFFD--HDKGKS
RPOB_RICBR       DTGSREIKGIKEQQ-VYMGNIPLMTKNGTFIINGTERVVVSQMHRSPGVFFY--HDEGKV
RPOB_ORITB       KSDPKEIKGIKEQA-VYFGDIPLMTANGTFVINGTERVVVSQMHRSPGVFFD--HDDGKT
RPOB_ANAMM       DTSERSVKYMKEQE-VSIGDLPMMTSYGTFIINGIERVIVSQMHRSPGVFFD--SDKGKT
RPOB_ANAPZ       GTLERSVKYMKEQE-VSIGDLPMMTSYGTFIINGIERVIVSQMHRSPGVFFD--SDKGKT
RPOB_EHRRW       ETSEKSIKYIKEQE-VSIGDLPTMTSYGTFIINGVERVIVSQMHRSPGVFFD--SDKGKT
RPOB_NEOSM       VSTEPAVKDVREQE-IYMGDIPIMSKNGTFIINGVERVVVSQMHRAPGVFFD--NDKARS
RPOB_MAGMM       ETGTKTVREIKEQD-VYLGEIPLMTNTGTFIINGTERVIVSQMHRSPGVFFD--HDRGKT
RPOB_ANADE       ----QSIRDVKEQE-VYFGEIPLMTENGTFIINGTERVVVSQLHRSPGAFFD--HDKGKS
RPOB_MYXXD       ----QSIRDVKEQE-VYFGEIPLMTQNGTFIINGTERVVVSQLHRSPGAFFD--HDKGKS
RPOB_SYNFM       ----RSIRDIKEQE-IYFGTLPLMTDNGTFIINGTERVIVSQLHRSPGIFFD--HDRGKT
RPOB_SYNAS       ----KNIRDIKEQE-IYFGEIPLMTEKGTFIVNGTERVIVSQLHRSPGIFFD--HDKGKT
RPOB_GEOSL       ----RSIRDIKEQE-VYFGEIPLMTENGTFIINGTERVIVSQLHRSPGVFYD--HDKGKT
RPOB_PELPD       ----RAIKDIKEQE-VYFGEIPLMTDNGTFIINGTERVIVSQLHRSPGVFYD--HDKGKT
RPOB_PELCD       ----QAIRDIKEQE-VYFGEIPLMTENGTFIINGTERVIVSQLHRSPGVFFD--HDKGKT
RPOB_BDEBA       ----RSIRDVKEQE-VYLGEIPLMTANGSFIINGTERVVVSQLHRSPGVFFD--HDGGKN
RPOB_DESPS       ----QTIRDMKEQE-VFLGSLPLMTADGVFVVNGTERVIVSQLQRSPGLFYS--HDNGKS
RPOB_DESVV       ----RTIRDIKEQE-IYFGTLPLMTEKGTFIINGTERVIVNQLQRSPGIIFE--HDSGKT
RPOB_DESAG       ----RTIRDIKEQD-IYFGTLPLMTEKGTFIINGTERVIVNQLQRSPGIIFE--HDAGKT
RPOB_LAWIP       ----RTVHDIKEQD-IYFGTLPLMTEKGTFIINGTERVIVNQLQRSPGIIFE--HDSGKT
RPOB_KORVE       ----RTIRDIKEQE-VFFGDVPLMTQNGTFIINGTERVIVSQLHRSPGVFFE--TANNRT
RPOB_SOLUE       ----KSVRDIKEQE-VFFGEIPLMTDNGTFIINGTERVIVSQLHRSPGVFFE--RVPAQG
RPOB_CAMJJ       ---KVGVKDIKEQE-IYIREIPLMTDRVSFIINGVERVVVNQLHRSPGVIFK--EEESST
RPOB_CAMFF       ---KVGVKDIKEQE-IFVREIPLMTDRISFIINGVERVVVNQLHRSPGVIFK--EEESPT
RPOB_SULDN       ---KLGVKDIKEQS-IFVRDIPLMTERTSFIINGVERVVVNQLHRSPGVIFK--EEESTT
RPOB_BACV8       ----HEDFDTVIQD-VYLGPIPYMTPKGTFVINGAERVVVSQLHRSPGVFFG--QSVHAN
RPOB_PARD8       ----HEDFDTVIQD-VYLGPIPYMTDRGTFVINGAERVVVSQLHRSPGVFFG--QSTHAN
RPOB_PORGI       ----HEDFATVIQD-VFLGPIPYMTSSGTFVINGAERVIVSQLHRSPGVFFG--QSLHTN
RPOB_FLAPJ       ----HEDFETIVQD-VYLGTIPYMTPSGTFVINGAERVVVSQLHRSPGVFFG--QSFHAN
RPOB_GRAFK       ----HEDFETIVQD-VYLGTIPYMTPSGTFCINGAERVVVSQLHRSPGVFFG--QSFHAN
RPOB_CYTH3       ----NEDFQTIEQE-VFLGNIPYMTERGSFVINGAERVIVSQLHRSPGVFFA--QSKHTN
RPOB_SALRD       ----EEAIEAIEQE-VYLGTLPFMTDRGTFIVNGAERVIVSQLHRSPGAFFE--KEIHSN
RPOB_PELLD       ----TDWKETIQQE-VYLGRIPYMTERGTFIVNGAERVVVAQLHRSPGVVFS--EAVHPN
RPOB_CHLPD       ----ADWKETIQQE-VYLGRIPYMTERGTFIVNGAERVVVAQLHRSPGVVFS--EAIHPN
RPOB_CHLCH       ----PDWKETIQQE-VYLGRIPYMTERGTFIVNGAERVVVAQLHRSPGVVFS--EAVHPN
RPOB_CHLTE       ----PDWKETIQQE-VYLGRIPYMTDRGTFIINGAERVVVAQLHRSPGVVFS--EAVHPN
RPOB_CHLMU       -----DETGIKEEE-VYMGTIPIMTDKGTFIINGAERVVVSQVHRSPGINFE--QEKHSK
RPOB_CHLPN       -----DETGIKEEE-VYMGTIPLMTDKGTFIINGAERVVVSQVHRSPGINFE--QEKHSK
RPOB_PARUW       -----DETGIKEEE-VYMGTIPVMTDKGTFIVNGAERVVVSQLHRSPGICFE--QERHSR
RPOB_RHOBA       -----REEPI-EEE-VYLGDLPIMLGGGEFIINGAERVVVSQLHRSPGVDFV--LEQDTT
RPOB_TREDE       --------EIRRKN-IYMGDIPLMTERGTFIINGAERVVVSQIHRSPGVIFS--HEKG--
RPOB_TREPA       --------EIRRKD-IYMGDIPKMTERGTFIINGAERVVVSQIHRSPGVVFS--HEKDKE
RPOB_BORAP       --------EIRQKD-VYMGTIPLMTERGTFIINGAERVIVSQIHRSPGVVFY--KEKD--
RPOB_LEPBL       --------EIREQT-VYMGDLPVMTEQGTFIINGAERVVVSQLHRSPGIFFS--YDME--
RPOB_FUSNN       --------EIQESL-VYFGEVPKMTDRATFIINGAERVVVSQLHRSPGVSFS--KEVNTQ
RPOB_CYAM1       --------DVRQQM-IYFGEIPLMTEDATFIINGAERVVVNQIVRSPGVYFQ--ALWDKQ
RPOB_AQUAE       ------YREFPPKK-VYFGEIPLMTETGSFIINGTERIIINQLIRSSGVFFDEKEEKQKD
RPOB_DEIRA       ------KPDSPPESWVFLGNLPLMTFDGSFIINGADRVVISQIHRSPGVYFT------SS
RPOB_DEIGD       ------------EDQVFLGDLPLMTDDGSFVINGADRVVISQIHRSPGVYFT------SS
RPOB_THET8       ------------EDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFT------PD
RPOB_THEMA       ---------MKEEE-VFLGYIPYMTDRGTFIINGAERVVVNQIVVSPGLYFS-------S
RPOB_BACCR       ---------VKEQ-DVFMGDFPLMTETGTFVINGAERVIVSQLVRSPSVYYSGKVD----
RPOB_BACSU       ---------VKDQ-DVFMGDFPIMTDTGTFIINGAERVIVSQLVRSPSVYFSGKVD----
RPOB_BACHD       ---------VKEQ-EVFMGDFPLMTDTGTFIINGAERVIVSQLVRSPSVYYSEKID----
RPOB_GEOTN       ---------VKEQ-DVFMGDFPLMTETGTFIINGAERVIVSQLVRSPSVYYSDKVD----
RPOB_OCEIH       ---------VKEQ-EVFMGDFPLMTETGTFIINGAERVIVSQLVRSPSVYYNEKID----
RPOB_LISIN       ---------VKDQ-EVFMGDFPLMTEMGTFIINGAERVIVSQLVRSPGVYFNGKLD----
RPOB_STAS1       ---------VKEQ-EVFMGDFPLMTDTGTFVINGAERVIVSQLVRSPSVYFNEKLD----
RPOB_STRS2       ---------IKTQ-EVFFGEFPIMTEMGTFIINGAERIIVSQLVRSPGVYFNDKVD----
RPOB_LACLA       ---------LKTQ-EVFFGDFPLMTEMGTFINNGSERLIVSQLVRSPGSYFHLKAD----
RPOB_LACGA       ---------IKTQ-DVFFGEFPLMTDSGTFVINGAERIIVSQLVRSPGVYYHSDFD----
RPOB_LACAC       ---------IKTQ-DVFFGDLPLMTESGSFIVNGAERVIVSQLVRSPGVYYTGDYD----
RPOB_LACDB       ---------IKTQ-DVFFGDLPLMTKSGSFIVNGAERVIVSQLVRSPGVYYSGEFD----
RPOB_LACPL       ---------IKSQ-DVFFGDFPLMTEQGTFIINGAERVIVSQLVRSPGVYFNEELD----
RPOB_LACBA       ---------IKSQ-DVFFGDFPLMTAQGTFIINGAERVIVSQLVRSPGVYFNEDTD----
RPOB_PEDPA       ---------IKSQ-DVFFGDFPLMTEQGTFIINGAERVIVSQLVRSPGVYYNLDTD----
RPOB_LACS1       ---------IKSQ-DVFFGDFPLMTKQGTFIINGAERVIVSQLVRSPGVYFNSELD----
RPOB_LACSS       ---------IKSQ-DVFFGDFPLMTDQGTFIINGAERVIVSQLVRSPGVYFNSAID----
RPOB_LACP3       ---------IKSQ-DVFFGDFPLMTKQGTFIINGAERVIVSQLVRSPGVYFHSETD----
RPOB_ENTFA       ---------IKSQ-EVFFGDFPLMTEMGTFIINGAERVIVSQLVRSPGVYFHGKVD----
RPOB_LEUMM       ---------IKSQ-DVFFGDFPLMTEQGTFIINGAERVIVSQLVRSPGIYYNQTTD----
RPOB_OENOB       ---------IKSQ-DVYFGEFPLMTEYGSFVINGAERVVVSQLVRSPGIYYNEDTD----
RPOB_CARHZ       ---------IKEQ-EVFLGDFPLMTEKGTFIFNGAERVVISQMVRSPGVYFSEQVD----
RPOB_MOOTA       ---------VKEQ-EVFMGDFPLMTDKGTFIINGAERVIVSQLVRSPGAYYAEGID----
RPOB_SYMTH       ---------VKEQ-EVFMGDFPLMTPTGTFIINGAERVIVSQLVRSPGVYFSEQID----
RPOB_DESHY       ---------VKEQ-EVFMGDFPLMTTKGTFIINGAERVIVSQLVRSPGVYYSESID----
RPOB_CLOAB       ---------VKEQ-EVFMGDFPLMTEQGTFIINGAERVIVSQLVRSPGAYYDYIVD----
RPOB_CLONN       ---------VKEQ-EVFMGDFPLMTQQGTFVINGAERVIVSQLVRSPGAYYGYDVD----
RPOB_CLOPS       ---------IKEQ-EVFMGDFPLMTEQGTFIINGAERVIVSQLVRSPGVYYNYNVD----
RPOB_CLOTE       ---------IKEQ-DVFMGDFPLMTEQGTFIINGAERVIVSQLVRSPGVYYDVSLD----
RPOB_HUNT2       ---------VKEQ-EIFMGDFPLMTETGTFIINGAERVIVSQLVRSPGIYYAMKID----
RPOB_CLOD6       ---------IKEQ-EVFMGDFPLMTERGTFVINGAERVIVSQLVRSPGVYYAEERD----
RPOB_CALS4       ---------IKES-EVFMGDLPLMTDKGTFIINGAERVIVSQLVRSPGVYYDQQFD----
RPOB_SYNWW       ---------IKES-EVYMGDLPLMTEKGTFIINGAERVVVSQLVKSPGVYFNERMD----
RPOB_ONYPE       ---------TKQS-NILLTELPLMTPTGTFVINGTERVVVSQIVRSASVYFAGNFDS---
RPOB_COREF       ---------IKSQ-TVFIGDFPMMTDKGTFIINGTERVVVSQLVRSPGVYFDQTIDK---
RPOB_CORDI       ---------IKSQ-TVFIGDFPMMTDKGTFIVNGTERVVVSQLVRSPGVYFDQTIDK---
RPOB_CORJK       ---------IKSQ-TVFIGDFPMMTDKGTFIINGTERVVVSQLVRSPGVYFDASIDA---
RPOB2_NOCFA      ---------IKSQ-TVFMGDFPMMTDKGTFIINGTERVVVSQLVRSPGVYFDHSIDK---
RPOB_RHOJR       ---------IKSQ-TVFMGDFPMMTDKGTFIINGTERVVVSQLVRSPGVYFDHSVDK---
RPOB_MYCS2       ---------IKSQ-TVFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDETIDK---
RPOB1_NOCFA      ---------IKSQ-TVFMGDFPMMTAHGTFVVNGTERVVVSQLVRSPGVYFDHAIDK---
RPOB_SACEN       ---------IKSQ-TVFMGDFPVMTDKGTFIINGTERVVVSQLVRSPGVYFDQSVDK---
RPOB_FRAAA       ---------IKSQ-TVFMGDFPLMTPKGTFVINGTERVVVSQLVRSPGVYFERSLDK---
RPOB_STRCO       ---------IKSQ-TVFMGDFPLMTNKGTFVINGTERVVVSQLVRSPGVYFDSSIDK---
RPOB_THEFY       ---------IKSQ-TVFMGDFPLMTAKGTFIINGTERVVVSQLVRSPGVYFDSQMDK---
RPOB_ACIC1       ---------IKSQ-TVFMGDFPLMTEKGTFIINGTERVVVSQLVRSPGVYFDRTVDK---
RPOB_NOCSJ       ---------IKGQ-TVFMGDFPLMTDKGTFIINGTERVVVSQLVRSPGVYFERTADK---
RPOB_ARTS2       ---------IKQQ-TVFMGDFPLMTEKGTFVVNGTERVVVSQLVRSPGAYFERTADK---
RPOB_LEIXX       ---------IKTQ-TVFMGDFPLMTERGTFIINGTERVVVSQLVRSPGVYFEAAADK---
RPOB_CUTAK       ---------IKSQ-TVFIGDFPLMTSKGTFIINGTERVVVSQLVRSPGVYFEKTADK---
RPOB_BIFAA       ---------IKSQ-TVFMGDFPLQTPHGTFIIGGTERVIVSQLVRSPGVYFDRSQDR---
RPOB_TROWT       ---------IKTQ-TVFMGDFPLMTDKGTFVINGTERVVVSQLVRSPGVYFERTPEK---
RPOB_RUBXD       ---------VREQ-DVFMGDFPLMTDWGTFIINGTERVVVTQLVRSPGAYVMEP--K---
RPOB_DEHMC       ---------IKEPFDLFFGDIPLMTALGTFITSGTERVVVSQLLRSPGVYFTISDDP---
RPOB_MYCMS       KTSLICNVSIYKSGEVFLGDFPLMTEAGTFIINGSQKVIVSQLVRSPGAYFNKELNR---
RPOB_MESFL       EDIIVAEVSVRKWGQVFFGDFPLMTDAGTFVINGSQKVIVSQLVRSPGSYFKTEINN---
RPOB_MYCMO       --------------EVLYGDVPIMTSGGTFLINGSEKIIVSQLIRSPGAYFGLKVRN---
RPOB_MYCPU       --------------EVILCDIPLMTSSGSFIINGFEKVIVSQLIRSPGAYFAQKTRD---
RPOB_MYCS5       --------------KILLGEIPYITSSGSFIINGSEKVIVSQLIRSPGAYFGVSVRN---
RPOB_MYCH2       --------------EILLAEFPFMTQGGTFIINGFEKVVVSQLIRSPGVCFRENVRN---
RPOB_CITSI       ----------MQEQTIFIGNIPLMNSLGTSIVNGIYRIVINQILQSPGIYYRSELGHNG-
RPOB_POPTR       ----------MQEQTIFIGNIPLMNSLGTSIVNGIYRIVINQILQSPGIYYRSELNHNG-
RPOB_AETGR       ----------MQEQRIFIGNIPLMNSLGTSIVNGIYRIVINQILQSPGIYYQSELDHNG-
RPOB_OENEH       ----------MQKQTIFIGNIPLMNSLGTSIVNGIYRIVINQILQSPGIYYRSELDHNG-
RPOB_NYMAL       ----------MQEQTVLLGNIPLMNSLGTSIVNGIYRIVINQILQSPGIYYSTGLDHNG-
RPOB_PIPCE       ----------MQEQTVFIGNIPLMSSLGIFIVNGIYRIVINQILQSPGIYYRSELDHNG-
RPOB_PHAAO       ----------MQEQTVFIGNIPIMNSFGTSIVNGIYRIVINQIVQSPGIYYRSELEHNG-
RPOB_DIOEL       ----------MQEQTIFIGNIPLMNSLGTSIINGIYRIVINQILQNPGVYYRSELDHNG-
RPOB_PHAVU       ----------IKKQTIFVGNIPLMNSLGTSIVNGIYRIVINQILQSPGIYYRSELDPNG-
RPOB_LOTJA       ----------IQEQTIFIGNIPLMNSLGTSIVNGIYRIVINQILQSPGIYYQSELDHKG-
RPOB_JASNU       ----------MQEQTILIGNIPLMNSLGTSIVKGIYRIVINQILQSPGIYYRSELDHNE-
RPOB_LACSA       ----------IQEQTILIGKIPLMTSLGAFIVNGIYRIVINQILQSPGIYYQSELNDNG-
RPOB_SACHY       ------------KQTISIGNIPIMNSLGTFIINGIYRIVINQILLSPGIYYRSELDHKG-
RPOB_PELHO       -----------QKKTICIGNLPLMNSVGTFIVNGISRVVINQILQSPGIYYGSELDYQG-
RPOB_ANTAG       ----------VKKQIVFLGSIPLMNSQGTFVVNGVARVIINQILRSPGIYYNSELDRNG-
RPOB_MARPO       ----------IQKQIVFLGSIPLMNSQGTFVVNGVARVIINQILRSPGIYYNSELDHNG-
RPOB_PHYPA       ----------IQKQTIFIGSIPLIDYQSTFRINSVTRVIINQILRSPGIYYNSELDHNG-
RPOB_PSINU       ----------IREQILFMGSIPLMTSQGTFIINGVTRVLVNQIVRSPGIFYSREPDHKR-
RPOB_ANGEV       ----------IQRQTVHFGSIPLMNSQGTFVINGIARVVINQILRSPGIYYDSELDHNG-
RPOB_PINTH       ----------IQKQTVFLGNIPLMNSHGTFVVNGIYRVVVNQILISPGIYYRSELDHNR-
RPOB_CYCTA       ----------IQKQTVLIGNLPLMNSQGTFVVNGISRIVVNQILRSPGIYYSSEPDQSG-
RPOB_ADICA       ----------VQEEDVRLGSIPWMNSGGTFIINGIARVLVSQILRSPGIYYNRESDQRG-
RPOB_HUPLU       ----------VKEQTVFIGNIPLMSSQGTFVINGIARVIINQMLRSPGIYYKSEKDPDSG
RPOB_CHAGL       -----------QKQKVLLGHIPLITSNGSFIINGISRAVVSQILRSPGIYFGSQLDSNS-
RPOB_CHAVU       ----------TKSEIILIGNIPIMTARGNFIINGASRVIVNQILRSPGLYYGSELDAQAN
RPOB_STAPU       ----------SRIQTVCLGSLPLMTPQGTFVINGVSWTIVNQILRNPGIYY--VLNRNG-
RPOB_ZYGCR       ----------IQKQTVFLGSIPLMSARGTFVIRGVSRCIVSQLLRSPGIYY--TLSVQG-
RPOB_NEPOL       ----------TQIQSVWMGDIPLMTSRGHFIINGSSRVVVNQIVRSPGIYFKEMIDQKH-
RPOB_OSTTA       ----------TF--PVAFCDLPLMTEHGTFILNGSPRVIVHQIVRCPGVYLKPQFDKQG-
RPOB_MESVI       ------------EQDVFLGEIPLMTGRGSFIINGSSRVIVNQIVRSPGIYYKREID-KKG
RPOB_CHLAT       ------------EQDVFLGEMPIMTSRGNFIINGSARVIVNQIVRSPGIYYKREIDPKEG
RPOB_OLTVI       ------------LQWVVLGNLPLMTKRGHFIINGSPRVIINQMVRSPGVYFK-EVSHADQ
RPOB_BIGNA       ------------IEWITLTNIPIMTNKCNFITNGSPRVIMSQITRAPGIYY-----HKEN
RPOB_PHATC       ------------HNQFPIITLPLMTTDATFIINGCERVIVSQIIRSPGVYFEKNKNQKTR
RPOB_THAPS       ------------HSKFPIINLPLMTSSATFVINGCERVIVSQIIRSPGVYFEKNKHQKKN
RPOB_TRIV2       ------------EQEVFIGDLPLMTDRGTFIINGAERVIVNQIVRSPGVYYKSEID-KNG
RPOB_TRIEI       ------------EQEVFIGDLPLMTDRGTFIINGAERVIVNQIVRSPGVYYKSETD-KSG
RPOB_SYNY3       ------------EQEVFIGDLPLMTERGTFIINGAERVIVNQIVRSPGVYYKKELD-KNG
RPOB_SYNE7       ------------EQEVFIGDLPLMTDRGTFIINGAERVIVNQIVRSPGVYYKSERD-KNG
RPOB_THEEB       ------------DQDVFIGDLPLMTDRGTFIINGAERVIVNQIVRSPGVYYKSETD-KNG
RPOB_SYNJA       ------------DMDVFIGELPLMTDRGTFIINGAERVIVNQIVRSPGVYYKSELD-KNG
RPOB_GLOVI       ------------EQQVFIGELPLMTDRGTFIINGAERVIVNQIVRSPGVYYKQELD-TNG
RPOB_PROM5       ------------EQEVFIGELPLMTERGTFIINGAERVIVNQIVRSPGVYFKDEMD-KNG
RPOB_GUITH       ------------EQEVFIGDLPLMTDRGTFIINGAERVIVNQIVRSPGIYYKSELD-KQG
RPOB_RHDSA       ------------EQEVFIGDLPLMTDRGTFIINGAERVIVNQIVRSPGIYYKSETD-RQG
RPOB_PYRYE       SAEKQIKNKKYKKRLVFIGDLPIMTNRGTFIVSGTERVIINQIIRSPGIYYKQEID-KNG
RPOB_GRATL       FFNSQDINKKYRKRPVFIGDLPLMTNRGTFVISGTERIIINQIVRSPGVYYKKELD-KNN
RPOB_CYAPA       ------------QDRIFFGEIPLMTDRCTFLINGVERVIINQIIRSPGIYYSVNTD-EQG
RPOB_CYACA       ------------EQEILLGEIPLMTQKGTFVINGAERVIVNQIVRSPGIYFNSEMD-KNN
RPOB_EMIHU       ------------EKQVFLGDIPLMTDSGTFLVNGIERIIINQIVRSPGIYYKSEAD-KQG
RPOB_EUGLO       -----------KKKYISFCKIPFMTEKGTFICNGNTRIIINQLIRSPGIYIKKKKN----
                                     .*           .    :: *:   ..            

RPOB_MYCGE       NSRKRV---------------------------QEGYVCEVLPA----------------
RPOB_MYCPN       SSRKRV---------------------------QEGYVCEVLPA----------------
RPOB_MYCGA       NSRKRN---------------------------QEGYICEVFPS----------------
RPOB_MYCPE       NSRKRI---------------------------QEGYICEILPA----------------
RPOB_UREPA       GSRKRL---------------------------FEGKICEIYPS----------------
RPOB_ALKEH       HSSG-----------------------------KLLFSARVIPY----------------
RPOB_HALHL       HSSG-----------------------------KLLFSARVIPY----------------
RPOB_METCA       HSSG-----------------------------KLLFNARIIPY----------------
RPOB_XANC8       HSSG-----------------------------KLLYSARIIPY----------------
RPOB_XYLFT       HSSG-----------------------------KLLYSARIIPC----------------
RPOB_LEGPA       HSSG-----------------------------KLLYSARIIPY----------------
RPOB_COXBU       HSSG-----------------------------KLLYSARVIPY----------------
RPOB_NITOC       HSSG-----------------------------KLLFSARIIPY----------------
RPOB_AROAE       HSSG-----------------------------KLLFSARIIPY----------------
RPOB_AZOSB       HSSG-----------------------------KLLFSARIIPY----------------
RPOB_METFK       HSSG-----------------------------KLLFSARIIPY----------------
RPOB_NITEC       HSSG-----------------------------KLLFSARIIPY----------------
RPOB_NITMU       HSSG-----------------------------KLLFSARIIPY----------------
RPOB_THIDA       HSSG-----------------------------KLLFSARVIPY----------------
RPOB_DECAR       HSSG-----------------------------KLLFSARVIPY----------------
RPOB_PARXL       HSSG-----------------------------KLLFSARIIPY----------------
RPOB_HERAR       HSSG-----------------------------KLLFSARIIPY----------------
RPOB_RALSO       HSSG-----------------------------KLLFSARIIPY----------------
RPOB_BORA1       HSSG-----------------------------KLLFSARVIPY----------------
RPOB_RHOFT       HSSG-----------------------------KLLFSARIIPY----------------
RPOB_POLSJ       HSSG-----------------------------KLLFSARIIPY----------------
RPOB_VEREI       HGSG-----------------------------KLLFSARIIPY----------------
RPOB_METPP       HSSG-----------------------------KLLFSARIIPY----------------
RPOB_NEIG1       HSSG-----------------------------KLLFSARIIPY----------------
RPOB_CHRVO       HSSG-----------------------------KLLFSARVIPY----------------
RPOB_ACIBT       HSSG-----------------------------KVLYSARIIPY----------------
RPOB_PSYCK       HSSG-----------------------------KVLYNARIIPY----------------
RPOB_HAHCH       HSSG-----------------------------KLLYSARIIPY----------------
RPOB_MARHV       HSSG-----------------------------KLLYSARVIPY----------------
RPOB_SACD2       HSSG-----------------------------KLLYSARVIPY----------------
RPOB_PSEU5       HSSG-----------------------------KLLYSARIIPY----------------
RPOB_CHRSD       HSSG-----------------------------KLLYSARIIPY----------------
RPOB_ALCBS       HSSG-----------------------------KLLYSARVIPY----------------
RPOB_SODGM       HSSG-----------------------------KVLYNARIIPY----------------
RPOB_ECOLI       HSSG-----------------------------KVLYNARIIPY----------------
RPOB_BAUCH       HSSG-----------------------------KVLFNARIIPY----------------
RPOB_BLOFL       HSSG-----------------------------KILYTARIIPY----------------
RPOB_BLOPB       HSSG-----------------------------KVLYNARIIPY----------------
RPOB_BUCAI       HSSG-----------------------------KVLYNARIIPY----------------
RPOB_BUCAP       HSSG-----------------------------KVLYNARIIPY----------------
RPOB_BUCBP       HSSG-----------------------------KVLYNARIIPY----------------
RPOB_WIGBR       HSSG-----------------------------KVLYNARIIPY----------------
RPOB_BUCCC       HSSG-----------------------------KILYNARIIPY----------------
RPOB_ACTP2       HSSG-----------------------------KVLYNARIIPY----------------
RPOB_MANSM       HSSG-----------------------------KVLYNARIIPY----------------
RPOB_HAEI8       HSSG-----------------------------KVLYNARIIPY----------------
RPOB_ALIF1       HSSG-----------------------------KVLYNARVIPY----------------
RPOB_PHOPR       HSSG-----------------------------KVLYNARVIPY----------------
RPOB_VIBCH       HSSG-----------------------------KVLYNARIIPY----------------
RPOB_AERS4       HSSG-----------------------------KVLYNARVIPY----------------
RPOB_COLP3       HSSG-----------------------------KVLYNARVIPY----------------
RPOB_PSEA6       HSSG-----------------------------KVLYNARVIPY----------------
RPOB_PSEHT       HSSG-----------------------------KVLYNARVIPY----------------
RPOB_SHEAM       HSSG-----------------------------KVLYNARIIPY----------------
RPOB_IDILO       HSSG-----------------------------KVLYNARVIPY----------------
RPOB_PSYIN       HSSG-----------------------------KVLYNARVIPY----------------
RPOB_DICNV       HSSG-----------------------------KKLYNARIIPY----------------
RPOB_HYDCU       HSSG-----------------------------KVLFNARIIPY----------------
RPOB_VESOH       HSSG-----------------------------KILFSSRIIPY----------------
RPOB_FRATO       -DSE-----------------------------EGAFSARIIPY----------------
RPOB_RHIL3       HSSG-----------------------------KLLFAARVIPY----------------
RPOB_RHIME       HSSG-----------------------------KLLFAARVIPY----------------
RPOB_AGRFC       HSSG-----------------------------KLLFAARVIPY----------------
RPOB_RHILO       HSSG-----------------------------KLLFAARVIPY----------------
RPOB_CHESB       HSSG-----------------------------KLLFAARVIPY----------------
RPOB_BRUSU       HSSG-----------------------------KLLFAARVIPY----------------
RPOB_BARBK       HSSG-----------------------------KVLFAARVIPY----------------
RPOB_RHOPB       HSSG-----------------------------KLLFAARVIPY----------------
RPOB_GLUOX       HSSG-----------------------------KYLFAARVIPY----------------
RPOB_GRABC       HSSG-----------------------------KFLFAARVIPY----------------
RPOB_MAGSA       HSSG-----------------------------KYLFAARVIPY----------------
RPOB_RHORT       HSSG-----------------------------KFLFAARVIPY----------------
RPOB_CAUVC       HASG-----------------------------KLLFAARVIPY----------------
RPOB_MARMM       HASG-----------------------------KYLFAARIIPY----------------
RPOB_HYPNA       HASG-----------------------------KLLFAARIIPY----------------
RPOB_RHOS1       HSSG-----------------------------KLLFACRIIPY----------------
RPOB_PARDP       HSSG-----------------------------KLLFACRIIPY----------------
RPOB_ROSDO       HSSG-----------------------------KLLFACRIIPY----------------
RPOB_JANSC       HSSG-----------------------------KLLFACRIIPY----------------
RPOB_NOVAD       HSSG-----------------------------KYLFAARVIPY----------------
RPOB_ERYLH       HSSG-----------------------------KLLFAARVIPY----------------
RPOB_SPHAL       HSSG-----------------------------KFLFAARVIPY----------------
RPOB_ZYMMO       HSSG-----------------------------KFLFAARVIPY----------------
RPOB_PELUB       HASG-----------------------------KLLFNCRVIPN----------------
RPOB_RICBR       HSSR-----------------------------KLLYSARVIPY----------------
RPOB_ORITB       HSTG-----------------------------KLIYSARVIPY----------------
RPOB_ANAMM       YSSG-----------------------------KLIYSARVIPY----------------
RPOB_ANAPZ       YSSG-----------------------------KLIYSARIIPY----------------
RPOB_EHRRW       YSSG-----------------------------KLIYLARIIPY----------------
RPOB_NEOSM       IS-G-----------------------------KLNYIARIIPY----------------
RPOB_MAGMM       HSSG-----------------------------KLLFSARVIPY----------------
RPOB_ANADE       HSSG-----------------------------KLLYNARIIPY----------------
RPOB_MYXXD       HSSG-----------------------------KLLYNARIIPY----------------
RPOB_SYNFM       HSSG-----------------------------KILYSARIIPL----------------
RPOB_SYNAS       LTSG-----------------------------KLIYSARIIPI----------------
RPOB_GEOSL       HSSG-----------------------------KVLYSARVIPY----------------
RPOB_PELPD       HSSG-----------------------------KVLYSARVIPY----------------
RPOB_PELCD       HSSG-----------------------------KILYNARVIPY----------------
RPOB_BDEBA       NASG-----------------------------KLIYSARVIPY----------------
RPOB_DESPS       HSSG-----------------------------KLLYSARIIPV----------------
RPOB_DESVV       HSSR-----------------------------KVLYSCRIIPM----------------
RPOB_DESAG       HSSR-----------------------------KVLYSCRVIPM----------------
RPOB_LAWIP       HASR-----------------------------KVLYSCRIIPM----------------
RPOB_KORVE       -----------------------------------YFLGKIIPY----------------
RPOB_SOLUE       -----------------------------------YFLGKIIPY----------------
RPOB_CAMJJ       VAN------------------------------KLVYTAQIIPD----------------
RPOB_CAMFF       VVN------------------------------KLIYTAQIIPD----------------
RPOB_SULDN       SGN------------------------------KLIYTGQIIPD----------------
RPOB_BACV8       GT--------------------------------KLYSARIIPF----------------
RPOB_PARD8       GT--------------------------------KLYSARIIPF----------------
RPOB_PORGI       GT--------------------------------KLYSARIIPF----------------
RPOB_FLAPJ       GT--------------------------------KLYSARVIPF----------------
RPOB_GRAFK       GT--------------------------------KLYSARVIPF----------------
RPOB_CYTH3       GT--------------------------------KLYSARVIPF----------------
RPOB_SALRD       GT--------------------------------ELFSARVIPF----------------
RPOB_PELLD       GK--------------------------------KMYSAKIVPT----------------
RPOB_CHLPD       GK--------------------------------KMYSAKIVPT----------------
RPOB_CHLCH       GK--------------------------------KMFSAKIVPT----------------
RPOB_CHLTE       GK--------------------------------KMYSAKIVPT----------------
RPOB_CHLMU       GN--------------------------------VLFSFRIIPY----------------
RPOB_CHLPN       GN--------------------------------ILFSFRIIPY----------------
RPOB_PARUW       GN--------------------------------VIYSFRIIPY----------------
RPOB_RHOBA       TDR-------------------------------KLPSCRVIPE----------------
RPOB_TREDE       -----------------------------------VYSSRIIPY----------------
RPOB_TREPA       ---G-----------------------------REVFSSRIIPY----------------
RPOB_BORAP       -----------------------------------LYSARIIPY----------------
RPOB_LEPBL       ---------------------------------RDVFSARVIPY----------------
RPOB_FUSNN       T--G-----------------------------KDLFSGKIIPY----------------
RPOB_CYAM1       ---H-----------------------------VRTFEATFMAN----------------
RPOB_AQUAE       ATIT-----------------------------RILYRGSIIPD----------------
RPOB_DEIRA       YKGI-----------------------------KKQYTAAIIPMPK--------------
RPOB_DEIGD       YKGI-----------------------------KKMYTAAIIPMPK--------------
RPOB_THET8       PARP-----------------------------GR-YIASIIPLPK--------------
RPOB_THEMA       EYID-----------------------------REEYGGYFLPS----------------
RPOB_BACCR       -KNG-----------------------------KRGFTATVIPN----------------
RPOB_BACSU       -KNG-----------------------------KKGFTATVIPN----------------
RPOB_BACHD       -KNG-----------------------------KKGYTATVIPN----------------
RPOB_GEOTN       -KNG-----------------------------KRGYSATVIPN----------------
RPOB_OCEIH       -KNG-----------------------------KRGIGATVIPN----------------
RPOB_LISIN       -KNG-----------------------------KKGFGSTVIPN----------------
RPOB_STAS1       -KNG-----------------------------RTNFDATIIPN----------------
RPOB_STRS2       -KNG-----------------------------KVGYGSTVIPN----------------
RPOB_LACLA       -KNG-----------------------------LESFGHTTIPN----------------
RPOB_LACGA       -KNG-----------------------------RQIFGATVIPN----------------
RPOB_LACAC       -KNG-----------------------------RQIFGTTVIPN----------------
RPOB_LACDB       -KNG-----------------------------RQIFGTTVIPN----------------
RPOB_LACPL       -KNG-----------------------------RPSYGTTVIPN----------------
RPOB_LACBA       -KNG-----------------------------RTVYGATVIPN----------------
RPOB_PEDPA       -KNN-----------------------------RKIWGTTVIPN----------------
RPOB_LACS1       -KNG-----------------------------RTNYGTTVIPN----------------
RPOB_LACSS       -KNS-----------------------------RTTYGTTVIPN----------------
RPOB_LACP3       -KNS-----------------------------RVTYGTTVIPN----------------
RPOB_ENTFA       -KNG-----------------------------KEGFGSTVIPN----------------
RPOB_LEUMM       -KNG-----------------------------RPHFGTTVIPN----------------
RPOB_OENOB       -KTG-----------------------------RVVYGTTVIPN----------------
RPOB_CARHZ       -PNG-----------------------------KKMYLATIIPN----------------
RPOB_MOOTA       -ASG-----------------------------TKVYGATVIPN----------------
RPOB_SYMTH       -PSG-----------------------------KKLFFATMIPN----------------
RPOB_DESHY       -PSG-----------------------------KKVFGATVIPN----------------
RPOB_CLOAB       -KNG-----------------------------KKLFSATVIPN----------------
RPOB_CLONN       -KTG-----------------------------KKLFSSTVIPN----------------
RPOB_CLOPS       -KTG-----------------------------KKLFSATVIPN----------------
RPOB_CLOTE       -KSG-----------------------------KELFSATVIPN----------------
RPOB_HUNT2       -KAG-----------------------------KQLFSNTVIPN----------------
RPOB_CLOD6       -KTG-----------------------------KRLISSTVIPN----------------
RPOB_CALS4       -KFG-----------------------------KKLIFATVIPN----------------
RPOB_SYNWW       -VAG-----------------------------HPLFGATIIPN----------------
RPOB_ONYPE       -KLN-----------------------------RTTYSGQVIPS----------------
RPOB_COREF       -STE-----------------------------RPLHAVKVIPS----------------
RPOB_CORDI       -STE-----------------------------RPLHSVKVIPS----------------
RPOB_CORJK       -STE-----------------------------RPLHSVKVIPS----------------
RPOB2_NOCFA      -GTE-----------------------------KDLHSVRVIPS----------------
RPOB_RHOJR       -GTE-----------------------------KDLHSVKVIPG----------------
RPOB_MYCS2       -STE-----------------------------KTLHSVKVIPG----------------
RPOB1_NOCFA      -GSE-----------------------------KDVHSARVIPS----------------
RPOB_SACEN       -TTD-----------------------------KDVYSVKIIPS----------------
RPOB_FRAAA       -ASD-----------------------------KDLYSCKVIPS----------------
RPOB_STRCO       -TSD-----------------------------KDIFSAKIIPS----------------
RPOB_THEFY       -SSD-----------------------------KELYGCKIIPS----------------
RPOB_ACIC1       -TSD-----------------------------RDIYGCKIIPS----------------
RPOB_NOCSJ       -TSD-----------------------------KDIYTAKLIPS----------------
RPOB_ARTS2       -TSD-----------------------------KDIFTAKIIPS----------------
RPOB_LEIXX       -TSD-----------------------------KDIYSARVIPS----------------
RPOB_CUTAK       -TSD-----------------------------KDIFTCKVIPS----------------
RPOB_BIFAA       -TSD-----------------------------KEVFGAKIIPS----------------
RPOB_TROWT       -NSE-----------------------------KDLFSGRIIPA----------------
RPOB_RUBXD       -DPT-----------------------------KQVLTASLMPH----------------
RPOB_DEHMC       -ATG-----------------------------RPLCHTNLIPS----------------
RPOB_MYCMS       KTGE-----------------------------MIYFA-DIIPS----------------
RPOB_MESFL       KTGE-----------------------------SLYNG-DIIPS----------------
RPOB_MYCMO       KQAD-----------------------------DLFNKLEIIPK----------------
RPOB_MYCPU       KQSD-----------------------------DLFNKVEVLPR----------------
RPOB_MYCS5       KQSE-----------------------------DLFNKLEILPR----------------
RPOB_MYCH2       QQAD-----------------------------DLFNKVEIIPQ----------------
RPOB_CITSI       IS---------------------------------VYTGTIISDW---------------
RPOB_POPTR       IS---------------------------------VYTGTIISDW---------------
RPOB_AETGR       IS---------------------------------VYTGTIISDW---------------
RPOB_OENEH       IS---------------------------------VYTGTIISDW---------------
RPOB_NYMAL       IS---------------------------------VYTGTIISDW---------------
RPOB_PIPCE       IF---------------------------------IYTGTIISDW---------------
RPOB_PHAAO       VS---------------------------------VYTSTIISDW---------------
RPOB_DIOEL       IS---------------------------------VYTSTIISDW---------------
RPOB_PHAVU       IS---------------------------------VYTGTIISDW---------------
RPOB_LOTJA       IS---------------------------------VYTGTIISDW---------------
RPOB_JASNU       IS---------------------------------VYTGTIISDW---------------
RPOB_LACSA       IS---------------------------------VYTGTIISDW---------------
RPOB_SACHY       IS---------------------------------ICTGTIISDW---------------
RPOB_PELHO       FT---------------------------------VYIATIISDW---------------
RPOB_ANTAG       IP---------------------------------IYTGTIISDW---------------
RPOB_MARPO       IP---------------------------------IYTGTLISNW---------------
RPOB_PHYPA       IS---------------------------------IYTGTIISDW---------------
RPOB_PSINU       IP---------------------------------LYTGTIISNW---------------
RPOB_ANGEV       NS---------------------------------IYTGTIISDW---------------
RPOB_PINTH       INY--------------------------------IYTGTLISDW---------------
RPOB_CYCTA       IT---------------------------------LYTSTIISDW---------------
RPOB_ADICA       -IL--------------------------------AYTSTVISDQ---------------
RPOB_HUPLU       EIT--------------------------------TYTATIISNW---------------
RPOB_CHAGL       -KC--------------------------------IYTATIISES---------------
RPOB_CHAVU       IT----------------------------------YSCTFISEW---------------
RPOB_STAPU       -----------------------------------MYTATILCLDV--------------
RPOB_ZYGCR       -----------------------------------VYTATIICNS---------------
RPOB_NEPOL       -RR--------------------------------MFQASIISNR---------------
RPOB_OSTTA       -NR--------------------------------THLVSFLSAY---------------
RPOB_MESVI       RK---------------------------------THSATIISNRG--------------
RPOB_CHLAT       IK---------------------------------TYSASIICNRG--------------
RPOB_OLTVI       KL---------------------------------TYYADLIAYRG--------------
RPOB_BIGNA       EN---------------------------------TYYADIIAERG--------------
RPOB_PHATC       NQFKKKLSTDINKLRSFIPSGEAFISEFDLFFPLPTSIYDPVKKKKKIIP--------HW
RPOB_THAPS       KKIRKLISSEIGKLKSFTPPSEILPTESRLYFLKPTIKKKLISDKKKKIRFIKKEEYWNW
RPOB_TRIV2       RR---------------------------------TYSASLIPNRG--------------
RPOB_TRIEI       RR---------------------------------TYNASLIPNRG--------------
RPOB_SYNY3       RR---------------------------------TYSASLIPNRG--------------
RPOB_SYNE7       RL---------------------------------THNASLIPNRG--------------
RPOB_THEEB       RR---------------------------------TYNASLIPNRG--------------
RPOB_SYNJA       RR---------------------------------TYSASLIPNRG--------------
RPOB_GLOVI       RK---------------------------------TFNASLIPNRG--------------
RPOB_PROM5       RR---------------------------------TYNASVIPNRG--------------
RPOB_GUITH       RR---------------------------------TYSSSLISNRG--------------
RPOB_RHDSA       RR---------------------------------TYSGSLISNRG--------------
RPOB_PYRYE       KQ---------------------------------IYSASLISNRG--------------
RPOB_GRATL       KQ---------------------------------IYSCSIISNRG--------------
RPOB_CYAPA       TR---------------------------------TYDVTIISNRG--------------
RPOB_CYACA       LK---------------------------------TFNFLIIPNRG--------------
RPOB_EMIHU       VR---------------------------------IYTASLISNRG--------------
RPOB_EUGLO       -----------------------------------CLLATLIPK----------------
                                                                             

RPOB_MYCGE       -------------------------------------------------NGSVMLIYISN
RPOB_MYCPN       -------------------------------------------------NGSVMLIYISN
RPOB_MYCGA       -------------------------------------------------KGTLMLFYIAE
RPOB_MYCPE       -------------------------------------------------KGTLFFIFMAE
RPOB_UREPA       -------------------------------------------------KGTLMLGYIPK
RPOB_ALKEH       -------------------------------------------------RGSWLDFEFD-
RPOB_HALHL       -------------------------------------------------RGSWLDFEFD-
RPOB_METCA       -------------------------------------------------RGSWLDFEFD-
RPOB_XANC8       -------------------------------------------------RGSWLDFEFD-
RPOB_XYLFT       -------------------------------------------------RGSWLDFEFD-
RPOB_LEGPA       -------------------------------------------------RGSWLDFEFD-
RPOB_COXBU       -------------------------------------------------RGSWLDFEFD-
RPOB_NITOC       -------------------------------------------------RGSWLDFEFD-
RPOB_AROAE       -------------------------------------------------RGSWLDFEFD-
RPOB_AZOSB       -------------------------------------------------RGSWLDFEFD-
RPOB_METFK       -------------------------------------------------RGSWLDFEFD-
RPOB_NITEC       -------------------------------------------------RGSWLDFEFD-
RPOB_NITMU       -------------------------------------------------RGSWLDFEFD-
RPOB_THIDA       -------------------------------------------------RGSWLDFEFD-
RPOB_DECAR       -------------------------------------------------RGSWLDFEFD-
RPOB_PARXL       -------------------------------------------------RGSWLDFEFD-
RPOB_HERAR       -------------------------------------------------RGSWLDYEFD-
RPOB_RALSO       -------------------------------------------------RGSWLDFEFD-
RPOB_BORA1       -------------------------------------------------RGSWLDFEFD-
RPOB_RHOFT       -------------------------------------------------RGSWLDFEFD-
RPOB_POLSJ       -------------------------------------------------RGSWLDFEFD-
RPOB_VEREI       -------------------------------------------------RGSWLDFEFD-
RPOB_METPP       -------------------------------------------------RGSWLDFEFD-
RPOB_NEIG1       -------------------------------------------------RGSWLDFEFD-
RPOB_CHRVO       -------------------------------------------------RGSWLDFEFD-
RPOB_ACIBT       -------------------------------------------------RGSWLDFEFD-
RPOB_PSYCK       -------------------------------------------------RGSWLDFEFD-
RPOB_HAHCH       -------------------------------------------------RGSWLDFEFD-
RPOB_MARHV       -------------------------------------------------RGSWLDFEFD-
RPOB_SACD2       -------------------------------------------------RGSWLDFEFD-
RPOB_PSEU5       -------------------------------------------------RGSWLDFEFD-
RPOB_CHRSD       -------------------------------------------------RGSWLDFEFD-
RPOB_ALCBS       -------------------------------------------------RGSWLDFEFD-
RPOB_SODGM       -------------------------------------------------RGSWLDFEFD-
RPOB_ECOLI       -------------------------------------------------RGSWLDFEFD-
RPOB_BAUCH       -------------------------------------------------RGSWLDFEFD-
RPOB_BLOFL       -------------------------------------------------RGSWLDFEFD-
RPOB_BLOPB       -------------------------------------------------RGSWLDFEFD-
RPOB_BUCAI       -------------------------------------------------RGSWLDFEFD-
RPOB_BUCAP       -------------------------------------------------RGSWLDFEFD-
RPOB_BUCBP       -------------------------------------------------RGSWLDFEFD-
RPOB_WIGBR       -------------------------------------------------RGSWLDFEFD-
RPOB_BUCCC       -------------------------------------------------RGSWLDVEFD-
RPOB_ACTP2       -------------------------------------------------RGSWLDFEFD-
RPOB_MANSM       -------------------------------------------------RGSWLDFEFD-
RPOB_HAEI8       -------------------------------------------------RGSWLDFEFD-
RPOB_ALIF1       -------------------------------------------------RGSWLDFEFD-
RPOB_PHOPR       -------------------------------------------------RGSWLDFEFD-
RPOB_VIBCH       -------------------------------------------------RGSWLDFEFD-
RPOB_AERS4       -------------------------------------------------RGSWLDFEFD-
RPOB_COLP3       -------------------------------------------------RGSWLDFEFD-
RPOB_PSEA6       -------------------------------------------------RGSWLDFEFD-
RPOB_PSEHT       -------------------------------------------------RGSWLDFEFD-
RPOB_SHEAM       -------------------------------------------------RGSWLDFEFD-
RPOB_IDILO       -------------------------------------------------RGSWLDFEFD-
RPOB_PSYIN       -------------------------------------------------RGSWLDFEFD-
RPOB_DICNV       -------------------------------------------------RGSWLDLEFD-
RPOB_HYDCU       -------------------------------------------------RGSWLDFEFD-
RPOB_VESOH       -------------------------------------------------RGSWLDFEYD-
RPOB_FRATO       -------------------------------------------------RGSWLDFEFD-
RPOB_RHIL3       -------------------------------------------------RGSWLDIEFD-
RPOB_RHIME       -------------------------------------------------RGSWLDIEFD-
RPOB_AGRFC       -------------------------------------------------RGSWLDIEFD-
RPOB_RHILO       -------------------------------------------------RGSWLDIEFD-
RPOB_CHESB       -------------------------------------------------RGSWLDIEFD-
RPOB_BRUSU       -------------------------------------------------RGSWLDIEFD-
RPOB_BARBK       -------------------------------------------------RGSWLDIEFD-
RPOB_RHOPB       -------------------------------------------------RGSWLDIEFD-
RPOB_GLUOX       -------------------------------------------------RGSWLDFEFD-
RPOB_GRABC       -------------------------------------------------RGSWLDFEFD-
RPOB_MAGSA       -------------------------------------------------RGSWLDFEFD-
RPOB_RHORT       -------------------------------------------------RGSWLDFEFD-
RPOB_CAUVC       -------------------------------------------------RGSWLDFEFD-
RPOB_MARMM       -------------------------------------------------RGSWLDFEFD-
RPOB_HYPNA       -------------------------------------------------RGSWLDFEFD-
RPOB_RHOS1       -------------------------------------------------RGSWLDFEFD-
RPOB_PARDP       -------------------------------------------------RGSWLDFEFD-
RPOB_ROSDO       -------------------------------------------------RGSWLDFEFD-
RPOB_JANSC       -------------------------------------------------RGSWLDFEFD-
RPOB_NOVAD       -------------------------------------------------RGSWLDFEFD-
RPOB_ERYLH       -------------------------------------------------RGSWLDFEFD-
RPOB_SPHAL       -------------------------------------------------RGSWLDFEFD-
RPOB_ZYMMO       -------------------------------------------------RGSWLDFEFD-
RPOB_PELUB       -------------------------------------------------RGSWLDLEYD-
RPOB_RICBR       -------------------------------------------------RGSWLDLEFD-
RPOB_ORITB       -------------------------------------------------RGSWLDFEFD-
RPOB_ANAMM       -------------------------------------------------RGSWLDFEFD-
RPOB_ANAPZ       -------------------------------------------------RGSWLDFEFD-
RPOB_EHRRW       -------------------------------------------------RGSWLDFEFD-
RPOB_NEOSM       -------------------------------------------------RGSWLDFEFD-
RPOB_MAGMM       -------------------------------------------------RGSWLDFEFD-
RPOB_ANADE       -------------------------------------------------RGSWIDFEFD-
RPOB_MYXXD       -------------------------------------------------RGSWIDFEFD-
RPOB_SYNFM       -------------------------------------------------RGSWLDLEFD-
RPOB_SYNAS       -------------------------------------------------RGSWLDLEFD-
RPOB_GEOSL       -------------------------------------------------RGSWLDFEFD-
RPOB_PELPD       -------------------------------------------------RGSWLDFEFD-
RPOB_PELCD       -------------------------------------------------RGSWLDFDFD-
RPOB_BDEBA       -------------------------------------------------RGSWLDAEFD-
RPOB_DESPS       -------------------------------------------------RGSWIDLEFD-
RPOB_DESVV       -------------------------------------------------RGSWLDFDFD-
RPOB_DESAG       -------------------------------------------------RGSWLDFDYD-
RPOB_LAWIP       -------------------------------------------------RGSWLDFDFD-
RPOB_KORVE       -------------------------------------------------RGSWVEFEYD-
RPOB_SOLUE       -------------------------------------------------RGSWVEFEYD-
RPOB_CAMJJ       -------------------------------------------------RGSWLYFEYD-
RPOB_CAMFF       -------------------------------------------------RGSWLYFEYD-
RPOB_SULDN       -------------------------------------------------RGSWLYFEYD-
RPOB_BACV8       -------------------------------------------------KGSWIEFATD-
RPOB_PARD8       -------------------------------------------------KGSWIEFATD-
RPOB_PORGI       -------------------------------------------------KGSWIEFATD-
RPOB_FLAPJ       -------------------------------------------------KGSWIEFATD-
RPOB_GRAFK       -------------------------------------------------KGSWIEFATD-
RPOB_CYTH3       -------------------------------------------------KGSWIEFATD-
RPOB_SALRD       -------------------------------------------------RGSWMEFSTD-
RPOB_PELLD       -------------------------------------------------RGSWIEFQTD-
RPOB_CHLPD       -------------------------------------------------RGSWIEFQTD-
RPOB_CHLCH       -------------------------------------------------RGSWIEFQTD-
RPOB_CHLTE       -------------------------------------------------RGSWIEFQTD-
RPOB_CHLMU       -------------------------------------------------RGSWLEASFD-
RPOB_CHLPN       -------------------------------------------------RGSWLEAIFD-
RPOB_PARUW       -------------------------------------------------RGSWLEGAFD-
RPOB_RHOBA       -------------------------------------------------RGSWIEVNVT-
RPOB_TREDE       -------------------------------------------------RGTWLEFEID-
RPOB_TREPA       -------------------------------------------------RGSWLEFEID-
RPOB_BORAP       -------------------------------------------------RGSWLEFEID-
RPOB_LEPBL       -------------------------------------------------RGSWLEFEMD-
RPOB_FUSNN       -------------------------------------------------KGTWLEFETD-
RPOB_CYAM1       -------------------------------------------------RGAWIKYELD-
RPOB_AQUAE       -------------------------------------------------KGSRVEFELS-
RPOB_DEIRA       -------------------------------------------------RGPWIELEFA-
RPOB_DEIGD       -------------------------------------------------RGPWIELEFN-
RPOB_THET8       -------------------------------------------------RGPWIDLEVE-
RPOB_THEMA       -------------------------------------------------RGAWLEVILD-
RPOB_BACCR       -------------------------------------------------RGAWLEYETD-
RPOB_BACSU       -------------------------------------------------RGAWLEYETD-
RPOB_BACHD       -------------------------------------------------RGAWLELETD-
RPOB_GEOTN       -------------------------------------------------RGAWLEYETD-
RPOB_OCEIH       -------------------------------------------------RGAWLEFETD-
RPOB_LISIN       -------------------------------------------------RGAWLEYETD-
RPOB_STAS1       -------------------------------------------------RGAWLEYETD-
RPOB_STRS2       -------------------------------------------------RGAWLELETD-
RPOB_LACLA       -------------------------------------------------RGAWFELDTD-
RPOB_LACGA       -------------------------------------------------RGAWLEYETD-
RPOB_LACAC       -------------------------------------------------RGAWLEYETD-
RPOB_LACDB       -------------------------------------------------RGAWLEFETD-
RPOB_LACPL       -------------------------------------------------RGAWLELETD-
RPOB_LACBA       -------------------------------------------------RGAWLEFETD-
RPOB_PEDPA       -------------------------------------------------RGAWLEYETD-
RPOB_LACS1       -------------------------------------------------RGAWLEYETD-
RPOB_LACSS       -------------------------------------------------RGAWLEFETD-
RPOB_LACP3       -------------------------------------------------RGAWLEYETD-
RPOB_ENTFA       -------------------------------------------------RGAWLEMETD-
RPOB_LEUMM       -------------------------------------------------RGAWLEYETD-
RPOB_OENOB       -------------------------------------------------RGAWLELDTD-
RPOB_CARHZ       -------------------------------------------------RGAWLEFETD-
RPOB_MOOTA       -------------------------------------------------RGAWLEFETD-
RPOB_SYMTH       -------------------------------------------------RGAWLEFESD-
RPOB_DESHY       -------------------------------------------------RGAWLEFETD-
RPOB_CLOAB       -------------------------------------------------RGAWLEYETD-
RPOB_CLONN       -------------------------------------------------RGAWLEYETD-
RPOB_CLOPS       -------------------------------------------------RGAWLEYETD-
RPOB_CLOTE       -------------------------------------------------RGAWLEYETD-
RPOB_HUNT2       -------------------------------------------------RGAWLEYETD-
RPOB_CLOD6       -------------------------------------------------RGAWLEYETD-
RPOB_CALS4       -------------------------------------------------RGAWLEYEED-
RPOB_SYNWW       -------------------------------------------------RGAWFELEMD-
RPOB_ONYPE       -------------------------------------------------RGAWIEYEEG-
RPOB_COREF       -------------------------------------------------RGAWLEFDVD-
RPOB_CORDI       -------------------------------------------------RGAWLEFDVD-
RPOB_CORJK       -------------------------------------------------RGAWLEFDVD-
RPOB2_NOCFA      -------------------------------------------------RGAWLEFDVD-
RPOB_RHOJR       -------------------------------------------------RGAWLEFDVD-
RPOB_MYCS2       -------------------------------------------------RGAWLEFDVD-
RPOB1_NOCFA      -------------------------------------------------RGAWLEFDVD-
RPOB_SACEN       -------------------------------------------------RGAWLEFDVD-
RPOB_FRAAA       -------------------------------------------------RGAWLEFEID-
RPOB_STRCO       -------------------------------------------------RGAWLEMEID-
RPOB_THEFY       -------------------------------------------------RGAWLEFEID-
RPOB_ACIC1       -------------------------------------------------RGAWLELEID-
RPOB_NOCSJ       -------------------------------------------------RGAWLEFEID-
RPOB_ARTS2       -------------------------------------------------RGAWFELEID-
RPOB_LEIXX       -------------------------------------------------RGSWLEFEID-
RPOB_CUTAK       -------------------------------------------------RGAWLEFAID-
RPOB_BIFAA       -------------------------------------------------RGAWLEFEID-
RPOB_TROWT       -------------------------------------------------RGAWLEFEVD-
RPOB_RUBXD       -------------------------------------------------RGSWLEFEVE-
RPOB_DEHMC       -------------------------------------------------RGAWLEFETS-
RPOB_MYCMS       -------------------------------------------------RGTWLEYETDS
RPOB_MESFL       -------------------------------------------------RGTWLEFETDT
RPOB_MYCMO       -------------------------------------------------LGSWIEISH--
RPOB_MYCPU       -------------------------------------------------IGSWIEIKH--
RPOB_MYCS5       -------------------------------------------------IGSWIEVSH--
RPOB_MYCH2       -------------------------------------------------LGSWMEIFH--
RPOB_CITSI       --------------------------------------------------GGRFELEID-
RPOB_POPTR       --------------------------------------------------GGRVELEID-
RPOB_AETGR       --------------------------------------------------GGRLELEID-
RPOB_OENEH       --------------------------------------------------GGRLELEID-
RPOB_NYMAL       --------------------------------------------------GGRSELEID-
RPOB_PIPCE       --------------------------------------------------GGRSELEID-
RPOB_PHAAO       --------------------------------------------------GGRSELEID-
RPOB_DIOEL       --------------------------------------------------GGRLELEID-
RPOB_PHAVU       --------------------------------------------------GGRLELEID-
RPOB_LOTJA       --------------------------------------------------GGRLELEID-
RPOB_JASNU       --------------------------------------------------GGRSELEID-
RPOB_LACSA       --------------------------------------------------GGRLELEID-
RPOB_SACHY       --------------------------------------------------GGRLELAID-
RPOB_PELHO       --------------------------------------------------GGRLKLEID-
RPOB_ANTAG       --------------------------------------------------GRRLKLEID-
RPOB_MARPO       --------------------------------------------------GGRLKLEID-
RPOB_PHYPA       --------------------------------------------------GGRLKLEID-
RPOB_PSINU       --------------------------------------------------GGRFKLEID-
RPOB_ANGEV       --------------------------------------------------GGRFKSEID-
RPOB_PINTH       --------------------------------------------------GRRSKLEID-
RPOB_CYCTA       --------------------------------------------------GGRSKLEID-
RPOB_ADICA       --------------------------------------------------GGRFKLEID-
RPOB_HUPLU       --------------------------------------------------GERLQLELD-
RPOB_CHAGL       --------------------------------------------------GSRLKLEID-
RPOB_CHAVU       --------------------------------------------------GGRLKLEMD-
RPOB_STAPU       --------------------------------------------------DKRLRLEID-
RPOB_ZYGCR       --------------------------------------------------GKSFKLELD-
RPOB_NEPOL       --------------------------------------------------GSWVRLETD-
RPOB_OSTTA       --------------------------------------------------GSWLRFETD-
RPOB_MESVI       ---------------------------------------------------AWLRIETD-
RPOB_CHLAT       ---------------------------------------------------AWLRLETD-
RPOB_OLTVI       ---------------------------------------------------AWLRIELD-
RPOB_BIGNA       ---------------------------------------------------NWLRIEID-
RPOB_PHATC       QSNSIYYYSIKYLKQKQQNSTFYFLQSFKLYRVASKLLSSKSKQRVIQLFLKWLKLKNK-
RPOB_THAPS       KGESLNIYSFKQIKDYEIDFSTSFVEHFKVYNDLFKIRHLSTKIKRIKIFLKWLACNNKF
RPOB_TRIV2       ---------------------------------------------------AWLKFETD-
RPOB_TRIEI       ---------------------------------------------------AWLKFETD-
RPOB_SYNY3       ---------------------------------------------------AWLKFETD-
RPOB_SYNE7       ---------------------------------------------------AWLKFETD-
RPOB_THEEB       ---------------------------------------------------AWLKFETD-
RPOB_SYNJA       ---------------------------------------------------AWLKFETD-
RPOB_GLOVI       ---------------------------------------------------AWLKFETD-
RPOB_PROM5       ---------------------------------------------------AWLKFETD-
RPOB_GUITH       ---------------------------------------------------AWVKFETD-
RPOB_RHDSA       ---------------------------------------------------AWVKFETD-
RPOB_PYRYE       ---------------------------------------------------SWLKFEID-
RPOB_GRATL       ---------------------------------------------------SWLKFEID-
RPOB_CYAPA       ---------------------------------------------------AWLKFEVD-
RPOB_CYACA       ---------------------------------------------------AWLKCEID-
RPOB_EMIHU       ---------------------------------------------------TWVKFEID-
RPOB_EUGLO       -------------------------------------------------TGSWITIKRN-
                                                                             

RPOB_MYCGE       KKKIE-------------------------------------------------------
RPOB_MYCPN       KKKIE-------------------------------------------------------
RPOB_MYCGA       NK----------------------------------------------------------
RPOB_MYCPE       NK----------------------------------------------------------
RPOB_UREPA       DR----------------------------------------------------------
RPOB_ALKEH       ------------------------------------------------------------
RPOB_HALHL       ------------------------------------------------------------
RPOB_METCA       ------------------------------------------------------------
RPOB_XANC8       ------------------------------------------------------------
RPOB_XYLFT       ------------------------------------------------------------
RPOB_LEGPA       ------------------------------------------------------------
RPOB_COXBU       ------------------------------------------------------------
RPOB_NITOC       ------------------------------------------------------------
RPOB_AROAE       ------------------------------------------------------------
RPOB_AZOSB       ------------------------------------------------------------
RPOB_METFK       ------------------------------------------------------------
RPOB_NITEC       ------------------------------------------------------------
RPOB_NITMU       ------------------------------------------------------------
RPOB_THIDA       ------------------------------------------------------------
RPOB_DECAR       ------------------------------------------------------------
RPOB_PARXL       ------------------------------------------------------------
RPOB_HERAR       ------------------------------------------------------------
RPOB_RALSO       ------------------------------------------------------------
RPOB_BORA1       ------------------------------------------------------------
RPOB_RHOFT       ------------------------------------------------------------
RPOB_POLSJ       ------------------------------------------------------------
RPOB_VEREI       ------------------------------------------------------------
RPOB_METPP       ------------------------------------------------------------
RPOB_NEIG1       ------------------------------------------------------------
RPOB_CHRVO       ------------------------------------------------------------
RPOB_ACIBT       ------------------------------------------------------------
RPOB_PSYCK       ------------------------------------------------------------
RPOB_HAHCH       ------------------------------------------------------------
RPOB_MARHV       ------------------------------------------------------------
RPOB_SACD2       ------------------------------------------------------------
RPOB_PSEU5       ------------------------------------------------------------
RPOB_CHRSD       ------------------------------------------------------------
RPOB_ALCBS       ------------------------------------------------------------
RPOB_SODGM       ------------------------------------------------------------
RPOB_ECOLI       ------------------------------------------------------------
RPOB_BAUCH       ------------------------------------------------------------
RPOB_BLOFL       ------------------------------------------------------------
RPOB_BLOPB       ------------------------------------------------------------
RPOB_BUCAI       ------------------------------------------------------------
RPOB_BUCAP       ------------------------------------------------------------
RPOB_BUCBP       ------------------------------------------------------------
RPOB_WIGBR       ------------------------------------------------------------
RPOB_BUCCC       ------------------------------------------------------------
RPOB_ACTP2       ------------------------------------------------------------
RPOB_MANSM       ------------------------------------------------------------
RPOB_HAEI8       ------------------------------------------------------------
RPOB_ALIF1       ------------------------------------------------------------
RPOB_PHOPR       ------------------------------------------------------------
RPOB_VIBCH       ------------------------------------------------------------
RPOB_AERS4       ------------------------------------------------------------
RPOB_COLP3       ------------------------------------------------------------
RPOB_PSEA6       ------------------------------------------------------------
RPOB_PSEHT       ------------------------------------------------------------
RPOB_SHEAM       ------------------------------------------------------------
RPOB_IDILO       ------------------------------------------------------------
RPOB_PSYIN       ------------------------------------------------------------
RPOB_DICNV       ------------------------------------------------------------
RPOB_HYDCU       ------------------------------------------------------------
RPOB_VESOH       ------------------------------------------------------------
RPOB_FRATO       ------------------------------------------------------------
RPOB_RHIL3       ------------------------------------------------------------
RPOB_RHIME       ------------------------------------------------------------
RPOB_AGRFC       ------------------------------------------------------------
RPOB_RHILO       ------------------------------------------------------------
RPOB_CHESB       ------------------------------------------------------------
RPOB_BRUSU       ------------------------------------------------------------
RPOB_BARBK       ------------------------------------------------------------
RPOB_RHOPB       ------------------------------------------------------------
RPOB_GLUOX       ------------------------------------------------------------
RPOB_GRABC       ------------------------------------------------------------
RPOB_MAGSA       ------------------------------------------------------------
RPOB_RHORT       ------------------------------------------------------------
RPOB_CAUVC       ------------------------------------------------------------
RPOB_MARMM       ------------------------------------------------------------
RPOB_HYPNA       ------------------------------------------------------------
RPOB_RHOS1       ------------------------------------------------------------
RPOB_PARDP       ------------------------------------------------------------
RPOB_ROSDO       ------------------------------------------------------------
RPOB_JANSC       ------------------------------------------------------------
RPOB_NOVAD       ------------------------------------------------------------
RPOB_ERYLH       ------------------------------------------------------------
RPOB_SPHAL       ------------------------------------------------------------
RPOB_ZYMMO       ------------------------------------------------------------
RPOB_PELUB       ------------------------------------------------------------
RPOB_RICBR       ------------------------------------------------------------
RPOB_ORITB       ------------------------------------------------------------
RPOB_ANAMM       ------------------------------------------------------------
RPOB_ANAPZ       ------------------------------------------------------------
RPOB_EHRRW       ------------------------------------------------------------
RPOB_NEOSM       ------------------------------------------------------------
RPOB_MAGMM       ------------------------------------------------------------
RPOB_ANADE       ------------------------------------------------------------
RPOB_MYXXD       ------------------------------------------------------------
RPOB_SYNFM       ------------------------------------------------------------
RPOB_SYNAS       ------------------------------------------------------------
RPOB_GEOSL       ------------------------------------------------------------
RPOB_PELPD       ------------------------------------------------------------
RPOB_PELCD       ------------------------------------------------------------
RPOB_BDEBA       ------------------------------------------------------------
RPOB_DESPS       ------------------------------------------------------------
RPOB_DESVV       ------------------------------------------------------------
RPOB_DESAG       ------------------------------------------------------------
RPOB_LAWIP       ------------------------------------------------------------
RPOB_KORVE       ------------------------------------------------------------
RPOB_SOLUE       ------------------------------------------------------------
RPOB_CAMJJ       ------------------------------------------------------------
RPOB_CAMFF       ------------------------------------------------------------
RPOB_SULDN       ------------------------------------------------------------
RPOB_BACV8       ------------------------------------------------------------
RPOB_PARD8       ------------------------------------------------------------
RPOB_PORGI       ------------------------------------------------------------
RPOB_FLAPJ       ------------------------------------------------------------
RPOB_GRAFK       ------------------------------------------------------------
RPOB_CYTH3       ------------------------------------------------------------
RPOB_SALRD       ------------------------------------------------------------
RPOB_PELLD       ------------------------------------------------------------
RPOB_CHLPD       ------------------------------------------------------------
RPOB_CHLCH       ------------------------------------------------------------
RPOB_CHLTE       ------------------------------------------------------------
RPOB_CHLMU       ------------------------------------------------------------
RPOB_CHLPN       ------------------------------------------------------------
RPOB_PARUW       ------------------------------------------------------------
RPOB_RHOBA       ------------------------------------------------------------
RPOB_TREDE       ------------------------------------------------------------
RPOB_TREPA       ------------------------------------------------------------
RPOB_BORAP       ------------------------------------------------------------
RPOB_LEPBL       ------------------------------------------------------------
RPOB_FUSNN       ------------------------------------------------------------
RPOB_CYAM1       ------------------------------------------------------------
RPOB_AQUAE       ------------------------------------------------------------
RPOB_DEIRA       ------------------------------------------------------------
RPOB_DEIGD       ------------------------------------------------------------
RPOB_THET8       ------------------------------------------------------------
RPOB_THEMA       ------------------------------------------------------------
RPOB_BACCR       ------------------------------------------------------------
RPOB_BACSU       ------------------------------------------------------------
RPOB_BACHD       ------------------------------------------------------------
RPOB_GEOTN       ------------------------------------------------------------
RPOB_OCEIH       ------------------------------------------------------------
RPOB_LISIN       ------------------------------------------------------------
RPOB_STAS1       ------------------------------------------------------------
RPOB_STRS2       ------------------------------------------------------------
RPOB_LACLA       ------------------------------------------------------------
RPOB_LACGA       ------------------------------------------------------------
RPOB_LACAC       ------------------------------------------------------------
RPOB_LACDB       ------------------------------------------------------------
RPOB_LACPL       ------------------------------------------------------------
RPOB_LACBA       ------------------------------------------------------------
RPOB_PEDPA       ------------------------------------------------------------
RPOB_LACS1       ------------------------------------------------------------
RPOB_LACSS       ------------------------------------------------------------
RPOB_LACP3       ------------------------------------------------------------
RPOB_ENTFA       ------------------------------------------------------------
RPOB_LEUMM       ------------------------------------------------------------
RPOB_OENOB       ------------------------------------------------------------
RPOB_CARHZ       ------------------------------------------------------------
RPOB_MOOTA       ------------------------------------------------------------
RPOB_SYMTH       ------------------------------------------------------------
RPOB_DESHY       ------------------------------------------------------------
RPOB_CLOAB       ------------------------------------------------------------
RPOB_CLONN       ------------------------------------------------------------
RPOB_CLOPS       ------------------------------------------------------------
RPOB_CLOTE       ------------------------------------------------------------
RPOB_HUNT2       ------------------------------------------------------------
RPOB_CLOD6       ------------------------------------------------------------
RPOB_CALS4       ------------------------------------------------------------
RPOB_SYNWW       ------------------------------------------------------------
RPOB_ONYPE       ------------------------------------------------------------
RPOB_COREF       ------------------------------------------------------------
RPOB_CORDI       ------------------------------------------------------------
RPOB_CORJK       ------------------------------------------------------------
RPOB2_NOCFA      ------------------------------------------------------------
RPOB_RHOJR       ------------------------------------------------------------
RPOB_MYCS2       ------------------------------------------------------------
RPOB1_NOCFA      ------------------------------------------------------------
RPOB_SACEN       ------------------------------------------------------------
RPOB_FRAAA       ------------------------------------------------------------
RPOB_STRCO       ------------------------------------------------------------
RPOB_THEFY       ------------------------------------------------------------
RPOB_ACIC1       ------------------------------------------------------------
RPOB_NOCSJ       ------------------------------------------------------------
RPOB_ARTS2       ------------------------------------------------------------
RPOB_LEIXX       ------------------------------------------------------------
RPOB_CUTAK       ------------------------------------------------------------
RPOB_BIFAA       ------------------------------------------------------------
RPOB_TROWT       ------------------------------------------------------------
RPOB_RUBXD       ------------------------------------------------------------
RPOB_DEHMC       ------------------------------------------------------------
RPOB_MYCMS       K-----------------------------------------------------------
RPOB_MESFL       K-----------------------------------------------------------
RPOB_MYCMO       ------------------------------------------------------------
RPOB_MYCPU       ------------------------------------------------------------
RPOB_MYCS5       ------------------------------------------------------------
RPOB_MYCH2       ------------------------------------------------------------
RPOB_CITSI       ------------------------------------------------------------
RPOB_POPTR       ------------------------------------------------------------
RPOB_AETGR       ------------------------------------------------------------
RPOB_OENEH       ------------------------------------------------------------
RPOB_NYMAL       ------------------------------------------------------------
RPOB_PIPCE       ------------------------------------------------------------
RPOB_PHAAO       ------------------------------------------------------------
RPOB_DIOEL       ------------------------------------------------------------
RPOB_PHAVU       ------------------------------------------------------------
RPOB_LOTJA       ------------------------------------------------------------
RPOB_JASNU       ------------------------------------------------------------
RPOB_LACSA       ------------------------------------------------------------
RPOB_SACHY       ------------------------------------------------------------
RPOB_PELHO       ------------------------------------------------------------
RPOB_ANTAG       ------------------------------------------------------------
RPOB_MARPO       ------------------------------------------------------------
RPOB_PHYPA       ------------------------------------------------------------
RPOB_PSINU       ------------------------------------------------------------
RPOB_ANGEV       ------------------------------------------------------------
RPOB_PINTH       ------------------------------------------------------------
RPOB_CYCTA       ------------------------------------------------------------
RPOB_ADICA       ------------------------------------------------------------
RPOB_HUPLU       ------------------------------------------------------------
RPOB_CHAGL       ------------------------------------------------------------
RPOB_CHAVU       ------------------------------------------------------------
RPOB_STAPU       ------------------------------------------------------------
RPOB_ZYGCR       ------------------------------------------------------------
RPOB_NEPOL       ------------------------------------------------------------
RPOB_OSTTA       ------------------------------------------------------------
RPOB_MESVI       ------------------------------------------------------------
RPOB_CHLAT       ------------------------------------------------------------
RPOB_OLTVI       ------------------------------------------------------------
RPOB_BIGNA       ------------------------------------------------------------
RPOB_PHATC       SFEFQDEKQIYLIKYFNFLLTSLMKYEILQSSLTTKFNEDKTILLSKFTKSNAILNLSDK
RPOB_THAPS       SLPNKKHLIFLLINSFNLLSRTIVKYKILK----TRNNEN---------KNDFILNDYNQ
RPOB_TRIV2       ------------------------------------------------------------
RPOB_TRIEI       ------------------------------------------------------------
RPOB_SYNY3       ------------------------------------------------------------
RPOB_SYNE7       ------------------------------------------------------------
RPOB_THEEB       ------------------------------------------------------------
RPOB_SYNJA       ------------------------------------------------------------
RPOB_GLOVI       ------------------------------------------------------------
RPOB_PROM5       ------------------------------------------------------------
RPOB_GUITH       ------------------------------------------------------------
RPOB_RHDSA       ------------------------------------------------------------
RPOB_PYRYE       ------------------------------------------------------------
RPOB_GRATL       ------------------------------------------------------------
RPOB_CYAPA       ------------------------------------------------------------
RPOB_CYACA       ------------------------------------------------------------
RPOB_EMIHU       ------------------------------------------------------------
RPOB_EUGLO       ------------------------------------------------------------
                                                                             

RPOB_MYCGE       ------------------------------------------------------------
RPOB_MYCPN       ------------------------------------------------------------
RPOB_MYCGA       ------------------------------------------------------------
RPOB_MYCPE       ------------------------------------------------------------
RPOB_UREPA       ------------------------------------------------------------
RPOB_ALKEH       ------------------------------------------------------------
RPOB_HALHL       ------------------------------------------------------------
RPOB_METCA       ------------------------------------------------------------
RPOB_XANC8       ------------------------------------------------------------
RPOB_XYLFT       ------------------------------------------------------------
RPOB_LEGPA       ------------------------------------------------------------
RPOB_COXBU       ------------------------------------------------------------
RPOB_NITOC       ------------------------------------------------------------
RPOB_AROAE       ------------------------------------------------------------
RPOB_AZOSB       ------------------------------------------------------------
RPOB_METFK       ------------------------------------------------------------
RPOB_NITEC       ------------------------------------------------------------
RPOB_NITMU       ------------------------------------------------------------
RPOB_THIDA       ------------------------------------------------------------
RPOB_DECAR       ------------------------------------------------------------
RPOB_PARXL       ------------------------------------------------------------
RPOB_HERAR       ------------------------------------------------------------
RPOB_RALSO       ------------------------------------------------------------
RPOB_BORA1       ------------------------------------------------------------
RPOB_RHOFT       ------------------------------------------------------------
RPOB_POLSJ       ------------------------------------------------------------
RPOB_VEREI       ------------------------------------------------------------
RPOB_METPP       ------------------------------------------------------------
RPOB_NEIG1       ------------------------------------------------------------
RPOB_CHRVO       ------------------------------------------------------------
RPOB_ACIBT       ------------------------------------------------------------
RPOB_PSYCK       ------------------------------------------------------------
RPOB_HAHCH       ------------------------------------------------------------
RPOB_MARHV       ------------------------------------------------------------
RPOB_SACD2       ------------------------------------------------------------
RPOB_PSEU5       ------------------------------------------------------------
RPOB_CHRSD       ------------------------------------------------------------
RPOB_ALCBS       ------------------------------------------------------------
RPOB_SODGM       ------------------------------------------------------------
RPOB_ECOLI       ------------------------------------------------------------
RPOB_BAUCH       ------------------------------------------------------------
RPOB_BLOFL       ------------------------------------------------------------
RPOB_BLOPB       ------------------------------------------------------------
RPOB_BUCAI       ------------------------------------------------------------
RPOB_BUCAP       ------------------------------------------------------------
RPOB_BUCBP       ------------------------------------------------------------
RPOB_WIGBR       ------------------------------------------------------------
RPOB_BUCCC       ------------------------------------------------------------
RPOB_ACTP2       ------------------------------------------------------------
RPOB_MANSM       ------------------------------------------------------------
RPOB_HAEI8       ------------------------------------------------------------
RPOB_ALIF1       ------------------------------------------------------------
RPOB_PHOPR       ------------------------------------------------------------
RPOB_VIBCH       ------------------------------------------------------------
RPOB_AERS4       ------------------------------------------------------------
RPOB_COLP3       ------------------------------------------------------------
RPOB_PSEA6       ------------------------------------------------------------
RPOB_PSEHT       ------------------------------------------------------------
RPOB_SHEAM       ------------------------------------------------------------
RPOB_IDILO       ------------------------------------------------------------
RPOB_PSYIN       ------------------------------------------------------------
RPOB_DICNV       ------------------------------------------------------------
RPOB_HYDCU       ------------------------------------------------------------
RPOB_VESOH       ------------------------------------------------------------
RPOB_FRATO       ------------------------------------------------------------
RPOB_RHIL3       ------------------------------------------------------------
RPOB_RHIME       ------------------------------------------------------------
RPOB_AGRFC       ------------------------------------------------------------
RPOB_RHILO       ------------------------------------------------------------
RPOB_CHESB       ------------------------------------------------------------
RPOB_BRUSU       ------------------------------------------------------------
RPOB_BARBK       ------------------------------------------------------------
RPOB_RHOPB       ------------------------------------------------------------
RPOB_GLUOX       ------------------------------------------------------------
RPOB_GRABC       ------------------------------------------------------------
RPOB_MAGSA       ------------------------------------------------------------
RPOB_RHORT       ------------------------------------------------------------
RPOB_CAUVC       ------------------------------------------------------------
RPOB_MARMM       ------------------------------------------------------------
RPOB_HYPNA       ------------------------------------------------------------
RPOB_RHOS1       ------------------------------------------------------------
RPOB_PARDP       ------------------------------------------------------------
RPOB_ROSDO       ------------------------------------------------------------
RPOB_JANSC       ------------------------------------------------------------
RPOB_NOVAD       ------------------------------------------------------------
RPOB_ERYLH       ------------------------------------------------------------
RPOB_SPHAL       ------------------------------------------------------------
RPOB_ZYMMO       ------------------------------------------------------------
RPOB_PELUB       ------------------------------------------------------------
RPOB_RICBR       ------------------------------------------------------------
RPOB_ORITB       ------------------------------------------------------------
RPOB_ANAMM       ------------------------------------------------------------
RPOB_ANAPZ       ------------------------------------------------------------
RPOB_EHRRW       ------------------------------------------------------------
RPOB_NEOSM       ------------------------------------------------------------
RPOB_MAGMM       ------------------------------------------------------------
RPOB_ANADE       ------------------------------------------------------------
RPOB_MYXXD       ------------------------------------------------------------
RPOB_SYNFM       ------------------------------------------------------------
RPOB_SYNAS       ------------------------------------------------------------
RPOB_GEOSL       ------------------------------------------------------------
RPOB_PELPD       ------------------------------------------------------------
RPOB_PELCD       ------------------------------------------------------------
RPOB_BDEBA       ------------------------------------------------------------
RPOB_DESPS       ------------------------------------------------------------
RPOB_DESVV       ------------------------------------------------------------
RPOB_DESAG       ------------------------------------------------------------
RPOB_LAWIP       ------------------------------------------------------------
RPOB_KORVE       ------------------------------------------------------------
RPOB_SOLUE       ------------------------------------------------------------
RPOB_CAMJJ       ------------------------------------------------------------
RPOB_CAMFF       ------------------------------------------------------------
RPOB_SULDN       ------------------------------------------------------------
RPOB_BACV8       ------------------------------------------------------------
RPOB_PARD8       ------------------------------------------------------------
RPOB_PORGI       ------------------------------------------------------------
RPOB_FLAPJ       ------------------------------------------------------------
RPOB_GRAFK       ------------------------------------------------------------
RPOB_CYTH3       ------------------------------------------------------------
RPOB_SALRD       ------------------------------------------------------------
RPOB_PELLD       ------------------------------------------------------------
RPOB_CHLPD       ------------------------------------------------------------
RPOB_CHLCH       ------------------------------------------------------------
RPOB_CHLTE       ------------------------------------------------------------
RPOB_CHLMU       ------------------------------------------------------------
RPOB_CHLPN       ------------------------------------------------------------
RPOB_PARUW       ------------------------------------------------------------
RPOB_RHOBA       ------------------------------------------------------------
RPOB_TREDE       ------------------------------------------------------------
RPOB_TREPA       ------------------------------------------------------------
RPOB_BORAP       ------------------------------------------------------------
RPOB_LEPBL       ------------------------------------------------------------
RPOB_FUSNN       ------------------------------------------------------------
RPOB_CYAM1       ------------------------------------------------------------
RPOB_AQUAE       ------------------------------------------------------------
RPOB_DEIRA       ------------------------------------------------------------
RPOB_DEIGD       ------------------------------------------------------------
RPOB_THET8       ------------------------------------------------------------
RPOB_THEMA       ------------------------------------------------------------
RPOB_BACCR       ------------------------------------------------------------
RPOB_BACSU       ------------------------------------------------------------
RPOB_BACHD       ------------------------------------------------------------
RPOB_GEOTN       ------------------------------------------------------------
RPOB_OCEIH       ------------------------------------------------------------
RPOB_LISIN       ------------------------------------------------------------
RPOB_STAS1       ------------------------------------------------------------
RPOB_STRS2       ------------------------------------------------------------
RPOB_LACLA       ------------------------------------------------------------
RPOB_LACGA       ------------------------------------------------------------
RPOB_LACAC       ------------------------------------------------------------
RPOB_LACDB       ------------------------------------------------------------
RPOB_LACPL       ------------------------------------------------------------
RPOB_LACBA       ------------------------------------------------------------
RPOB_PEDPA       ------------------------------------------------------------
RPOB_LACS1       ------------------------------------------------------------
RPOB_LACSS       ------------------------------------------------------------
RPOB_LACP3       ------------------------------------------------------------
RPOB_ENTFA       ------------------------------------------------------------
RPOB_LEUMM       ------------------------------------------------------------
RPOB_OENOB       ------------------------------------------------------------
RPOB_CARHZ       ------------------------------------------------------------
RPOB_MOOTA       ------------------------------------------------------------
RPOB_SYMTH       ------------------------------------------------------------
RPOB_DESHY       ------------------------------------------------------------
RPOB_CLOAB       ------------------------------------------------------------
RPOB_CLONN       ------------------------------------------------------------
RPOB_CLOPS       ------------------------------------------------------------
RPOB_CLOTE       ------------------------------------------------------------
RPOB_HUNT2       ------------------------------------------------------------
RPOB_CLOD6       ------------------------------------------------------------
RPOB_CALS4       ------------------------------------------------------------
RPOB_SYNWW       ------------------------------------------------------------
RPOB_ONYPE       ------------------------------------------------------------
RPOB_COREF       ------------------------------------------------------------
RPOB_CORDI       ------------------------------------------------------------
RPOB_CORJK       ------------------------------------------------------------
RPOB2_NOCFA      ------------------------------------------------------------
RPOB_RHOJR       ------------------------------------------------------------
RPOB_MYCS2       ------------------------------------------------------------
RPOB1_NOCFA      ------------------------------------------------------------
RPOB_SACEN       ------------------------------------------------------------
RPOB_FRAAA       ------------------------------------------------------------
RPOB_STRCO       ------------------------------------------------------------
RPOB_THEFY       ------------------------------------------------------------
RPOB_ACIC1       ------------------------------------------------------------
RPOB_NOCSJ       ------------------------------------------------------------
RPOB_ARTS2       ------------------------------------------------------------
RPOB_LEIXX       ------------------------------------------------------------
RPOB_CUTAK       ------------------------------------------------------------
RPOB_BIFAA       ------------------------------------------------------------
RPOB_TROWT       ------------------------------------------------------------
RPOB_RUBXD       ------------------------------------------------------------
RPOB_DEHMC       ------------------------------------------------------------
RPOB_MYCMS       ------------------------------------------------------------
RPOB_MESFL       ------------------------------------------------------------
RPOB_MYCMO       ------------------------------------------------------------
RPOB_MYCPU       ------------------------------------------------------------
RPOB_MYCS5       ------------------------------------------------------------
RPOB_MYCH2       ------------------------------------------------------------
RPOB_CITSI       ------------------------------------------------------------
RPOB_POPTR       ------------------------------------------------------------
RPOB_AETGR       ------------------------------------------------------------
RPOB_OENEH       ------------------------------------------------------------
RPOB_NYMAL       ------------------------------------------------------------
RPOB_PIPCE       ------------------------------------------------------------
RPOB_PHAAO       ------------------------------------------------------------
RPOB_DIOEL       ------------------------------------------------------------
RPOB_PHAVU       ------------------------------------------------------------
RPOB_LOTJA       ------------------------------------------------------------
RPOB_JASNU       ------------------------------------------------------------
RPOB_LACSA       ------------------------------------------------------------
RPOB_SACHY       ------------------------------------------------------------
RPOB_PELHO       ------------------------------------------------------------
RPOB_ANTAG       ------------------------------------------------------------
RPOB_MARPO       ------------------------------------------------------------
RPOB_PHYPA       ------------------------------------------------------------
RPOB_PSINU       ------------------------------------------------------------
RPOB_ANGEV       ------------------------------------------------------------
RPOB_PINTH       ------------------------------------------------------------
RPOB_CYCTA       ------------------------------------------------------------
RPOB_ADICA       ------------------------------------------------------------
RPOB_HUPLU       ------------------------------------------------------------
RPOB_CHAGL       ------------------------------------------------------------
RPOB_CHAVU       ------------------------------------------------------------
RPOB_STAPU       ------------------------------------------------------------
RPOB_ZYGCR       ------------------------------------------------------------
RPOB_NEPOL       ------------------------------------------------------------
RPOB_OSTTA       ------------------------------------------------------------
RPOB_MESVI       ------------------------------------------------------------
RPOB_CHLAT       ------------------------------------------------------------
RPOB_OLTVI       ------------------------------------------------------------
RPOB_BIGNA       ------------------------------------------------------------
RPOB_PHATC       QIINLSMIYNKLIINSQTLAQMELNSNLFLITKEPREWLTEMSNFLFLKKQISKATFTLK
RPOB_THAPS       ----IKKVYDQVLQESETLLSLNINTQILSFILRDLEKFNQLNNFNFLKLNITP------
RPOB_TRIV2       ------------------------------------------------------------
RPOB_TRIEI       ------------------------------------------------------------
RPOB_SYNY3       ------------------------------------------------------------
RPOB_SYNE7       ------------------------------------------------------------
RPOB_THEEB       ------------------------------------------------------------
RPOB_SYNJA       ------------------------------------------------------------
RPOB_GLOVI       ------------------------------------------------------------
RPOB_PROM5       ------------------------------------------------------------
RPOB_GUITH       ------------------------------------------------------------
RPOB_RHDSA       ------------------------------------------------------------
RPOB_PYRYE       ------------------------------------------------------------
RPOB_GRATL       ------------------------------------------------------------
RPOB_CYAPA       ------------------------------------------------------------
RPOB_CYACA       ------------------------------------------------------------
RPOB_EMIHU       ------------------------------------------------------------
RPOB_EUGLO       ------------------------------------------------------------
                                                                             

RPOB_MYCGE       ------------------------------------------------------------
RPOB_MYCPN       ------------------------------------------------------------
RPOB_MYCGA       ------------------------------------------------------------
RPOB_MYCPE       ------------------------------------------------------------
RPOB_UREPA       ------------------------------------------------------------
RPOB_ALKEH       ------------------------------------------------------------
RPOB_HALHL       ------------------------------------------------------------
RPOB_METCA       ------------------------------------------------------------
RPOB_XANC8       ------------------------------------------------------------
RPOB_XYLFT       ------------------------------------------------------------
RPOB_LEGPA       ------------------------------------------------------------
RPOB_COXBU       ------------------------------------------------------------
RPOB_NITOC       ------------------------------------------------------------
RPOB_AROAE       ------------------------------------------------------------
RPOB_AZOSB       ------------------------------------------------------------
RPOB_METFK       ------------------------------------------------------------
RPOB_NITEC       ------------------------------------------------------------
RPOB_NITMU       ------------------------------------------------------------
RPOB_THIDA       ------------------------------------------------------------
RPOB_DECAR       ------------------------------------------------------------
RPOB_PARXL       ------------------------------------------------------------
RPOB_HERAR       ------------------------------------------------------------
RPOB_RALSO       ------------------------------------------------------------
RPOB_BORA1       ------------------------------------------------------------
RPOB_RHOFT       ------------------------------------------------------------
RPOB_POLSJ       ------------------------------------------------------------
RPOB_VEREI       ------------------------------------------------------------
RPOB_METPP       ------------------------------------------------------------
RPOB_NEIG1       ------------------------------------------------------------
RPOB_CHRVO       ------------------------------------------------------------
RPOB_ACIBT       ------------------------------------------------------------
RPOB_PSYCK       ------------------------------------------------------------
RPOB_HAHCH       ------------------------------------------------------------
RPOB_MARHV       ------------------------------------------------------------
RPOB_SACD2       ------------------------------------------------------------
RPOB_PSEU5       ------------------------------------------------------------
RPOB_CHRSD       ------------------------------------------------------------
RPOB_ALCBS       ------------------------------------------------------------
RPOB_SODGM       ------------------------------------------------------------
RPOB_ECOLI       ------------------------------------------------------------
RPOB_BAUCH       ------------------------------------------------------------
RPOB_BLOFL       ------------------------------------------------------------
RPOB_BLOPB       ------------------------------------------------------------
RPOB_BUCAI       ------------------------------------------------------------
RPOB_BUCAP       ------------------------------------------------------------
RPOB_BUCBP       ------------------------------------------------------------
RPOB_WIGBR       ------------------------------------------------------------
RPOB_BUCCC       ------------------------------------------------------------
RPOB_ACTP2       ------------------------------------------------------------
RPOB_MANSM       ------------------------------------------------------------
RPOB_HAEI8       ------------------------------------------------------------
RPOB_ALIF1       ------------------------------------------------------------
RPOB_PHOPR       ------------------------------------------------------------
RPOB_VIBCH       ------------------------------------------------------------
RPOB_AERS4       ------------------------------------------------------------
RPOB_COLP3       ------------------------------------------------------------
RPOB_PSEA6       ------------------------------------------------------------
RPOB_PSEHT       ------------------------------------------------------------
RPOB_SHEAM       ------------------------------------------------------------
RPOB_IDILO       ------------------------------------------------------------
RPOB_PSYIN       ------------------------------------------------------------
RPOB_DICNV       ------------------------------------------------------------
RPOB_HYDCU       ------------------------------------------------------------
RPOB_VESOH       ------------------------------------------------------------
RPOB_FRATO       ------------------------------------------------------------
RPOB_RHIL3       ------------------------------------------------------------
RPOB_RHIME       ------------------------------------------------------------
RPOB_AGRFC       ------------------------------------------------------------
RPOB_RHILO       ------------------------------------------------------------
RPOB_CHESB       ------------------------------------------------------------
RPOB_BRUSU       ------------------------------------------------------------
RPOB_BARBK       ------------------------------------------------------------
RPOB_RHOPB       ------------------------------------------------------------
RPOB_GLUOX       ------------------------------------------------------------
RPOB_GRABC       ------------------------------------------------------------
RPOB_MAGSA       ------------------------------------------------------------
RPOB_RHORT       ------------------------------------------------------------
RPOB_CAUVC       ------------------------------------------------------------
RPOB_MARMM       ------------------------------------------------------------
RPOB_HYPNA       ------------------------------------------------------------
RPOB_RHOS1       ------------------------------------------------------------
RPOB_PARDP       ------------------------------------------------------------
RPOB_ROSDO       ------------------------------------------------------------
RPOB_JANSC       ------------------------------------------------------------
RPOB_NOVAD       ------------------------------------------------------------
RPOB_ERYLH       ------------------------------------------------------------
RPOB_SPHAL       ------------------------------------------------------------
RPOB_ZYMMO       ------------------------------------------------------------
RPOB_PELUB       ------------------------------------------------------------
RPOB_RICBR       ------------------------------------------------------------
RPOB_ORITB       ------------------------------------------------------------
RPOB_ANAMM       ------------------------------------------------------------
RPOB_ANAPZ       ------------------------------------------------------------
RPOB_EHRRW       ------------------------------------------------------------
RPOB_NEOSM       ------------------------------------------------------------
RPOB_MAGMM       ------------------------------------------------------------
RPOB_ANADE       ------------------------------------------------------------
RPOB_MYXXD       ------------------------------------------------------------
RPOB_SYNFM       ------------------------------------------------------------
RPOB_SYNAS       ------------------------------------------------------------
RPOB_GEOSL       ------------------------------------------------------------
RPOB_PELPD       ------------------------------------------------------------
RPOB_PELCD       ------------------------------------------------------------
RPOB_BDEBA       ------------------------------------------------------------
RPOB_DESPS       ------------------------------------------------------------
RPOB_DESVV       ------------------------------------------------------------
RPOB_DESAG       ------------------------------------------------------------
RPOB_LAWIP       ------------------------------------------------------------
RPOB_KORVE       ------------------------------------------------------------
RPOB_SOLUE       ------------------------------------------------------------
RPOB_CAMJJ       ------------------------------------------------------------
RPOB_CAMFF       ------------------------------------------------------------
RPOB_SULDN       ------------------------------------------------------------
RPOB_BACV8       ------------------------------------------------------------
RPOB_PARD8       ------------------------------------------------------------
RPOB_PORGI       ------------------------------------------------------------
RPOB_FLAPJ       ------------------------------------------------------------
RPOB_GRAFK       ------------------------------------------------------------
RPOB_CYTH3       ------------------------------------------------------------
RPOB_SALRD       ------------------------------------------------------------
RPOB_PELLD       ------------------------------------------------------------
RPOB_CHLPD       ------------------------------------------------------------
RPOB_CHLCH       ------------------------------------------------------------
RPOB_CHLTE       ------------------------------------------------------------
RPOB_CHLMU       ------------------------------------------------------------
RPOB_CHLPN       ------------------------------------------------------------
RPOB_PARUW       ------------------------------------------------------------
RPOB_RHOBA       ------------------------------------------------------------
RPOB_TREDE       ------------------------------------------------------------
RPOB_TREPA       ------------------------------------------------------------
RPOB_BORAP       ------------------------------------------------------------
RPOB_LEPBL       ------------------------------------------------------------
RPOB_FUSNN       ------------------------------------------------------------
RPOB_CYAM1       ------------------------------------------------------------
RPOB_AQUAE       ------------------------------------------------------------
RPOB_DEIRA       ------------------------------------------------------------
RPOB_DEIGD       ------------------------------------------------------------
RPOB_THET8       ------------------------------------------------------------
RPOB_THEMA       ------------------------------------------------------------
RPOB_BACCR       ------------------------------------------------------------
RPOB_BACSU       ------------------------------------------------------------
RPOB_BACHD       ------------------------------------------------------------
RPOB_GEOTN       ------------------------------------------------------------
RPOB_OCEIH       ------------------------------------------------------------
RPOB_LISIN       ------------------------------------------------------------
RPOB_STAS1       ------------------------------------------------------------
RPOB_STRS2       ------------------------------------------------------------
RPOB_LACLA       ------------------------------------------------------------
RPOB_LACGA       ------------------------------------------------------------
RPOB_LACAC       ------------------------------------------------------------
RPOB_LACDB       ------------------------------------------------------------
RPOB_LACPL       ------------------------------------------------------------
RPOB_LACBA       ------------------------------------------------------------
RPOB_PEDPA       ------------------------------------------------------------
RPOB_LACS1       ------------------------------------------------------------
RPOB_LACSS       ------------------------------------------------------------
RPOB_LACP3       ------------------------------------------------------------
RPOB_ENTFA       ------------------------------------------------------------
RPOB_LEUMM       ------------------------------------------------------------
RPOB_OENOB       ------------------------------------------------------------
RPOB_CARHZ       ------------------------------------------------------------
RPOB_MOOTA       ------------------------------------------------------------
RPOB_SYMTH       ------------------------------------------------------------
RPOB_DESHY       ------------------------------------------------------------
RPOB_CLOAB       ------------------------------------------------------------
RPOB_CLONN       ------------------------------------------------------------
RPOB_CLOPS       ------------------------------------------------------------
RPOB_CLOTE       ------------------------------------------------------------
RPOB_HUNT2       ------------------------------------------------------------
RPOB_CLOD6       ------------------------------------------------------------
RPOB_CALS4       ------------------------------------------------------------
RPOB_SYNWW       ------------------------------------------------------------
RPOB_ONYPE       ------------------------------------------------------------
RPOB_COREF       ------------------------------------------------------------
RPOB_CORDI       ------------------------------------------------------------
RPOB_CORJK       ------------------------------------------------------------
RPOB2_NOCFA      ------------------------------------------------------------
RPOB_RHOJR       ------------------------------------------------------------
RPOB_MYCS2       ------------------------------------------------------------
RPOB1_NOCFA      ------------------------------------------------------------
RPOB_SACEN       ------------------------------------------------------------
RPOB_FRAAA       ------------------------------------------------------------
RPOB_STRCO       ------------------------------------------------------------
RPOB_THEFY       ------------------------------------------------------------
RPOB_ACIC1       ------------------------------------------------------------
RPOB_NOCSJ       ------------------------------------------------------------
RPOB_ARTS2       ------------------------------------------------------------
RPOB_LEIXX       ------------------------------------------------------------
RPOB_CUTAK       ------------------------------------------------------------
RPOB_BIFAA       ------------------------------------------------------------
RPOB_TROWT       ------------------------------------------------------------
RPOB_RUBXD       ------------------------------------------------------------
RPOB_DEHMC       ------------------------------------------------------------
RPOB_MYCMS       ------------------------------------------------------------
RPOB_MESFL       ------------------------------------------------------------
RPOB_MYCMO       ------------------------------------------------------------
RPOB_MYCPU       ------------------------------------------------------------
RPOB_MYCS5       ------------------------------------------------------------
RPOB_MYCH2       ------------------------------------------------------------
RPOB_CITSI       ------------------------------------------------------------
RPOB_POPTR       ------------------------------------------------------------
RPOB_AETGR       ------------------------------------------------------------
RPOB_OENEH       ------------------------------------------------------------
RPOB_NYMAL       ------------------------------------------------------------
RPOB_PIPCE       ------------------------------------------------------------
RPOB_PHAAO       ------------------------------------------------------------
RPOB_DIOEL       ------------------------------------------------------------
RPOB_PHAVU       ------------------------------------------------------------
RPOB_LOTJA       ------------------------------------------------------------
RPOB_JASNU       ------------------------------------------------------------
RPOB_LACSA       ------------------------------------------------------------
RPOB_SACHY       ------------------------------------------------------------
RPOB_PELHO       ------------------------------------------------------------
RPOB_ANTAG       ------------------------------------------------------------
RPOB_MARPO       ------------------------------------------------------------
RPOB_PHYPA       ------------------------------------------------------------
RPOB_PSINU       ------------------------------------------------------------
RPOB_ANGEV       ------------------------------------------------------------
RPOB_PINTH       ------------------------------------------------------------
RPOB_CYCTA       ------------------------------------------------------------
RPOB_ADICA       ------------------------------------------------------------
RPOB_HUPLU       ------------------------------------------------------------
RPOB_CHAGL       ------------------------------------------------------------
RPOB_CHAVU       ------------------------------------------------------------
RPOB_STAPU       ------------------------------------------------------------
RPOB_ZYGCR       ------------------------------------------------------------
RPOB_NEPOL       ------------------------------------------------------------
RPOB_OSTTA       ------------------------------------------------------------
RPOB_MESVI       ------------------------------------------------------------
RPOB_CHLAT       ------------------------------------------------------------
RPOB_OLTVI       ------------------------------------------------------------
RPOB_BIGNA       ------------------------------------------------------------
RPOB_PHATC       SFQELTQLQNLKPAIYFSISLKEQLKYVFGKNK-----------LTYKSDRHKYLKTKTQ
RPOB_THAPS       KIKVIIANDKIKSSLYFTNSFKELIKFKYNFTKKEKDKKRNQSQATIFKNKTKYLKTKSK
RPOB_TRIV2       ------------------------------------------------------------
RPOB_TRIEI       ------------------------------------------------------------
RPOB_SYNY3       ------------------------------------------------------------
RPOB_SYNE7       ------------------------------------------------------------
RPOB_THEEB       ------------------------------------------------------------
RPOB_SYNJA       ------------------------------------------------------------
RPOB_GLOVI       ------------------------------------------------------------
RPOB_PROM5       ------------------------------------------------------------
RPOB_GUITH       ------------------------------------------------------------
RPOB_RHDSA       ------------------------------------------------------------
RPOB_PYRYE       ------------------------------------------------------------
RPOB_GRATL       ------------------------------------------------------------
RPOB_CYAPA       ------------------------------------------------------------
RPOB_CYACA       ------------------------------------------------------------
RPOB_EMIHU       ------------------------------------------------------------
RPOB_EUGLO       ------------------------------------------------------------
                                                                             

RPOB_MYCGE       -------------DAFVQILLRDAVREGAKIFPITTLLKAFGLN----------------
RPOB_MYCPN       -------------DAFVQILLRDAVREGAKIFPITTLLKAFGMS----------------
RPOB_MYCGA       --------------DFVQAVVRDVGGESAKVFSITTLLKAFGLS----------------
RPOB_MYCPE       --------------DFIQVMFRDAIGESTHTIPITAFLKALGLN----------------
RPOB_UREPA       --------------HNIQIVARDSSGDNAQTFSVTTLLKAFGLT----------------
RPOB_ALKEH       -------------PK-DNIYVRIDRR---RKLPATILLRA--------------------
RPOB_HALHL       -------------PK-DTIYVRIDRR---RKLPATILLRA--------------------
RPOB_METCA       -------------HK-DCVYVRIDRR---RKLPATVLLRA--------------------
RPOB_XANC8       -------------PK-DALFTRIDRR---RKLPVSILLRA--------------------
RPOB_XYLFT       -------------PK-DALFTRIDRR---RKLPVSILLRA--------------------
RPOB_LEGPA       -------------PK-DCVYVRIDRR---RKLPVSILLRA--------------------
RPOB_COXBU       -------------PK-DCLFVRIDRR---RKLPATVILRA--------------------
RPOB_NITOC       -------------PK-DCVYARIDRR---RKLLATILLRA--------------------
RPOB_AROAE       -------------PK-DALYFRVDRR---RKMPATILLRA--------------------
RPOB_AZOSB       -------------PK-DYLYFRVDRR---RKMPVTILLRA--------------------
RPOB_METFK       -------------PK-DYLYFRVDRR---RKMPVTILLKA--------------------
RPOB_NITEC       -------------PK-DYVYFRIDRR---RKMPVTTLLKA--------------------
RPOB_NITMU       -------------PK-DYLYFRVDRR---RKMPITVLLKA--------------------
RPOB_THIDA       -------------AK-DILFFRVDRR---RKMPVTILLKA--------------------
RPOB_DECAR       -------------PK-DTLFFRVDRR---RKMPVTTLLKA--------------------
RPOB_PARXL       -------------PK-DVLYFRVDRR---RKMPVTILLKA--------------------
RPOB_HERAR       -------------PK-DILFFRVDRR---RKMPVTILLKA--------------------
RPOB_RALSO       -------------PK-DILYFRVDRR---RKMPVTILLKS--------------------
RPOB_BORA1       -------------PK-DVLFFRVDRR---RKMPVTILLKA--------------------
RPOB_RHOFT       -------------PK-DFLYFRVDRR---RKMPVTILLKA--------------------
RPOB_POLSJ       -------------PK-DVLYFRVDRR---RKMPVTILLKA--------------------
RPOB_VEREI       -------------PK-DILYFRVDRR---RKMPVTILLKA--------------------
RPOB_METPP       -------------PK-DILYFRVDRR---RKMPVTILLKA--------------------
RPOB_NEIG1       -------------PK-DLLYFRIDRR---RKMPVTILLKA--------------------
RPOB_CHRVO       -------------PK-DLLYFRIDRR---RKMPVTILLKA--------------------
RPOB_ACIBT       -------------AK-DLVYVRIDRR---RKLLATVVLRA--------------------
RPOB_PSYCK       -------------AK-DLVFARIDRR---RKLLASIILRA--------------------
RPOB_HAHCH       -------------PK-DCVFVRIDRR---RKLPATILLRA--------------------
RPOB_MARHV       -------------PK-DAVFVRIDRR---RKLPASILLRG--------------------
RPOB_SACD2       -------------PK-DLVFVRIDRR---RKLPASILLRA--------------------
RPOB_PSEU5       -------------PK-DAVFVRIDRR---RKLPASVLLRA--------------------
RPOB_CHRSD       -------------PK-DNVYVRIDRR---RKLPATVLLRA--------------------
RPOB_ALCBS       -------------PK-DQVFVRIDRR---RKLPATILLRA--------------------
RPOB_SODGM       -------------PK-DNLFVRIDRR---RKLPATIILRA--------------------
RPOB_ECOLI       -------------PK-DNLFVRIDRR---RKLPATIILRA--------------------
RPOB_BAUCH       -------------QK-DHLFVRIDRR---RKLPATIILRA--------------------
RPOB_BLOFL       -------------LK-DNLFVRIDRR---RKLPVTVLLRA--------------------
RPOB_BLOPB       -------------LK-DNLFVRIDRR---RKLPVTVILRA--------------------
RPOB_BUCAI       -------------PK-DNLFVRIDRR---RKLPVSIILRA--------------------
RPOB_BUCAP       -------------PK-DNLFVRIDRR---RKLPVTIILRA--------------------
RPOB_BUCBP       -------------PK-DNLFFRIDRR---RKLPISIILKA--------------------
RPOB_WIGBR       -------------AK-DHLFIRIDRR---RKLPVTVLLKA--------------------
RPOB_BUCCC       -------------PK-DHLFIRIDRR---RKIPATVLLHA--------------------
RPOB_ACTP2       -------------PK-DNLYARIDRR---RKLPATIILRA--------------------
RPOB_MANSM       -------------PK-DNLFARIDRR---RKLPATIILRA--------------------
RPOB_HAEI8       -------------PK-DNLFARIDRR---RKLPATIILRA--------------------
RPOB_ALIF1       -------------PK-DNLFVRIDRR---RKLPATIILRALN------------------
RPOB_PHOPR       -------------PK-DNVFVRIDRR---RKLAASVILRA--------------------
RPOB_VIBCH       -------------PK-DNLYVRIDRR---RKLPASIILRA--------------------
RPOB_AERS4       -------------AK-DNLFVRIDRR---RKLPASIILRA--------------------
RPOB_COLP3       -------------PK-DNLFVRIDRR---RKLPASIILRA--------------------
RPOB_PSEA6       -------------PK-DNLYVRIDRR---RKLPATIMLRA--------------------
RPOB_PSEHT       -------------AK-DNLYVRIDRR---RKLPASIILRA--------------------
RPOB_SHEAM       -------------PK-DALFVRIDRR---RKLPATIILRA--------------------
RPOB_IDILO       -------------PK-DNVFVRIDRR---RKLPASIILRA--------------------
RPOB_PSYIN       -------------PK-DNLFVRIDRR---RKLPATIMLRA--------------------
RPOB_DICNV       -------------VK-DLIYCRIDRR---RKLLITILLRA--------------------
RPOB_HYDCU       -------------HN-DCVFVRIDRR---RKLPVSIIFRA--------------------
RPOB_VESOH       -------------HH-EHLYVRIDRR---RKLPVTTLLRA--------------------
RPOB_FRATO       -------------SK-GIIWARIDRK---RKFCATVILKA--------------------
RPOB_RHIL3       -------------AK-DIVYARIDRR---RKIPVTSLLMA--------------------
RPOB_RHIME       -------------AK-DIVHARIDRR---RKIPVTSLLMA--------------------
RPOB_AGRFC       -------------AK-DIVYARIDRR---RKLPVTSLLMA--------------------
RPOB_RHILO       -------------SK-DVVHARIDRR---RKIPVTSLLMA--------------------
RPOB_CHESB       -------------AK-DIVYARIDRR---RKIPVTSLLMA--------------------
RPOB_BRUSU       -------------SK-DIVYARIDRR---RKLPATTLLMA--------------------
RPOB_BARBK       -------------AK-DIVYARIDRR---RKIPVTSFLMA--------------------
RPOB_RHOPB       -------------AK-DIVFARIDRR---RKIPVTSLMFA--------------------
RPOB_GLUOX       -------------AK-DLIYVRIDRK---RKLPVTTLLYALEGANYLAQREQKIAEGGD-
RPOB_GRABC       -------------SK-DLVYVRIDRR---RKLPVTTLLYALEGQ----RTEAAIASGTDP
RPOB_MAGSA       -------------AK-DLVYVRIDRR---RKLPVTTLLYALDGMNTAALRAQRAAEGRG-
RPOB_RHORT       -------------AK-DMVYVRIDRR---RKLPVTTLLYALEGAAATALREARTAEGRS-
RPOB_CAUVC       -------------AK-DIVYVRIDRR---RKLPATTFLYA--------------------
RPOB_MARMM       -------------AK-DVVHMRLDRR---RKLPATTLLYA--------------------
RPOB_HYPNA       -------------AK-DVLNIRIDRK---RKLPATTMLYA--------------------
RPOB_RHOS1       -------------AK-DIVFARIDRR---RKLPVTTLLYA--------------------
RPOB_PARDP       -------------AK-DLVFARIDRR---RKLPVTTLLYA--------------------
RPOB_ROSDO       -------------AK-DIVFARIDRR---RKLPVTTLLYS--------------------
RPOB_JANSC       -------------AK-DIVFSRIDRR---RKLPVTTLLYA--------------------
RPOB_NOVAD       -------------AK-DIVNVRIDRK---RKLPVTALLHA--------------------
RPOB_ERYLH       -------------AK-DIVNVRIDRK---RKLPVTALLYA--------------------
RPOB_SPHAL       -------------AK-DIVNVRIDRK---RKLPVTSLLYA--------------------
RPOB_ZYMMO       -------------AK-DIVNVRIDRK---RKLPVTTLLYA--------------------
RPOB_PELUB       -------------VK-DFLYFKIDRK---KKIFASTLLMA--------------------
RPOB_RICBR       -------------AK-DIIYFRIDRK---RKLYATTLLKA--------------------
RPOB_ORITB       -------------AK-DLLYFRIDRK---RKLYVTTLLMA--------------------
RPOB_ANAMM       -------------IK-DIIYFRIDKK---RKLPVSYLLKA--------------------
RPOB_ANAPZ       -------------IK-DIIYFRIDKK---RKLPVTYLLKA--------------------
RPOB_EHRRW       -------------IK-DILYFRIDRK---RKLPVSLLLRA--------------------
RPOB_NEOSM       -------------AK-DVLYFRIDKK---RKLPVTFLLRA--------------------
RPOB_MAGMM       -------------PK-DLLFARIDRR---RKLPVTTLLRA--------------------
RPOB_ANADE       -------------HK-DILYVRIDRR---RKLPATVLLRALGATPDT------------A
RPOB_MYXXD       -------------HK-DLLYVRIDRR---RKLPATVLIRALGAVPDT------------A
RPOB_SYNFM       -------------PK-DILYIRIDRR---RKFPVTVLLKALGY-----------------
RPOB_SYNAS       -------------SK-DLLYVRIDRR---RKMPVTILLKAMGY-----------------
RPOB_GEOSL       -------------HK-DILFVRIDRR---RKMPATVLLKALGY-----------------
RPOB_PELPD       -------------HK-DILYVRIDRR---RKMPATVLLKALGY-----------------
RPOB_PELCD       -------------HK-DLLYVRIDRR---RKLPATVLLKALGY-----------------
RPOB_BDEBA       -------------QK-DLIHVRIDRR---RKFPVTILLKALGY-----------------
RPOB_DESPS       -------------IK-DVLHVRIDRR---RKFPVTTLLKALGY-----------------
RPOB_DESVV       -------------HK-DILYVRIDRR---RKMPATILFKAMGM-----------------
RPOB_DESAG       -------------HK-DILYVRIDRR---RKMPATILFKAMGM-----------------
RPOB_LAWIP       -------------HK-DILYVRIDRR---RKMPATILLKAMGM-----------------
RPOB_KORVE       -------------QK-NILYVRIDRK---RKFLGTIFLRAL-------------------
RPOB_SOLUE       -------------NK-NILYVRIDRK---RKFYGSVFLRAL-------------------
RPOB_CAMJJ       -------------AK-DVLYVRINKR---RKVPVTMLFRA--------------------
RPOB_CAMFF       -------------TK-DVLYVRINKR---RKVPITILFRA--------------------
RPOB_SULDN       -------------PK-DILYMRINKR---RKVPVTIMFRA--------------------
RPOB_BACV8       -------------IN-NVMYAYIDRK---KKLPVTTLLRAVG------------------
RPOB_PARD8       -------------IN-NVMYAYIDRK---KKLPVTTLLRAIG------------------
RPOB_PORGI       -------------IN-NVMYAYIDRK---KKLPVTTLLRAIG------------------
RPOB_FLAPJ       -------------IN-SVMYAYIDRK---KKLPVTTLFRAIG------------------
RPOB_GRAFK       -------------IN-SVMYAYIDRK---KKLPVTTLFRAIG------------------
RPOB_CYTH3       -------------VN-NVMFAYIDRK---KKFPVTTLLRAIG------------------
RPOB_SALRD       -------------VR-DVLWAYVDRK---KKVPVTTLLRALG------------------
RPOB_PELLD       -------------IN-NQIFVYIDQK---KNFLVTALLRAIG------------------
RPOB_CHLPD       -------------IN-NQIFVYIDQK---KNFLVTALLRAIG------------------
RPOB_CHLCH       -------------IN-NQIFVYIDQK---KNFLVTALLRAIG------------------
RPOB_CHLTE       -------------IN-NQIFVYIDQK---KNFLVTALLRAIG------------------
RPOB_CHLMU       -------------IN-DLIYIHIDRKKRRRKILAMTFIRALG------------------
RPOB_CHLPN       -------------IN-DLIYIHIDRKKRRRKILAITFIRALG------------------
RPOB_PARUW       -------------TN-DLIHIYIDRKKRRRKILATTFIRALG------------------
RPOB_RHOBA       -------------KK-DALTVRIDQS---GKFAATMLLRAMDP-----------------
RPOB_TREDE       -------------QKKELIYAKLDSK---KRILGTIFLRALG------------------
RPOB_TREPA       -------------QKKDLIYAKLDKK---RRILGTVFLRALH------------------
RPOB_BORAP       -------------SKKDYLYVKIDRK---KRILITLFLRALG------------------
RPOB_LEPBL       -------------NK-GILIAKIDRK---KKFPATLLIKSLG------------------
RPOB_FUSNN       -------------KN-DFLSVKIDRK---KKVLATVFLKAVD------------------
RPOB_CYAM1       -------------KQ-KLLWVRLDKN---RKMPLVIFLQALG------------------
RPOB_AQUAE       -------------GATDLISARIDRK----KLSATAVLRAFG------------------
RPOB_DEIRA       --------------G-DVLEMKVNKR----KFPVSLLLRV--------------------
RPOB_DEIGD       --------------G-GVLEMKVNKR----KFPVSLLLRV--------------------
RPOB_THET8       -------------PN-GVVSMKVNKR----KFPLVLLLRV--------------------
RPOB_THEMA       -------------PYDGVLYAGLDGK----KVNLFLFLKTIGYE----------------
RPOB_BACCR       -------------AK-DVVYVRIDRT---RKLPVTVLLRAL-------------------
RPOB_BACSU       -------------AK-DVVYVRIDRT---RKLPVTVLLRAL-------------------
RPOB_BACHD       -------------AK-DIVYVRIDRT---RKIPVTVLLRAL-------------------
RPOB_GEOTN       -------------AK-DVVYVRIDRT---RKLPVTVLLRAL-------------------
RPOB_OCEIH       -------------AK-DIAYVRIDRT---RKLPITVLLRAL-------------------
RPOB_LISIN       -------------AK-DVVHVRIDRT---RKLPVTVLLRAL-------------------
RPOB_STAS1       -------------AK-DVVYVRIDRT---RKLPLTVLLRAL-------------------
RPOB_STRS2       -------------SK-DIAYTRIDRT---RKIPFTTLVRAL-------------------
RPOB_LACLA       -------------AK-GIGYVRIDRT---RKLTFTTMLRAL-------------------
RPOB_LACGA       -------------AK-DLAYVRIDRT---RKLPLTVLIRAL-------------------
RPOB_LACAC       -------------AK-NVSYVRVDRT---RKLPLTVLIRAM-------------------
RPOB_LACDB       -------------AK-NISYVRVDRT---RKLPLSVLVRAL-------------------
RPOB_LACPL       -------------AK-NVSYVRIDRT---RKIPLTELVRAL-------------------
RPOB_LACBA       -------------AK-NVSYVRIDRT---RKIPMTELVRAL-------------------
RPOB_PEDPA       -------------AK-EISYVRIDRT---RKIPMTELVRAL-------------------
RPOB_LACS1       -------------AK-NVAYVRIDRT---RKIPLTELIRAL-------------------
RPOB_LACSS       -------------AK-DIAYVRIDRT---RKIPMSVLVRAL-------------------
RPOB_LACP3       -------------AK-DIAYVRIDRT---RKIPLTELVRAL-------------------
RPOB_ENTFA       -------------AK-DISYVRIDRT---RKIPLTVLVRAL-------------------
RPOB_LEUMM       -------------AK-GIANVRIDRT---RKLLMTELVRAL-------------------
RPOB_OENOB       -------------AK-GVANIRIDRT---RKLPITELIRSF-------------------
RPOB_CARHZ       -------------VN-DHIYVRIDRT---RKLPVTVLLKAL-------------------
RPOB_MOOTA       -------------NT-ESIYVRIDRT---RKIPVTILLRAL-------------------
RPOB_SYMTH       -------------VN-DVIYVRVDRT---RKLPATVLLRAL-------------------
RPOB_DESHY       -------------VN-DNIFVRVDRT---RKLPATVLIRAL-------------------
RPOB_CLOAB       -------------SN-SVIHVRIDKT---RKLPITILVRAM-------------------
RPOB_CLONN       -------------SN-DIIYVRIDKT---RKLPISILIRAL-------------------
RPOB_CLOPS       -------------SN-DVIYVRIDKT---RKLPISILGRAM-------------------
RPOB_CLOTE       -------------SN-DIIYVRIDKT---RKLPISILIRAL-------------------
RPOB_HUNT2       -------------SN-DVLSVRIDRT---RKLPLTVLVRAL-------------------
RPOB_CLOD6       -------------SN-DVISVRVDRT---RKQPVTVLLRAL-------------------
RPOB_CALS4       -------------SN-DVIYVRIDRT---RKVPITVLLRAI-------------------
RPOB_SYNWW       -------------SA-GLVYTRIDKT---RKIPVTVLLRAL-------------------
RPOB_ONYPE       -------------SK-EILYAKLDRS---KKIPLSNFIYAL-------------------
RPOB_COREF       -------------KR-DSVGVRIDRK---RRQPVTVLLKAL-------------------
RPOB_CORDI       -------------KR-DTVGVRIDRK---RRQPVTVLLKAL-------------------
RPOB_CORJK       -------------KR-DTVGVRIDRK---RRQPVTVLLKAL-------------------
RPOB2_NOCFA      -------------KR-DTVGVRIDRK---RRQPVTVLLKAL-------------------
RPOB_RHOJR       -------------KR-DTVGVRIDRK---RRQPVTVLLKAL-------------------
RPOB_MYCS2       -------------KR-DTVGVRIDRK---RRQPVTVLLKAL-------------------
RPOB1_NOCFA      -------------KR-DTLGVRIDRK---RRQPVTVLLKAL-------------------
RPOB_SACEN       -------------KR-DTVGVRIDRK---RRQPVTVLLKAL-------------------
RPOB_FRAAA       -------------KR-DTVGVRIDRK---RRQSVTVLLKAL-------------------
RPOB_STRCO       -------------KR-DMVGVRIDRK---RKQSVTVLLKAL-------------------
RPOB_THEFY       -------------KR-DFVGVRIDRK---RKQAVTILLKAL-------------------
RPOB_ACIC1       -------------KR-DNVGVRIDRK---RKQSVTVLLKAL-------------------
RPOB_NOCSJ       -------------KR-DMVGVRLDRK---RKQNVTVLLKAL-------------------
RPOB_ARTS2       -------------KR-DQVGVRLDRK---RKQSVTVLLKAL-------------------
RPOB_LEIXX       -------------KR-DQVGVRIDRK---RKQSVTVFLKAL-------------------
RPOB_CUTAK       -------------KR-DTVGVRLDRK---RKQNVTVFLKAL-------------------
RPOB_BIFAA       -------------KR-DVLGVRVDRK---RKQSAIVFLMAI-------------------
RPOB_TROWT       -------------RH-DQLGVRVDRK---RRQPVIFFLRAI-------------------
RPOB_RUBXD       -------------TK-GYVSVRIDRK---RKLPVTVLLKAL-------------------
RPOB_DEHMC       -------------NR-DVISVKIDGR---RKIPVSTLLRAI-------------------
RPOB_MYCMS       ---------KIGNDAINPLYVKIDKS---RKTTATSLLLAF-------------------
RPOB_MESFL       ---------KTA-ETTNSLFVKIDKS---RKTTATSFLKIL-------------------
RPOB_MYCMO       ---------RVTGNTTDTVKVKIDKH---KAVSLVTFLRAM-------------------
RPOB_MYCPU       ---------KVTSNL-DSVKIKIDKH---KSFLLTTFLSSF-------------------
RPOB_MYCS5       ---------KVTSANLDAIKIKIDKN---KNINIVTFLASF-------------------
RPOB_MYCH2       ---------KVTGNQVDTVKFRIDKH---KNIPLLSFLRAI-------------------
RPOB_CITSI       --------------RKARIWARVSRK---QKVSILVLSAAMGSN----------------
RPOB_POPTR       --------------KKARIWARVSRK---QKISILVLSSAMGLN----------------
RPOB_AETGR       --------------KKARIWARVSRK---QKISILVLSSAMGSN----------------
RPOB_OENEH       --------------RKARIWARVSRK---QKISILVLSSAMGSN----------------
RPOB_NYMAL       --------------RKERIWARVSRK---QKISILVLSSAMGSS----------------
RPOB_PIPCE       --------------RKARIWARVSRK---QKISILVSSSAMGSN----------------
RPOB_PHAAO       --------------RKARIWARVSRK---QKISILVLSSAMGSN----------------
RPOB_DIOEL       --------------RKARIWARVSRK---QKISILVLLSAMGSN----------------
RPOB_PHAVU       --------------KKARIWARVSRK---QKISILILLSAMGSN----------------
RPOB_LOTJA       --------------RKARIWARVSRK---QKISILVLSSAMGSN----------------
RPOB_JASNU       --------------RKARIWARVSRK---QKISILVLSSAMGSN----------------
RPOB_LACSA       --------------RKTRIWVRVSRQ---QKLSILVLLSAMGLN----------------
RPOB_SACHY       --------------KKERIWARVSRK---QKISILVLLSAMGLN----------------
RPOB_PELHO       --------------KKERIWARVSRK---QKISILVLSSAMGSN----------------
RPOB_ANTAG       --------------GKTRIWARISKK---RKVSILVLLLAMGLD----------------
RPOB_MARPO       --------------GKTRIWARISKK---RKVSILVLLLAMGLN----------------
RPOB_PHYPA       --------------SKTRIWARISKK---RKVSILVLLLAMGLT----------------
RPOB_PSINU       --------------GRMRIWARISKE---RKFSIITLLLALGLT----------------
RPOB_ANGEV       --------------GKKRIWVRLSKN---RKVSIIILLLAMGLN----------------
RPOB_PINTH       --------------VGERIWARVSRK---QKISIPVLLSAMGLN----------------
RPOB_CYCTA       --------------GKTRIWARVSKK---RKISIPILLSAMGSN----------------
RPOB_ADICA       --------------GRNRIWVRISKK---KKISIFILLVAMGLC----------------
RPOB_HUPLU       --------------ANNRIWFRIDKK---HKVSILLLLLAMGLN----------------
RPOB_CHAGL       --------------DRKLIWARISKK---RKVSAIVLLLSMGIK----------------
RPOB_CHAVU       --------------NKRRIWVRLSKK---RKIPVLLLLLAMGLN----------------
RPOB_STAPU       --------------KKGRLSVRINNR---HKIPLVFLLIALGLD----------------
RPOB_ZYGCR       --------------RQGCLWVRVGRN---SKAPLLLLLIALGLE----------------
RPOB_NEPOL       --------------VDGMIWVRMDKA---KKISILIVLEAMGLS----------------
RPOB_OSTTA       --------------KKGVVFAHIDNL---RKVPVTVFLQALGFS----------------
RPOB_MESVI       --------------KNGLIWARIGKI---RKVSIMIVFKAMGLT----------------
RPOB_CHLAT       --------------KNGFVWARIGKV---RKVSGFILLRAMGLT----------------
RPOB_OLTVI       --------------KKADIWARMKKT---PKLPMLILLQALGLN----------------
RPOB_BIGNA       --------------KKNNIWMKVKKV---PKVPALMFLQALGVT----------------
RPOB_PHATC       FLLYRKDHEIKTNYNKKYDEKDLYTA---TVIPEYGSWIRIGFQ----------------
RPOB_THAPS       IIQYKDDHLIRDIYKKKYEEKELYTA---TLIPEYGSWIRFGFQ----------------
RPOB_TRIV2       --------------RNDLVWVRIDKT---RKLSAQVLLKALGLS----------------
RPOB_TRIEI       --------------KNDLVWVRIDKT---RKLSAQVLLKALGLG----------------
RPOB_SYNY3       --------------KNGLVYVRIDKT---RKLSAQVLLKAIGLS----------------
RPOB_SYNE7       --------------KNGLVWVRIDKT---RKLSAQVLLKALGLS----------------
RPOB_THEEB       --------------KNDLLWVRIDKT---RKLSAHVLLKALGLT----------------
RPOB_SYNJA       --------------KNGLVWVRIDKT---RKLSAAVLLKALGLS----------------
RPOB_GLOVI       --------------ANDLVWVRIDKT---RKLSAVVLLKALGLS----------------
RPOB_PROM5       --------------KNNLLYVRVDKT---RKINAHVLMRAMGLS----------------
RPOB_GUITH       --------------RNDLVWVRIDKT---RKIPAHVFLKAMGLS----------------
RPOB_RHDSA       --------------RNDLVWVRIDKT---RKIPAHVFLKAMGLS----------------
RPOB_PYRYE       --------------PKGEIWIRIDKT---HKVNAYIFLRAIGLN----------------
RPOB_GRATL       --------------SKAQIWAKIDKN---HKVSAYIFLRSIGLN----------------
RPOB_CYAPA       --------------KDDLIWMRIDKT---HRLPCHIFLKALNLS----------------
RPOB_CYACA       --------------KNDLIWIRIDKN---KKINLSIFFKALGID----------------
RPOB_EMIHU       --------------KDDLVYIKIDKA---KKFSIFVFLKALGLD----------------
RPOB_EUGLO       --------------KKKENFIKIDKIN--NSIPLFTFLNILGLS----------------
                                                                             

RPOB_MYCGE       ----------NREILKIFKNNEFIKRSLEAEIYNAKDFLSNVDP----------------
RPOB_MYCPN       ----------GKEILKVFKNNEFITRSLEAEVYNAKDFLNNVDP----------------
RPOB_MYCGA       ----------EIKIKEIFNNNDYILRSLESEFYNEKQILNEAD-----------------
RPOB_MYCPE       ----------KEEILNIFANHKSIKNSLDNEIYNEKDVFETDE-----------------
RPOB_UREPA       ----------SAEILKIFNNEKEIRESLEIEKYAPEYIFENSQEN---------------
RPOB_ALKEH       ------LGFDTQQILDLFFDKNAFHFRDDGS-----VVLDLVPE-----RLRGETAAFDI
RPOB_HALHL       ------LGYTPEEILYAFFDTDRFHLGSGNK-----VVLDLVPE-----RLRGETASFDI
RPOB_METCA       ------LGYDNEQIIAEFFDTNRFLLSSAG------IQLELIPE-----RLRGDIASFDI
RPOB_XANC8       ------LGYNNEEMLAEFFEINTFHINPDEG-----VQLELVPE-----RLRGETLNFDL
RPOB_XYLFT       ------LGYSNEEILGEFFEINTFHINPDEG-----VQLELVPE-----RLRGEILSFNL
RPOB_LEGPA       ------LGYEAEDILSEFFETTRCHL-KNGE-----YHIDLIPQ-----RLRGEIASFDI
RPOB_COXBU       ------LGYDTEQILDMFYKTNHFHL-NQET-----VTLDLIPQ-----RLRGELAVVEI
RPOB_NITOC       ------LGYSTEEILIMFFETISVKR-QGSS-----YLLDLVPQ-----RLRGESLPFDI
RPOB_AROAE       ------IGMGPEEILATFHDFDAFHLRGNE------AAFELVPD-----RLRGDVAKFDI
RPOB_AZOSB       ------IGMTPEEILETFHDFDAFHLSAEG------AQFELVPD-----RLRGEVARFDI
RPOB_METFK       ------LGFTPEQILETFYDFDTFHIAKKG------VQFELVPE-----RLRGEVAKFDI
RPOB_NITEC       ------MGYSSTQILADFFEFDHFTLAGNK------ILFHLIPE-----RLRGELASFDI
RPOB_NITMU       ------IGYTPEQILENFFSFDSFHISRKS------ILFELLPE-----RLRGDTARFDI
RPOB_THIDA       ------LGYTPESILDAFFNKDTFYINTLG------IQFELVPE-----RLRGEIARFDI
RPOB_DECAR       ------IGMSSEEILDQFFDFDTFLLSKDK------VEFTLVPE-----RLRGEVARFDF
RPOB_PARXL       ------IGLTPEQILANFFVFDNFTLMPEG------AQMEFVPE-----RLRGEVARFDI
RPOB_HERAR       ------IGMTPEQILENFFVFDDFTLHADG------AEMKFVAE-----RLRGEVARFDI
RPOB_RALSO       ------IGLTPEQILAHFFVFDNFTLKSDG------ALMEFVPE-----RLRGEVARFDI
RPOB_BORA1       ------IGMTPESILAHFFDFDNFELKSEG------AMMEFVPE-----RWKGEMARFDI
RPOB_RHOFT       ------IGLNHESILANFFVNDNFRLMDSG------AQMEFVAE-----RLRGEVARFDI
RPOB_POLSJ       ------IGLNPESILANFFVFDHFRLMDSG------AQMEFVAE-----RMRGEVARFDI
RPOB_VEREI       ------IGLNPESILANFFVNDNFRLMDSG------AQMEFVPE-----RLRGEVARFDI
RPOB_METPP       ------IGLNPEQILANFFVFDNFRLMDSG------AQMEFVAD-----RLRGEIARFDL
RPOB_NEIG1       ------LGYNNEQILDIFYDKETFYLSSNG------VQTDLVAG-----RLKGETAKVDI
RPOB_CHRVO       ------LGYTNEEILSEFYSFDTFYLTKSG------VFMRVVPE-----RLKGEVAKFDI
RPOB_ACIBT       ------LGYNNEQILNLFYEKVPVYLD-MGS-----YQIDLVPE-----RLRGEMAQFDI
RPOB_PSYCK       ------LGLSTSEILDLFFDKVRVYKG-EEQ-----FEIDLVAD-----RLRGEMAQFDI
RPOB_HAHCH       ------LGYAADEMLEMFFENSLFEVE-GGE-----YFLDLVPS-----RLRGDIAIFEI
RPOB_MARHV       ------LGYTSEQMLEMFFETSKFSLG-AEV-----CKLELVPS-----RLRGDIATFDI
RPOB_SACD2       ------LGYTTEQMLDMFYETSKFGLTETGE-----CVLELVPS-----RLRGDVTTFEI
RPOB_PSEU5       ------LNYSTEEILDAFYDTNVFHVK-GET-----LALELVPQ-----RLRGEIATFDI
RPOB_CHRSD       ------LGMSAEEILETFFDTSTFHIE-KSG-----FSVELVPS-----RLRGETATFDI
RPOB_ALCBS       ------LGYTSDEVLEMFFDTNEIAVE-DGI-----YRMKLVPE-----RLRGETATFDI
RPOB_SODGM       ------LNYSTGQILDTFFDKVVYEIH-DKK-----LQMELLPE-----RLRGETASFDI
RPOB_ECOLI       ------LNYTTEQILDLFFEKVIFEIR-DNK-----LQMELVPE-----RLRGETASFDI
RPOB_BAUCH       ------LQLSTNQILDTFFEKVIFHLN-DEH-----IQMELVPE-----RLRGETASFDI
RPOB_BLOFL       ------LDYTNDQILNTFFNTVVYEFK-DDL-----LFMNLVPE-----RLRGETVSFDI
RPOB_BLOPB       ------LNYTTDQILNIFFNKVIYEIQ-NNT-----LYMHLIPE-----RLRGETASFDI
RPOB_BUCAI       ------LNYNTEEILNIFFEKNIFKIE-NNK-----IVLELVPE-----RLRGETASFNI
RPOB_BUCAP       ------LNYNTEEILNLFFEKNIFNIN-NNK-----IQLELVSE-----RLRGETASFDI
RPOB_BUCBP       ------LNYNTEQILDTFFKKNIFKFT-ENS-----ILMKLVPH-----RLRGETASFDI
RPOB_WIGBR       ------LNFSDGEILNIFFEKVNFFIR-KKN-----LLMELIPK-----RLRGETALFDI
RPOB_BUCCC       ------LNFSTEKILKIFFKHDIFYIK-NKN-----IYMYLIPK-----RLKGEIIPFEI
RPOB_ACTP2       ------LGYTTEEILSMFFDKVNFEIQ-DNK-----LLMTLVPE-----RLRGETAAFDI
RPOB_MANSM       ------LGYSTEEILDLFFEKIQFEIQ-DNK-----LLMALVPE-----RLRGETASFDI
RPOB_HAEI8       ------LGYTTEEILNLFFDKITFEIA-GDK-----LLMTLVPE-----RLRGETASFDI
RPOB_ALIF1       --------KTTEEILDLFFDKVVFEVKDQT------LMMELIPER-----LRGETATFDI
RPOB_PHOPR       ------LDYTTEQILDMFFDKVSFEVQ-GKS-----LVMELVPE-----RLRGETASFDI
RPOB_VIBCH       ------LGKTSAEILDIFFEKVNFEVK-DQT-----LMMELVPE-----RLRGETATFDI
RPOB_AERS4       ------LDFSSEEILANFFETIGFEVK-DGK-----LMMDLVPE-----RLRGETATFDI
RPOB_COLP3       ------LEYSTEEILAMFYDTTDYTIK-GDK-----LIMDLIPE-----RLRGETAIFDI
RPOB_PSEA6       ------LEIPTEEILGMFFEKNQVRID-GNR-----FMSDIVPD-----RLRGETAQFDI
RPOB_PSEHT       ------LEYSSEDILGIFFDNTTFEVT-DGK-----VLMELVPS-----RLRGETAAFDI
RPOB_SHEAM       ------LDFSTQDILDIFFERVDFTIK-KDS-----LVMKLLPE-----RLRGETASYDI
RPOB_IDILO       ------LEYSTEEILDMFFDTTYFEIL-KTK-----VKMQLVPE-----RLRGETAKFDI
RPOB_PSYIN       ------LEYSTQEILAIFYDTTKFDIK-DGV-----ISMSLIAD-----RLRGEMALFDI
RPOB_DICNV       ------LGLSNQEMLDIFFSKQTFKLNKTGK-----IELVFEPE-----QFAGELAQFDI
RPOB_HYDCU       ------MGYSSEEILDTFFDHTHISYK-KGA-----FVMQLVPS-----QLKGQTAAFDI
RPOB_VESOH       ------MGLSSEDILETFFEKTPVKLK-AKS-----CDLSMLPI-----HLQRTIAEFDI
RPOB_FRATO       ------LGYTQEQILENFSESKTITFNSKGF-----ALRLDNLS-----NMKGELLKFDI
RPOB_RHIL3       ------LGMDGEEILDTFYTKSLYKRDGE------GWRIPFKPE-----TLKGAKAITEM
RPOB_RHIME       ------LGMDGEEILDTFYTKSLYQRDGE------GWRVPFQPD-----ALKGQKTLADM
RPOB_AGRFC       ------LGMDGEEILSTFYTKATYERSGD------GWRIPFQPE-----ALKNAKVITDM
RPOB_RHILO       ------LGMDGEEILSTFYNKITYVRAGD------HWRIPFNVE-----RFRGLKAVGDL
RPOB_CHESB       ------LGMDGEEILSTFYNKLTFIRDGD------NWRVPFSAE-----RFRGMKATADI
RPOB_BRUSU       ------LGMDGEEILSTFYKTVTYTRDGD------NWRIPYSAE-----RFKGMKIISDL
RPOB_BARBK       ------LGMDASDILSTFYNKVTYERVES------GWRIPYSVD-----RFKGVKLVSDL
RPOB_RHOPB       ------LGLDGEEILSTFYKKIQYKKIKE------GWRVPFDSN-----RFRGYSTINDL
RPOB_GLUOX       VEGLDIRGMDQDEILSYFYEAVPFTRLGG------EWARPFDPD-----AFRGLKLLSPL
RPOB_GRABC       QDLPEIHGMTAEEILSYFYTQVVFTSTPK------GWARPFDPE-----AFRGITLAEAL
RPOB_MAGSA       LEQSEIKGMTSEEILSYFYGKVVYTRGPK------GWKTPFDAE-----RLKGVKLVSDL
RPOB_RHORT       VDPSEIAGMTSEEILDFFYQKLSYKRDDK------GWKVDFKPD-----HLRGVKLMFDL
RPOB_CAUVC       ------LGMDGEEILTTFYDVVPFEKRSG------GWATPYKPE-----RWRGVKPEFPL
RPOB_MARMM       ------LGLDKEEILSTFYDTVTYKASKK------GWTVPYVKE-----RWRGVKPARDL
RPOB_HYPNA       ------LGYDTEQILDQFYTRSIYRLDKK------GWITSFRAD-----AWKGVKPEFEL
RPOB_RHOS1       ------LGMDQEGIMDAYYETVNFKHQKN-----RGWVTRFFPE-----RVRGTRPTYDL
RPOB_PARDP       ------LGMDQEGIMDAFYNTVDYKLQRAGKGQAAGWVTKFFPE-----RVRGTRPSFDL
RPOB_ROSDO       ------LGLDQEAIMDAYYDTITYKLEKN-----KGWVAPFFPD-----RVRGTRPTYDL
RPOB_JANSC       ------LGLDQEGIMDAYYDTVTFKMVKN-----KGWSTKFFPE-----RVRGTRPTTDL
RPOB_NOVAD       ------LGLGDEDILHHFYDTVTWARAEG------GWKVPFVLE-----QWRGSKPAFDI
RPOB_ERYLH       ------LGLDSEEILHFFYNTVTWKRAGGKKG--EGWKIPFEPE-----AWRGQKPTFAL
RPOB_SPHAL       ------LGMTGEEILNHFYDRLVFERAEN------GWKVPFMVE-----NWRGSKPAFDV
RPOB_ZYMMO       ------LGLNAEQILHHFYNTITFVRGDG------GWKVPYVAE-----SWRGRKPFFDI
RPOB_PELUB       ------LGLTKSEIADEFYDKDTYSFDAKT----GKWKTKFNPE-----NYKAKNFSEEV
RPOB_RICBR       ------IGMSTEEIIKFYYDSVNYKVVKN----KG-WAVKFMPS-----HITAHRLTSDL
RPOB_ORITB       ------LGMSSHDILNFYYESATYKKYKKSE--NG-WIVDFLPE-----LVSTKHLAYDL
RPOB_ANAMM       ------LGMSNNDILDAFYDKVIYTRCDKG------WRVPFIVD-----RFKGVRLSYDL
RPOB_ANAPZ       ------LGMSNNDILDTFYDKVLYVRSDKG------WKVPFVVD-----RFKGVRLSYDL
RPOB_EHRRW       ------LGLSNSEILDTFYDKIRYERCENG------WVVPFVVD-----RFRGVRLSYDL
RPOB_NEOSM       ------LGLSNKDIFAQFCEVSECRLTKDG-----KWTVCFVPE-----KFKGVRLQYDL
RPOB_MAGMM       ------MGMSSEQILERFYEIETFRKEGVV------WQKRMVPE-----RLMGNRLNYAI
RPOB_ANADE       KKDPVEFHGSAEEILKYYYDTETIRVEGKGK-----FEKDLVPD-----LLKGQRATRDI
RPOB_MYXXD       KKNPLEFKGSTEEILNYYYATETIYLHSAEE-----FEKSVELE-----LLPGQRATRDI
RPOB_SYNFM       ---------ATEELLNYFYPSEKIFLKSEAQ-----SEKELNPD-----ILMGSRAPEDI
RPOB_SYNAS       ---------STEDLLNYFYDVEHIFCEGEN-------FYAAVDE-----SLVGHKLYDDI
RPOB_GEOSL       ---------SAEALLNYFYKSEEILVAAEG------MWKKADPE-----LLASQKASVDI
RPOB_PELPD       ---------SAEQLLNYYYKSEEIFLTGET------PSKSIDAE-----LLTLQKALVDV
RPOB_PELCD       ---------SAEELLNYYYQVETVTVDGDS------FKKKVNLD-----LLAGQRASTDV
RPOB_BDEBA       ---------NSEQLLEYFYDLDEVYVKGGK------LFRKLDIE-----RMSGQRALTDI
RPOB_DESPS       ---------SSEELLREFYPLENVKLSDGK------YWVRFVAE-----HTAGQRLEFDL
RPOB_DESVV       ---------SKTDILDYFYKKEFYRLDPMGR-----LMWEVQKD-----MYRKDSAFVDI
RPOB_DESAG       ---------SRSDILEYFYKKEYYTLEDDGR-----LMWELDKD-----LYRKDVAYADV
RPOB_LAWIP       ---------GKQDILNFFYKKETYILDNDGR-----IKWKFDPS-----LFRKDIAYTDI
RPOB_KORVE       ------GLRTDEDILRTFYTVDRIAVKDKK------LYWTLEPGIERPTNLVGLKLSHAI
RPOB_SOLUE       ------GLKTDEQILRAFYRVSKMEIRDKK------IYWNVDEG------LTGLKLSHAI
RPOB_CAMJJ       ------LGYKKQDIIKLFYPIQTIHVKKDK------FLTEFNPN------DFMDRIEYDI
RPOB_CAMFF       ------LGYKKQDIVKLFYPIQTLNIKNNK------FLTMFNPD------DFSGRVDYDI
RPOB_SULDN       ------LGYSKQDILKLFYPIQHINIVDNK------FLMSFNPN------DYSSRLTYDL
RPOB_BACV8       -------FENDKDILEIFNLAEDVKVN-KTN----------------LKKVVGRKLAARV
RPOB_PARD8       -------FESDRDILEIFNLAEEVKVT-KAN----------------LKKFIGRKLAARV
RPOB_PORGI       -------FEADKDILDIFNLAEEVKVT-KAN----------------LKKCIGRKLAARV
RPOB_FLAPJ       -------FQSDKDILEIFDLAEEIKVS-KSG----------------LKKYIGRKLAARV
RPOB_GRAFK       -------FERDKDILEIFDLAEEVKVS-KTG----------------LKKYLGRKLAARV
RPOB_CYTH3       -------YGSDKDILDLFGLSEEVEAT-KAN----------------IKKAIGRKLAARV
RPOB_SALRD       -------FSSDEEIVKMFDLADAVDIG-DEDE---------------FEEHLGRELATSV
RPOB_PELLD       -------FTRDEDILGLFDLVEEVPM--KAAK---------------RERLVGQYLAS--
RPOB_CHLPD       -------FAKDEDILGLFDLVEEVKI--TSAK---------------KEQLIGQYLAS--
RPOB_CHLCH       -------FARDEDILALFDLVEEVSL--KASK---------------REQLVGQYLAS--
RPOB_CHLTE       -------FAKDEDILGLFDLVEEVEVSSKSSK---------------REQLLGQYLAS--
RPOB_CHLMU       -------YSTDADIIEEFFAVEEHSLR-SEKD---------------FVALVGKVLADNV
RPOB_CHLPN       -------YSSDADIIEEFFTIGESSLR-SEKD---------------FALLVGRILADNI
RPOB_PARUW       -------YSSNSDIIEEFFTTRKYKIK-NEKE---------------FAKLVGKILAQDV
RPOB_RHOBA       ------KYSTDADLLSAFYETGTIKVN-GGKD---------------ATKIENKIAVDDV
RPOB_TREDE       -------YDTREKIIDLFYKTKT---------------AKISPDRTEYEELIGQVLARDV
RPOB_TREPA       -------YETREQIIEAFYAIEK---------------TPVCQDRAEYELLTGKILARSV
RPOB_BORAP       -------FDTREKIIETFYNIKK---------------IKV--EEGTKRDLPGQYLAKSI
RPOB_LEPBL       -------HGTNEEVLRLFYSSKK---------------EKI--AGATSKDLKKILGRRTI
RPOB_FUSNN       -------FFKDNNEIRDYFLEVKELKLKALY-------KKYSKEPEELLNVLKQELDGSI
RPOB_CYAM1       -------LNLQE------------------------------------------------
RPOB_AQUAE       -------LETAYDILKYFYEDVRKFIVKDKYLYDAQTGEEFTPE------DLEHHYIFAI
RPOB_DEIRA       ------LGMDDASIRALFTEFTPEVEP------------------------GEDKS-AGM
RPOB_DEIGD       ------LGYDDAQLKALFTEFDPAAEL------------------------PEDKS-AGM
RPOB_THET8       ------LGYDQETLARELGAYGELVQG------------------------LMDESVFAM
RPOB_THEMA       ---------KDEDILSLYPTYLDADDEDSLL------------------LHVGSILLEDI
RPOB_BACCR       ------GFGSDQEITELLG-DNEY------------------------------------
RPOB_BACSU       ------GFGSDQEILDLIG-ENEY------------------------------------
RPOB_BACHD       ------GFGSDQEIIDLLG-EDEY------------------------------------
RPOB_GEOTN       ------GFSSDQEIIDLLG-DNEY------------------------------------
RPOB_OCEIH       ------GFGTDQEITDLLG-ENEY------------------------------------
RPOB_LISIN       ------GFGSDQEIIDLIG-DNDY------------------------------------
RPOB_STAS1       ------GFSTDQEIVDLLG-DNEY------------------------------------
RPOB_STRS2       ------GFSGDDEIFDIFG-DSEL------------------------------------
RPOB_LACLA       ------GFGSDEEILELLG-ETQL------------------------------------
RPOB_LACGA       ------GFGSDSEVADMFG-ESDS------------------------------------
RPOB_LACAC       ------GIGSDSEIIEMFG-QSDT------------------------------------
RPOB_LACDB       ------GFGSDSEIKEIFG-DSDT------------------------------------
RPOB_LACPL       ------GYGSDDDIIDMLG-ETDS------------------------------------
RPOB_LACBA       ------GFGSDDEILDILG-DNES------------------------------------
RPOB_PEDPA       ------GFGSDEEIIDIFG-GSDS------------------------------------
RPOB_LACS1       ------GYGSDNEIVEILGSNSDS------------------------------------
RPOB_LACSS       ------GYGSDQEIIDILG-DNDS------------------------------------
RPOB_LACP3       ------GFGSDQDIINMFG-DNDS------------------------------------
RPOB_ENTFA       ------GFGSDDTIFEIFG-DSES------------------------------------
RPOB_LEUMM       ------GFGSDSDIIDIFSDQYDA------------------------------------
RPOB_OENOB       ------GFGSDSEIQDIFGDEIDS------------------------------------
RPOB_CARHZ       ------GYESKGRIAELFD-HDDK------------------------------------
RPOB_MOOTA       ------GYNTNARILELFD-YDGR------------------------------------
RPOB_SYMTH       ------GFGSDQEILDAVG-DSEY------------------------------------
RPOB_DESHY       ------GYATNGQIAELFD-DNEH------------------------------------
RPOB_CLOAB       ------GFGSDAEIVNYFG-EEER------------------------------------
RPOB_CLONN       ------GLGSDAEIVDWFG-EEER------------------------------------
RPOB_CLOPS       ------GFGSDQELLEYFG-EEER------------------------------------
RPOB_CLOTE       ------EYGSDLEIIDYFG-EDER------------------------------------
RPOB_HUNT2       ------GYGTDLEITELFG-EDER------------------------------------
RPOB_CLOD6       ------GIGTDAEIIDLLG-EDER------------------------------------
RPOB_CALS4       ------GYNTDIQILDLLG-EEEK------------------------------------
RPOB_SYNWW       ------GYESNEVILDMYD-GDET------------------------------------
RPOB_ONYPE       ------GFDSKEAIENVFG-KSAI------------------------------------
RPOB_COREF       ------GWT-TEQITERFGFSEI-------------------------------------
RPOB_CORDI       ------GWT-TEQITERFGFSEI-------------------------------------
RPOB_CORJK       ------GLT-TQEITDRFGFSEL-------------------------------------
RPOB2_NOCFA      ------GWT-TEEIAERFGFSEI-------------------------------------
RPOB_RHOJR       ------GWT-TEQITERFGFSEI-------------------------------------
RPOB_MYCS2       ------GWT-NEQIVERFGFSEI-------------------------------------
RPOB1_NOCFA      ------GWS-AERIAERFGFAPL-------------------------------------
RPOB_SACEN       ------GWT-AEAIRERFGFSET-------------------------------------
RPOB_FRAAA       ------GWD-EARILERFGDFPS-------------------------------------
RPOB_STRCO       ------GWT-TEQILEEFGEYES-------------------------------------
RPOB_THEFY       ------GWT-TDQILERFGEYES-------------------------------------
RPOB_ACIC1       ------GWD-DARILERFGEFEA-------------------------------------
RPOB_NOCSJ       ------GWT-NEQIREEFGEYES-------------------------------------
RPOB_ARTS2       ------GWT-EGQILEEFGQYDS-------------------------------------
RPOB_LEIXX       ------GLT-SEEILAEFAGFQS-------------------------------------
RPOB_CUTAK       ------GWT-ADRILEEFGTHES-------------------------------------
RPOB_BIFAA       ------GMT-KDEIADAFKDYPL-------------------------------------
RPOB_TROWT       ------GMT-DDEIRDAFGEFES-------------------------------------
RPOB_RUBXD       ------GFGGPEEILARFGNSWL-------------------------------------
RPOB_DEHMC       ------GYSDDLDILNLFEVIDNDPER---------------------------------
RPOB_MYCMS       -------GISKDDILNIFDNDEVLVET---------------------------------
RPOB_MESFL       -------GLDRDTILNIYDKDKVIVET---------------------------------
RPOB_MYCMO       -------GMKKETIQNLFGSHSTLEGE---------------------------------
RPOB_MYCPU       -------GFTEESMYKLFGNSETLKNT---------------------------------
RPOB_MYCS5       -------GLLADDIRYLFGKNEVLEET---------------------------------
RPOB_MYCH2       -------GFTNETVRKYFGNSPELLES---------------------------------
RPOB_CITSI       --------LRE--ILENICYPEIFLSFLT-------------------------------
RPOB_POPTR       --------LRE--ILENVCYPEIFLSFLS-------------------------------
RPOB_AETGR       --------LRE--ILENVCYPEIFLSFLT-------------------------------
RPOB_OENEH       --------LRE--ILENVCYPEMFLSFLN-------------------------------
RPOB_NYMAL       --------LRE--ILDNVCYPEIFLSFPN-------------------------------
RPOB_PIPCE       --------LRE--ILENVRYPEIFLSFLN-------------------------------
RPOB_PHAAO       --------IRE--ILDNVCYPEIFLSFPN-------------------------------
RPOB_DIOEL       --------LRE--ILDNVCYPEIFLSFPN-------------------------------
RPOB_PHAVU       --------LSE--ILENVCYPEIFVSFLN-------------------------------
RPOB_LOTJA       --------LNE--ILENVCYPEIFLSFLN-------------------------------
RPOB_JASNU       --------LKE--ILDNVFYPEIFLSFLK-------------------------------
RPOB_LACSA       --------IRE--ILENVCYPELFLSFLN-------------------------------
RPOB_SACHY       --------LRE--ILDNVSYPEIFLSFLN-------------------------------
RPOB_PELHO       --------LKE--ILENACYPEIFLAL-N-------------------------------
RPOB_ANTAG       --------IEE--ILGNVCYPKLLLGCMK-------------------------------
RPOB_MARPO       --------LQN--ILDSVCYPKIFLEFIK-------------------------------
RPOB_PHYPA       --------IKQ--ILDSVCSSKIFLDFLKE------------------------------
RPOB_PSINU       --------RKD--ILNGVCYPNILLDLWK-------------------------------
RPOB_ANGEV       --------MND--ILKNVRYPNIFLRLFQ-------------------------------
RPOB_PINTH       --------LEE--ILDNTRYPERFLFLLKKK-----------------------------
RPOB_CYCTA       --------LGE--ILDNVCYPKIFLSLLTE------------------------------
RPOB_ADICA       --------KRD--ILQNSRYPRIFSNMFK-------------------------------
RPOB_HUPLU       --------EEK--ILDTVHYPEVMSDIIR-------------------------------
RPOB_CHAGL       --------LSD--ITRSIEHPAILDNILK-------------------------------
RPOB_CHAVU       --------WKD--LEKLISRPSLLLSYLS-------------------------------
RPOB_STAPU       --------IND--IPDWLQSRTKKLEDLL-------------------------------
RPOB_ZYGCR       --------MRY--IPPMIVQRTKKLNQLL-------------------------------
RPOB_NEPOL       --------KKT--IFRSLKSPEFLFKALQQL-----------------------------
RPOB_OSTTA       --------MDT--IVGALKYPEALDPTLKEV-----------------------------
RPOB_MESVI       --------KNE--IFDALKYPQFLKK----------------------------------
RPOB_CHLAT       --------KSK--ILNSLRHPEFFQK----------------------------------
RPOB_OLTVI       --------LPT--ILKSLNYPKFFENLGHDGN----------------------------
RPOB_BIGNA       --------KSN--LIKLLKYPIPNQN----------------------------------
RPOB_PHATC       --------RNT--KINSYKYPLKSQE----------------------------------
RPOB_THAPS       --------KNT--KINISKYPIKNQE----------------------------------
RPOB_TRIV2       --------DNE--IFDALRHPEYFQKTIE-------------------------------
RPOB_TRIEI       --------DSE--IFDSLRHPDYFQKTIE-------------------------------
RPOB_SYNY3       --------DNE--ILDSLSHPEFYQKTLD-------------------------------
RPOB_SYNE7       --------DNE--IYDKLRHPEYYQKTID-------------------------------
RPOB_THEEB       --------DSE--ILERLRHPEYYQKTVE-------------------------------
RPOB_SYNJA       --------DSE--IYDSLRHPEFFQKTME-------------------------------
RPOB_GLOVI       --------DNE--ILDAFRHPEYFQKTIE-------------------------------
RPOB_PROM5       --------DND--VVDKLRHPEFYKQSIDA------------------------------
RPOB_GUITH       --------DTD--IYNGLRHPEYLKKTFR-------------------------------
RPOB_RHDSA       --------DSD--IYNGLRHPEYLKKSFR-------------------------------
RPOB_PYRYE       --------KDE--IEKGLSKYAFLISASQIY-----------------------------
RPOB_GRATL       --------NED--IRKRLTKYNYLINSSLTY-----------------------------
RPOB_CYAPA       --------ESE--ILSALTHPEFLQKTIY-------------------------------
RPOB_CYACA       --------HDDLRIKNAFRQPEFIYKNLN-------------------------------
RPOB_EMIHU       --------NQE--IFNSIENINYFRKTSN-------------------------------
RPOB_EUGLO       -------KKKITLSLNKNNYSKNFKISKKKK-----------------------------
                                                                             

RPOB_MYCGE       --------------------EIKNLLKEFRDGKTDLRRKGIASDQ------KLRSLVNEY
RPOB_MYCPN       --------------------EIKNLLREFRDGKTDLRRKGIASDQ------KIRSLVSDY
RPOB_MYCGA       ---------------------IAQLIRDIES-DRISKVKSLPIDQ------KWKNLVLDW
RPOB_MYCPE       ---------------------LINLRKNLNSSDSNR---SYGVDT------KLRELFKKY
RPOB_UREPA       ------------EIIFKIYSDAHDIHEKADRRESNNKLKEEYIEQGSPLLSKLKQLIFNY
RPOB_ALKEH       K--A-----NGQVLVEAGRRVTARHIRELGKA-GVDTLEVPAEYLEGK--IVAHDV-VDT
RPOB_HALHL       V--A-----GGETIVEAGRRVTARHVKQLQKS-GVEQLEVPEDYLTGK--IIAHDV-IDP
RPOB_METCA       R--L-----GDQIVVEKDHRITARHIRMLQKE-NVNLLDVPKDYLYGK--ILAHNV-VDT
RPOB_XANC8       A--D-----GDKVIVEAGKRITARHVKQLEAA-GVAALAVPDDYLVGR--ILSHDV-VDG
RPOB_XYLFT       T--D-----GGSVIVEAGKRITARHVKQLEAS-GISALAVPDEYLIGR--ILSHDV-IDA
RPOB_LEGPA       HVPE-----TGELIVEQGRRITARHIKQMEKS-QMQDLVVPRDYLIGK--TLAKNI-IDT
RPOB_COXBU       K-DK-----KGKVIVEANRRISARHIRLIEKA-EINKLELPDDYLYGK--VIGKTI-IDK
RPOB_NITOC       A-SP-----DGEVIVEAGRRVTARHIKQMEKA-GMKTLPAPKEFLIGK--TLARDL-IDA
RPOB_AROAE       T-DG-----AGNVIVARDKRITAKHIRELDQA-GVKMISVPDEFLLGR--IIARNI-VDA
RPOB_AZOSB       V-DP-----TGKVIVARDKRITAKHIRELDQA-GIKMIGVPDDFVLGR--IIARNV-VDP
RPOB_METFK       L-DK-----DGKVIVAKDKRITVKHIRDMEKS-GISKITVPEEFLLGR--SLAAGI-VDK
RPOB_NITEC       V-SE-----DGKVFVQKDKRITAKHVRDLQQA-NLTKISVPEEFLLGK--ILAEDI-VDK
RPOB_NITMU       L-SK-----SGKVIVQKDKRITVKHVREMQQA-GIDRLEVPEDFLLGR--VLGHNV-VDK
RPOB_THIDA       C-GK-----DDKVIVAKDKRITAKHIRELDAA-GVKKWAVPGEFVVGR--VLAHDV-VDK
RPOB_DECAR       V-GP-----DGVLIVPKDKRITAKHIRDIGAA-AIKQIVVPEDFLIGR--VVAKNI-VDK
RPOB_PARXL       T-DR-----DGNVIVQKDKRINAKHIRDLDNA-KTKFISVPEDYLLGR--VLAKNV-VDG
RPOB_HERAR       T-DK-----AGKVLVAKDKRINSKHVRDVEAA-GIKQISVPEDYLLGR--ILAKNI-VDA
RPOB_RALSO       S-DK-----NGKVVVEKDKRINAKHIRDLDAA-GTKLISVPEDYLLGR--VLAKNI-VDP
RPOB_BORA1       T-DR-----AGKVIVEKDKRINAKHLRDLANG-GIQRISVPEDFLYGR--VLAKNV-VDP
RPOB_RHOFT       T-DK-----SGKVIVAKEKRVTARHTRELEQS-GTTHISVPEDFLLGR--VVARNI-VDT
RPOB_POLSJ       T-DK-----SGKVVVAKDKRITVRHTRELEQS-GTTTISVPEDFLVGR--VVAKNI-VDA
RPOB_VEREI       T-DK-----SGKLIVAKDKRVTARHTRDLEQS-GSTHISVPEDFLVGR--VVARTI-VDA
RPOB_METPP       T-DK-----AGAVIVEKDKRITARHTRALEAS-GTSFISVPEDFLVGR--VLAKNM-VDA
RPOB_NEIG1       L-DK-----EGNVLVAKGKRITAKNIRDITNA-GLTRLDVEQESLLGK--ALAADL-IDS
RPOB_CHRVO       V-AA-----DGKLIVAKDKRITAKHIRDIQTA-ELDRIEVPADALLGK--MLAHNV-VNQ
RPOB_ACIBT       T-DN-----EGKVIVEQGKRINARHVRQMEAA-GLTKLSVPDEYLYER--ITAEDI-TLR
RPOB_PSYCK       V-TP-----AGDVVVEQGKRINARRIRQLEEA-GMTKISIPDEYLYER--ILAEDI-IVN
RPOB_HAHCH       K-DD-----EGNLIVEEGRRVTARHIRQMEKA-GLKRLRVPSSYLLGK--VTATNI-ADP
RPOB_MARHV       K-DN-----DGNVIVEEGRRITARHIKQLEKA-GITELEVPTEYLYGR--VLAKDM-IDQ
RPOB_SACD2       K-DK-----DGNLIVEDGRRITARHIRQLEKA-GVTELSVPHEYMVGR--ALAKDI-INA
RPOB_PSEU5       K-DD-----SGKVIVEQGRRITARHINQLDKS-GIKELEMPMDYVLGR--TVAKAI-VHP
RPOB_CHRSD       K-DG-----EGNLIVEEGRRITQKHIRQMEKA-GLERLDVPMEYLFGK--TLAKDQ-VDP
RPOB_ALCBS       L--A-----DGEVVVERGRRITARHIRQLEKA-NIEYLDIPAEYLQGK--YLAKSI-IDQ
RPOB_SODGM       --EA-----NGTVYVEKGRRITARHIRQLEKD-GVAQIEVPVEYIIGK--AVVKDY-IDE
RPOB_ECOLI       --EA-----NGKVYVEKGRRITARHIRQLEKD-DVKLIEVPVEYIAGK--VVAKDY-IDE
RPOB_BAUCH       --IA-----NGTIYVNKGRRITARHIHQLKID-SIDRINVPREYLVGK--IIAIDY-IHD
RPOB_BLOFL       --KA-----NDIIYVERGRRITSKHINKLKAD-NIIKVEVPLNYLMGK--VIIKDY-LDI
RPOB_BLOPB       --AV-----NGVIYVKKGRRIAAKHIRQLKKD-KISKIEVPMDYIIGK--VVIKDY-FDK
RPOB_BUCAI       --KK-----NGIIYVEKGRRITAKHIQELKNN-KIKSITVPVEYILGR--IVSKNY-VDK
RPOB_BUCAP       --KK-----NGKIYVKKGRRITAKHIQELKKD-KINSITVPVEYILGR--IVSKNY-LDP
RPOB_BUCBP       --CI-----DNKTYIKKGQRITARHINILKEK-KIHTIKVPTEYLIGK--ISAKNY-FNK
RPOB_WIGBR       --CE-----NGITYIKKGRRITAKHIRNLEND-KISQITVPFEYIIGK--VSAKNY-FDK
RPOB_BUCCC       --IK-----NKKRYIKKGERITTEHIKKLKKK-KIKTIQIPEEYLYGK--TISKNY-YHP
RPOB_ACTP2       --EA-----NGKVYVERGRRITARHIRTLEKD-GITQIEVPVEYIVGK--VAAKDY-VDL
RPOB_MANSM       --EA-----NGKVYVERGRRITARHIRTLEKD-NVTKIDVPTEYIVGK--VSAKDY-IDL
RPOB_HAEI8       --EA-----NGKVYVERGRRITARHIKALEKD-NISQVVVPSEYILGK--VASKDY-VDL
RPOB_ALIF1       EANG-------KVYVEAGRRITARHIRQLTKD-DITHIEVPVDYIVGK---VASHDYVNE
RPOB_PHOPR       --EA-----NGKVYVEQGRRITARHIRQLGKD-GVDQIEVPVEYIVGK--ISSRDY-VNE
RPOB_VIBCH       --EA-----DGKVYVEKGRRVTARHIRQLEKD-GVNFIEVPVEYIVGK--VSAKDY-VNE
RPOB_AERS4       --VA-----NGAVVVETGRRVTARHIRQLEKD-AVTQIEVPVEYVVGK--VAAKNY-THP
RPOB_COLP3       S-IK-----KGEVLVESGRRITARHIRALSKA-KLEKLEVPADYIVGR--VLSKAY-IDK
RPOB_PSEA6       L-DS-----DGNVLVEAGRRISARHTRALEKA-GIVELEVPAEYLVGR--VFACDY-VDQ
RPOB_PSEHT       K-SE-----DGEVFVESGRRVTARHIKNIEKK-GIKQLEVPHEYIIGR--VLAKNY-VDE
RPOB_SHEAM       K-DA-----EGNIVVEKGRRITARHIRQLEKT-NTTELEVPVEYIVGK--IAAQDY-IDP
RPOB_IDILO       K-GA-----EGEVLVEKGRRITARHIRQLEQL-DIKEMEVPAEYMVGK--VLAKDY-ANK
RPOB_PSYIN       --AA-----NGKIYVEQGKRITARHIKQLEKD-NINTLDVPVEYIAEKDLVVAKDY-ISK
RPOB_DICNV       I--A-----DGEVIVPMGRKISSRFVRQLIEK-KVKKQTVPVDFVVGK--FLATDL-VDK
RPOB_HYDCU       A--D-----GDKVIIKAGKKITARNIKQLQEA-KVDSVVVPEEYLLGK--VLSSGI-TNE
RPOB_VESOH       V--V-----NQHVVVEKGRRITAKHVKLLGKA-GIKSINAPLEYLLDK--VICADI-INK
RPOB_FRATO       V-DA-----QDNVIVKKNKKLTSRDVKKIKDA-GVDSVAIDFDLVSTL--RVAKDI-VNE
RPOB_RHIL3       VDAD-----TGEVVVEAGKKLTPRLLRTLSDK-GLKALKAADDDLYGN--YLAGDI-VNY
RPOB_RHIME       IDAD-----TGEVVVESGKKLTPRLLRQLQEK-GLKALKATDDDLYGN--YLAEDV-VNF
RPOB_AGRFC       IDAD-----TGEVVVEGGKKLTPRLIRQLVDK-GLKALKATDEDLYGN--YLAEDI-VNY
RPOB_RHILO       VDAD-----TGEIVVEAGKKITARQARQLGEK-GLKAIKATDEDLLGN--YLAEDI-VNY
RPOB_CHESB       IDAD-----TGEVVLEAGKKMTARMARQLADK-GLKAIRATEDDLLGN--YLAEDI-VNM
RPOB_BRUSU       VDAD-----TGEAVLEAGKKLTARAAKQLAEK-GLKAIKATEDDLFGS--YLAEDV-VNY
RPOB_BARBK       VDAE-----SGEVVAEAGKKLTARTAKLLVEK-GLKAIRVSEDELLGS--YLADDI-VNY
RPOB_RHOPB       IDAD-----TGKVVLEAGKKLTVRAARQLQEK-GLKALRLSDEELVGN--YLAEDL-VNP
RPOB_GLUOX       VDAD-----TGEVVAEADAKLTARMVRKIAEK-TRV-VQVGRLDILGR--FLAYDL-VNE
RPOB_GRABC       IDAD-----TGTVVAEAGTKLTARSARKIAEQ-AKT-VLVGRADLLGR--YMAEDL-VND
RPOB_MAGSA       IDAK-----SGEKVADAGSKMTPRLGKKLREA-GLTDIVVFPEDMIGQ--YVAEDI-INE
RPOB_RHORT       VDAA-----TGEVKIEAGTKVTPRAARKLAED-GMTEMRVFTEELVGR--YAAEDM-INE
RPOB_CAUVC       VDAD-----TGEEVAPAGTKITARQAKKFADG-GLKTLLLAPEALTGR--YLARDA-VNM
RPOB_MARMM       VDAK-----TGDIIAPAGKKISARAANKFADD-GLAALLVSDEHLLGG--YLADDM-VNL
RPOB_HYPNA       IDAK-----TGKSVAEAGKKITALKAKRMAEA-GTDEILVTSEALIGK--FLARDV-VNL
RPOB_RHOS1       VDAA-----TGEVILKAGEKATPRMVKKWIDEAQITELLVPFDHIVGR--YVAQDI-INE
RPOB_PARDP       VNAE-----TGEIITKAGDKVTPRLVKQLAEKGDIN-LLLPFEKIVGR--FVAKDI-INE
RPOB_ROSDO       VDAA-----SGEVLFERGKKVTPRAVKKLIDEGKVTELLLPYEHIAGK--FVAKDI-INE
RPOB_JANSC       VDAK-----TGEVIAEAGKKVTPRAVKKWIDEGSIENLLVPFDGIVGR--FAAKDI-INE
RPOB_NOVAD       VDAK-----SGEVIFPAGQKISPRAANKAAKD-GLEALLIPTEEIFGR--YAARDL-IDE
RPOB_ERYLH       VDAK-----TGEEVFPANQKISPRAANKAQKD-GLKDLLLPTEEVFAR--YAAKDM-IDE
RPOB_SPHAL       VDAK-----TGEVVFAAGHKISPRLANKAAKD-GLDTLLIPTEEIFGR--YSAYDL-INE
RPOB_ZYMMO       INGD-----TGEVVFPAGQKISPRAANKAGRD-GLETLLIPTEEIYGH--YAAYDV-IDE
RPOB_PELUB       TDAK-----TGNVVIKLGDKINFLTAKKLASD-GLKDILVSQESLIGK--YLHNEVKVSD
RPOB_RICBR       IDAD-----TGNVLLKAGQKITPRLAKKYAGE-GLNNILVSHKALIGK--YLSEDL-KDP
RPOB_ORITB       IDAQ-----TGKVLLNAGQKITFRIAKMLADK-GVKQILVKNDSLVGK--LLAEDL-VNN
RPOB_ANAMM       MDVD-----GSVLVKAN-TRITLRIAKKLYAD-GLREYMVPFSGITGM--FVAADL-VDP
RPOB_ANAPZ       MDVD-----GNVLIKAN-TRITLRIAKKLYAD-GLREYLVPFAGISGL--FVATDL-VDP
RPOB_EHRRW       VDID-----GNVLVKAN-TRITLRLAKKLASD-GLKKYLVPFAEIQGL--FIANDL-VDP
RPOB_NEOSM       INAE-----TGELVLAKGNRISIVLARNLYAK-GLRYCYMDLEVMKDM--YLADDL-VS-
RPOB_MAGMM       VHPE-----SGEEIVKAKKRVTARHIKKFEEL-GMDWLPVSQEELIGS--FVARNM--SD
RPOB_ANADE       RDPK-----SSEVIVKKNRKYTESAIKKLVAA-KMKSLPVEPEEVYTK--ISAEDV-VDE
RPOB_MYXXD       K-AK-----TGELIVKKNRKFTRAAIKKLEAA-KMKTLPIDADELFTK--VSAYDV-VEE
RPOB_SYNFM       LHPQ-----TGEVLIKKNRKLGKQALRRLQEV-GINRLPMKSTELIGQ--VLAQDV-IDY
RPOB_SYNAS       RDIN-----TGEILFKKGRRINKVILKRIREQ-RVERIKMDVEELPGR--ILATDI-LDP
RPOB_GEOSL       VAPK-----TGEVLLKANRKFTKAAIRKMTEH-GITQIPITMEEVLGK--YASNDI-VDP
RPOB_PELPD       VDPK-----SGEVIVKANRKFTKASIRKMVEH-DIKAVPITFDSIIGR--YASSDV-IDP
RPOB_PELCD       LG-N-----DGEIIVKANRKFTKAAIRKLADS-NVEYIPVSEEEIVGK--VASTDI-VDV
RPOB_BDEBA       VDPK-----TGEALVKAGRRITRAIVKKIKDL-DITELDVLPEDLEGK--VLAKPL-IDE
RPOB_DESPS       VNPQ-----DGEILAKKGRKISKALCRKAVEA-GIEFIEASSETILGK--VLASAI-TLA
RPOB_DESVV       ED-G-----KGGTIVKAGKPITKRAWRLISEA-GLETIEVAPDTIEGM--FLAEDI-VNP
RPOB_DESAG       AD-G-----EGKVIAKAGKPYTKRSWRLMLEA-GIPAVEVAPDYIAGM--FLAEDI-VDE
RPOB_LAWIP       LD-N-----DNNLLVAAGKTITKRVWRQMEAS-GLEAFEVDPSTVIGQ--FLAEDI-IDT
RPOB_KORVE       K-AK-----NGEEVAHSGRKVTASVLKEIQKH-KISELEIELGDLEGA--YVASDV-IDT
RPOB_SOLUE       T-TK-----SGDTVVGQGKKITASLFKELQKA-KIEKVEVAPNDLEGA--HVVADV-VDM
RPOB_CAMJJ       K-DE-----KGKIVHQAGKRLTKKKAEQLIKD-GLKWIEYPVEILLNR--YLANPI-IDK
RPOB_CAMFF       K-DE-----DGNILHQAGKRLTKKKADKLIED-GLKFVEYPIEVLVNR--YLASPV-IDK
RPOB_SULDN       V-DK-----NGKILLASGKRLSAKKAQNFIDE-GLSEVEYPLEVLLDR--YLAKPI-VDP
RPOB_BACV8       LKTW-----TEDFVDEDTGEVVSIE-RNEVIIDRETVIEEDHIDEIID------------
RPOB_PARD8       LKTW-----VEDFVDEDTGEVVSIE-RNDVIIDRESVLDSDNIEAILD------------
RPOB_PORGI       INTY-----IDDLSDEDTGEVVSME-RITVVVDREVELTEDNIEAILN------------
RPOB_FLAPJ       LNTW-----HEDFVDEDTGEVVSIE-RNEIILDRDTILDKDNVEEIVE------------
RPOB_GRAFK       LNTW-----YEDFVDEDTGEVVSIE-RNEIVLDRDTELEKDHIEEILE------------
RPOB_CYTH3       LRTW-----TEDFVDEDTGEVVSID-RNEVLLERDSIIKEEDINIIVE------------
RPOB_SALRD       TIEK-----TIEIVDEDTGEVVDEEMEREVLLPAEHELEEGDWEELDE------------
RPOB_PELLD       -----------DIVDMQTGEVVSAR----------TAITEEVFEQIQA------------
RPOB_CHLPD       -----------DIVDMQTGEVVSAR----------TAITEDIVDQIIA------------
RPOB_CHLCH       -----------DIVDMQTGEVISAR----------TAITEEIFEQILL------------
RPOB_CHLTE       -----------DIIDMTTGEVVPAR----------AAITEEIIDQIVA------------
RPOB_CHLMU       VD-------------ADSSLVYGKA---------GEKLSTAMLKRILD------------
RPOB_CHLPN       ID-------------EASSLVYGKA---------GEKLSTAMLKRMLD------------
RPOB_PARUW       VD-------------EESGLVFGKA---------SEKLTTAMLKRIVD------------
RPOB_RHOBA       VYP---------SGHERAGEIIVEA---------GYKITTELSETICN------------
RPOB_TREDE       YVKG--EDGEKRKMHQAGEKIHPHNIDDLIQN-DVKKITIIDFKGKDS------------
RPOB_TREPA       TVEN--EQGETRVLYKAGEKIHPHVIDDLLQN-GICEVYIINLEAEGS------------
RPOB_BORAP       NIR-------ENMYYRAGDKITLQDVEDFLQN-GVNEIELVDFDGYNDV------SGKYF
RPOB_LEPBL       NDII--NMETGEVMLEAGSKVNEDNISILKEM-KVKEVELIEFPKGKD------------
RPOB_FUSNN       VKEDILDEETGEFIAEAEAFINEEVINKLIEN-KVDKISYWYVGPESK------------
RPOB_CYAM1       ------------------------IKPHLTNR-EVFERSWENHAVNNT------------
RPOB_AQUAE       IKFR-----GKLVGFASSKERDFIEERYIEEWEDLVRLLDDDRIEVLSVTAVPRDVVIKS
RPOB_DEIRA       GADE--------------------------------------------------------
RPOB_DEIGD       NPDE--------------------------------------------------------
RPOB_THET8       RPEE--------------------------------------------------------
RPOB_THEMA       YDGG-------RKIAEKWDILTKDLAERILMIDDINQIKIVHPIAQNT----------FE
RPOB_BACCR       ------------------------------------------------------------
RPOB_BACSU       ------------------------------------------------------------
RPOB_BACHD       ------------------------------------------------------------
RPOB_GEOTN       ------------------------------------------------------------
RPOB_OCEIH       ------------------------------------------------------------
RPOB_LISIN       ------------------------------------------------------------
RPOB_STAS1       ------------------------------------------------------------
RPOB_STRS2       ------------------------------------------------------------
RPOB_LACLA       ------------------------------------------------------------
RPOB_LACGA       ------------------------------------------------------------
RPOB_LACAC       ------------------------------------------------------------
RPOB_LACDB       ------------------------------------------------------------
RPOB_LACPL       ------------------------------------------------------------
RPOB_LACBA       ------------------------------------------------------------
RPOB_PEDPA       ------------------------------------------------------------
RPOB_LACS1       ------------------------------------------------------------
RPOB_LACSS       ------------------------------------------------------------
RPOB_LACP3       ------------------------------------------------------------
RPOB_ENTFA       ------------------------------------------------------------
RPOB_LEUMM       ------------------------------------------------------------
RPOB_OENOB       ------------------------------------------------------------
RPOB_CARHZ       ------------------------------------------------------------
RPOB_MOOTA       ------------------------------------------------------------
RPOB_SYMTH       ------------------------------------------------------------
RPOB_DESHY       ------------------------------------------------------------
RPOB_CLOAB       ------------------------------------------------------------
RPOB_CLONN       ------------------------------------------------------------
RPOB_CLOPS       ------------------------------------------------------------
RPOB_CLOTE       ------------------------------------------------------------
RPOB_HUNT2       ------------------------------------------------------------
RPOB_CLOD6       ------------------------------------------------------------
RPOB_CALS4       ------------------------------------------------------------
RPOB_SYNWW       ------------------------------------------------------------
RPOB_ONYPE       ------------------------------------------------------------
RPOB_COREF       ------------------------------------------------------------
RPOB_CORDI       ------------------------------------------------------------
RPOB_CORJK       ------------------------------------------------------------
RPOB2_NOCFA      ------------------------------------------------------------
RPOB_RHOJR       ------------------------------------------------------------
RPOB_MYCS2       ------------------------------------------------------------
RPOB1_NOCFA      ------------------------------------------------------------
RPOB_SACEN       ------------------------------------------------------------
RPOB_FRAAA       ------------------------------------------------------------
RPOB_STRCO       ------------------------------------------------------------
RPOB_THEFY       ------------------------------------------------------------
RPOB_ACIC1       ------------------------------------------------------------
RPOB_NOCSJ       ------------------------------------------------------------
RPOB_ARTS2       ------------------------------------------------------------
RPOB_LEIXX       ------------------------------------------------------------
RPOB_CUTAK       ------------------------------------------------------------
RPOB_BIFAA       ------------------------------------------------------------
RPOB_TROWT       ------------------------------------------------------------
RPOB_RUBXD       ------------------------------------------------------------
RPOB_DEHMC       ------------------------------------------------------------
RPOB_MYCMS       ------------------------------------------------------------
RPOB_MESFL       ------------------------------------------------------------
RPOB_MYCMO       ------------------------------------------------------------
RPOB_MYCPU       ------------------------------------------------------------
RPOB_MYCS5       ------------------------------------------------------------
RPOB_MYCH2       ------------------------------------------------------------
RPOB_CITSI       ------------------------------------------------------------
RPOB_POPTR       ------------------------------------------------------------
RPOB_AETGR       ------------------------------------------------------------
RPOB_OENEH       ------------------------------------------------------------
RPOB_NYMAL       ------------------------------------------------------------
RPOB_PIPCE       ------------------------------------------------------------
RPOB_PHAAO       ------------------------------------------------------------
RPOB_DIOEL       ------------------------------------------------------------
RPOB_PHAVU       ------------------------------------------------------------
RPOB_LOTJA       ------------------------------------------------------------
RPOB_JASNU       ------------------------------------------------------------
RPOB_LACSA       ------------------------------------------------------------
RPOB_SACHY       ------------------------------------------------------------
RPOB_PELHO       ------------------------------------------------------------
RPOB_ANTAG       ------------------------------------------------------------
RPOB_MARPO       ------------------------------------------------------------
RPOB_PHYPA       ------------------------------------------------------------
RPOB_PSINU       ------------------------------------------------------------
RPOB_ANGEV       ------------------------------------------------------------
RPOB_PINTH       ------------------------------------------------------------
RPOB_CYCTA       ------------------------------------------------------------
RPOB_ADICA       ------------------------------------------------------------
RPOB_HUPLU       ------------------------------------------------------------
RPOB_CHAGL       ------------------------------------------------------------
RPOB_CHAVU       ------------------------------------------------------------
RPOB_STAPU       ------------------------------------------------------------
RPOB_ZYGCR       ------------------------------------------------------------
RPOB_NEPOL       ------------------------------------------------------------
RPOB_OSTTA       ------------------------------------------------------------
RPOB_MESVI       ------------------------------------------------------------
RPOB_CHLAT       ------------------------------------------------------------
RPOB_OLTVI       ------------------------------------------------------------
RPOB_BIGNA       ------------------------------------------------------------
RPOB_PHATC       ------------------------------------------------------------
RPOB_THAPS       ------------------------------------------------------------
RPOB_TRIV2       ------------------------------------------------------------
RPOB_TRIEI       ------------------------------------------------------------
RPOB_SYNY3       ------------------------------------------------------------
RPOB_SYNE7       ------------------------------------------------------------
RPOB_THEEB       ------------------------------------------------------------
RPOB_SYNJA       ------------------------------------------------------------
RPOB_GLOVI       ------------------------------------------------------------
RPOB_PROM5       ------------------------------------------------------------
RPOB_GUITH       ------------------------------------------------------------
RPOB_RHDSA       ------------------------------------------------------------
RPOB_PYRYE       ------------------------------------------------------------
RPOB_GRATL       ------------------------------------------------------------
RPOB_CYAPA       ------------------------------------------------------------
RPOB_CYACA       ------------------------------------------------------------
RPOB_EMIHU       ------------------------------------------------------------
RPOB_EUGLO       ------------------------------------------------------------
                                                                             

RPOB_MYCGE       VTLEKQYNALKQTS-----------------------------------------PNDSS
RPOB_MYCPN       VLLEKEHKALSEAK-----------------------------------------PNDPK
RPOB_MYCGA       YKLNQEKQELLNSSN----------------------------------------PNPTK
RPOB_MYCPE       SSLKSQLEAEGKNA----------------------------------------------
RPOB_UREPA       VEKNDEIDALLHENKDV-----------------------------------EDASFIKN
RPOB_ALKEH       GTGEIICEANTELTAEL----------VQAIQ----DAGVK--QLDTLFV-NDLDRGPYM
RPOB_HALHL       ATGEILAEANTTLTPEI----------TQSLF----DAGIR--EIETLFV-NDLDRGPYM
RPOB_METCA       STGELIAKVNQEITEDV----------YARLV----AAAIP--EIRTLYV-NDLDRGPYI
RPOB_XANC8       STGELLANANDEISEDQ----------LAAFR----KAGVD--AVGTLWV-NDLDRGPYL
RPOB_XYLFT       TTGELLASANSEVNEDR----------IIAFR----KAGIE--SVGTLWV-NDLDRGAYL
RPOB_LEGPA       STGEFLAQANDEITEEL----------LDAMA----NHGIL--QIDMIYT-NDLDHGSYI
RPOB_COXBU       ETGEIIAHANEEITAEL----------LKNLR----ATKTA--SLDTLYI-NEIECGPYV
RPOB_NITOC       GTGEVLAKANDEITAEL----------MTALE----DANIQ--AFDLIYT-NDLDRGSFI
RPOB_AROAE       ETGEIVARANDEITEDL----------LDKLR----DAGVK--DLETLYV-NDLDRGAYI
RPOB_AZOSB       ETGELLARANEEITEDL----------LGKLR----DAGVR--DLVTLYV-NDLDRGAYI
RPOB_METFK       TTGEIIANANDEVTESL----------LDKLR----EADVN--KINTLYA-NDLDHGDYI
RPOB_NITEC       ETGEVVATANSEINETL----------LERIK----QTQNKNSEISTLFV-NDLNYGPYI
RPOB_NITMU       ETGEILALANDEITETL----------LGKLR----DANVE--EIRTIYT-NDLDQGAYI
RPOB_THIDA       DTGELVARANDEITEEL----------LKKLA----AAGID--KFQTLYT-NDLDHGAFI
RPOB_DECAR       ATGEVVANANDEITETL----------LAKLR----EAEIT--TVETLYT-NELDRGAFI
RPOB_PARXL       DTGEVIANANDEITETV----------LEKLR----ESKIK--DIQTLYT-NDLDQGPYI
RPOB_HERAR       DTGEVIASANDELTDDL----------LARLR----EGKIS--HIQTLYT-NDLDQGGYI
RPOB_RALSO       DTGEVLANANDELTEGV----------LEKLR----DAGVK--EIQTLYT-NDLDQGPYM
RPOB_BORA1       DTGEVIALANDEITESV----------LDAMR----AAKVL--DLQTLYT-NDLDRGPYI
RPOB_RHOFT       DTGEILAKANEELTEAL----------IKKLR----LAGVQ--DLPCIYT-NELDQGAYI
RPOB_POLSJ       ETGEIIAKANDELTELL----------LKKLR----LAGVQ--DLQVLYT-NELDQGAYI
RPOB_VEREI       DSGEILAKANDELTEAL----------LKKLR----SAAVR--ELQCIYT-NELDQGAYI
RPOB_METPP       DTGEIIAKANDELTDSL----------LKKLR----TAGIK--DIQCLYT-NELDMGAYI
RPOB_NEIG1       ETGEVLASANDEITEEL----------LAKFD----INGVK--EITTLYI-NELDQGAYI
RPOB_CHRVO       NTGEVIARANEEVTEEI----------LAKLA----LAEVE--QVEVLFT-NDLDQGAYI
RPOB_ACIBT       D--GEVIAANTLLSHEV----------MVKL----AEGGVK--QFNILFT-NDIDRGSFV
RPOB_PSYCK       D--EVIARANTLIDHEL----------LVKLSAFEASESIK--EFSILFT-NDIDQGSYI
RPOB_HAHCH       STGEVIVECNTEITDDA----------IEKIE----KAGIK--RIETLYT-NDLDCGPFV
RPOB_MARHV       STGEVLVECNTELTEEV----------VTKIL----DAGVK--DIETLYT-NDLDCGPFM
RPOB_SACD2       ESGEVLFECNTEITDEV----------LAELV----KSGVK--EFETLYT-NELDCGPFI
RPOB_PSEU5       ATGEIIAECNTELTVDV----------MAKIV----KAQVV--RFETLYT-NDIDCGPFI
RPOB_CHRSD       NTGELVCECNTEITPEL----------LEKIG----QAGIT--TLETLYT-NDLDTGPFV
RPOB_ALCBS       DTGEILVECNTELTAET----------LEKLE----QGGIT--DFETLYT-NDLDNGPFM
RPOB_SODGM       NTGEIIVPANMELTLDL----------LAKLS----QAGHK--RIETLFT-NDLDHGAYI
RPOB_ECOLI       STGELICAANMELSLDL----------LAKLS----QSGHK--RIETLFT-NDLDHGPYI
RPOB_BAUCH       NTGEIIVPANIEITLEI----------LDKLG----KANFK--RIETLFT-NDLDHGAYI
RPOB_BLOFL       KNGELIVAANTEISMDI----------LHNLV----KSGFN--IIETLFS-NDLDYGNYI
RPOB_BLOPB       NTNIPIVTANTEISSDI----------LHNLI----RSGYE--SIETLFS-NDLDYGNYI
RPOB_BUCAI       KTGETIISSNTELSLEI----------LEKLK----KLGFY--SIETLFT-NDLDHGPYI
RPOB_BUCAP       KTGETIILANTELSLEI----------LTKLK----NSSFF--SIETLFT-NDLDHGPYI
RPOB_BUCBP       KTNEIIVSANTELNINI----------IKELK----NNEYT--NIETIFT-NDLDHGPYI
RPOB_WIGBR       KTEKPIITANTELTVDL----------MLNLF----KSGYK--SIETLFT-NDLDHGSYI
RPOB_BUCCC       KTKEILIKSNTTLTQDE----------FNKIK----NFNNK--KFYVLFT-NNIDNGAYI
RPOB_ACTP2       STGEVVCPANMEISMEM----------LAKLS----QAGYK--EIEVLFT-NDLDHGPYI
RPOB_MANSM       ESGELVCPANMEISLDI----------LAKLA----QAGYK--SIETLFT-NDLDFGPYI
RPOB_HAEI8       ESGEIICPANGEISLET----------LAKLA----QAGYT--TIETLFT-NDLDYGPYI
RPOB_ALIF1       DTGEIIIAANQEFSLEDLAN-----------------LSQAGYKKIEVLFTNDLDHGAYI
RPOB_PHOPR       ETGELIAAANQELNLEI----------LALLS----QAGHK--SIEVLFT-NDLDYGPYM
RPOB_VIBCH       ATGELIITANQEISLEA----------LANLS----QAGYK--KLEVLFT-NDLDHGPFM
RPOB_AERS4       QTGEMVVTANQALSLEA----------VANLS----QAGFK--HFEVLFT-NELDHGAYM
RPOB_COLP3       STGEVIAEANAIITLEL----------LAELS----QAGHK--VLSTLYM-NEFDVGSYM
RPOB_PSEA6       ETGELVVAANDLLTLEN----------VLALK----EAGYT--TFETLYI-NELDHGAYI
RPOB_PSEHT       STGEVVANANDELTLEL----------MAELV----KAGHT--KIDTLYI-NEVDSGAYM
RPOB_SHEAM       DTGEVLVTANNEIRLED----------LAQLS----LAGIK--DISTLYI-NELDHGAYI
RPOB_IDILO       KTGEVVGHANDVLTLEL----------IAELS----EAGIK--KIETLFV-NDLDHGPYM
RPOB_PSYIN       ETGEIIVSANDILTLEI----------LAELT----QSGIT--SFDIIYT-NELDCGSFI
RPOB_DICNV       ETGELILAANSELTEEL----------LTRFV----ELGVK--EFQTLLI-NENGHGGYL
RPOB_HYDCU       ETGELVARSNEVIASDL----------IETMK------SIKDLSFRILFI-DDLENGSYI
RPOB_VESOH       DTGEILISANTITSEEV----------LELLN------TNKVKKIEILYI-NSSETGAYI
RPOB_FRATO       ATGEVIAYANDDVTESL----------LESCV----EVGML--ELEVIDF-ITTERGRYI
RPOB_RHIL3       STGEIYLEAGDEIDEKT----------LGIIL----ANGFD--EIPVLGI-DHINVGAYI
RPOB_RHIME       ETGEIYLEAGDEIDEKT----------LPVIL----SAGFD--EIPVLDI-DHINIGAYI
RPOB_AGRFC       STGEIYLEAGDEIDEKT----------LGLIL----QSGFD--EIPVLNI-DHVNVGAYI
RPOB_RHILO       ATGEIFLEAGDEIDEKT----------LKVLL----GTGEQ--EIKVLDI-DHVNVGAYI
RPOB_CHESB       KTGEIFLEAGDEIDEKT----------LKILL----ETAGN--EVKFLDI-DHVNIGGYI
RPOB_BRUSU       ATGEIYLEAGDEIDEKV----------LKTLI----DTGET--EINVLDI-DHVNIGAYI
RPOB_BARBK       ETGEIYLEAGDEIDEKV----------LKVLF----DVGAN--QINILDI-DHMSVGAYI
RPOB_RHOPB       KTGEIYAEAGEEITEKS----------LKGLN----EQGYK--ELPLLDI-DHVNIGAYI
RPOB_GLUOX       NTGEIYGEAGEELTEDR----------LAALE----EMGIT--ELPLLSV-DGSH-GPWI
RPOB_GRABC       QTGEIYAEAGEELTEAR----------LAALE----TLGVT--SLPTLAV-DQTT-GPWI
RPOB_MAGSA       QTGEIFTEAGDELTANL----------VAELE----KAGIS--ELPVLAI-DHINVGPYM
RPOB_RHORT       ASGEIYAEAGEELTEAM----------LADME----KAGFT--ELRVLHI-DHVNVGPYV
RPOB_CAUVC       ATGEIYAEAGDELDVTS----------IQALA----DQGFS--TIDVLDIDHVT-VGAYM
RPOB_MARMM       ETGEIFAEAGDEMSEEI----------LETLK----DTGVK--ELNLLDIDPATGVGPYI
RPOB_HYPNA       ETGEIFGEAGDALEEPI----------IAEMR----EYGID--SIEVLDIDAGG-RGPWL
RPOB_RHOS1       ETGEIWVEAGDELTMEYDRDGEVKGGTLKLLL----DQGIT--DIPVLDI-DNVNVGPYI
RPOB_PARDP       QTGLIYAEAGDEITVEYDRDGEISGGLLKVLL----DNGIE--DIPVLDI-DHVNVGPYI
RPOB_ROSDO       ETGAIYVEAGDELTLEYDKDGTLIGGTAKELV----DAGIT--EIPVLDI-DNVNVGPYM
RPOB_JANSC       ETGAIYVEAGDELTWELDKAGEVSGGTLKELI----DAGIT--EIPVLDI-DNVNVGPYM
RPOB_NOVAD       STGRIWIEAGDEVSPEN----------LDLLD----KAGID--NLDLLDI-DHISTGPWI
RPOB_ERYLH       KTGRIYIEAGDEVGPDH----------LEALD----AAGID--ELELLDI-DEINTGPWI
RPOB_SPHAL       STGEIYIEAGDEVSAEN----------LEKLD----AAGID--KLVLLDI-DHNNTGPWI
RPOB_ZYMMO       STGRIWIEAGDEVTPEN----------LELLD----NAGVA--TLELLDI-DHVSTGPWI
RPOB_PELUB       DEEEGTFGIGTELNDTI----------IKQIL----EANIS--SIEISIT-NSINKGPYL
RPOB_RICBR       ESDEILAKIGEMITVEL----------LSVIS----DLKIK--NISVLVIN-PQ-SGPYI
RPOB_ORITB       QTGEVLLGVGEEITNDI----------LTIVN----DLQIT--TVKVLAVG-GQ-CGPYV
RPOB_ANAMM       SSGAVIVSAGETITSEH----------IVKLE----LFDIS--EIAFLNIDFLT-VGPYV
RPOB_ANAPZ       ASGAVIVSAGEAIAAEH----------IVKLE----LFDIS--EIAFLNIDFLT-VGPYV
RPOB_EHRRW       ASNVMIMCAGESITSEH----------INKLK----LFDIN--EIFILNIDFLT-VGPYI
RPOB_NEOSM       TKGEVLLPHGTKLTKEH----------VAKLE----FLDVD--SIKLVELK-----GNYV
RPOB_MAGMM       VMGEVVIEAGAEITEEM----------VQYLE----DGGIK--EIDVLFI-DGMSVGAYL
RPOB_ANADE       TTGEVLLEVNEEVTEAK----------VEELR----KRNIN--EFKVLFI-DNLNILPAL
RPOB_MYXXD       TNGVVLLECNEEVTQEK----------VDELL----KHGIK--EFKVLFI-DNLNVGPYL
RPOB_SYNFM       GTGEIVAECNDSIDADM----------LKEFV----ERGVG--EIELLHL-EGQDVSPSF
RPOB_SYNAS       ETGEVLFHCNEALSAAG----------IDVVR----EKGIR--ELSVINL-GEDLSNVSI
RPOB_GEOSL       STGEVIVECNDEITQAR----------LDDIK----AKGIT--EFKVLFI-DNLHVTSSL
RPOB_PELPD       ATGEVLLECNEEVTAEK----------FDEIK----AKGVE--SFRLLFI-DNLHITSSF
RPOB_PELCD       STGEVIVECNEEISESK----------LEELR----TRGIV--EFNILFI-DHLHVGPYL
RPOB_BDEBA       STGEIIADANAELNAAI----------IKRSI----EAGIE--SFFMIFF-DGLTVGPYL
RPOB_DESPS       GAEEPLYPCNTEITETV----------LENLA----ENGIN--EFETLFM-DGVNYSASF
RPOB_DESVV       ATGEVLAEAADEITASL----------VENLR----EAGIS--RLPVLHT-KGLETSSSL
RPOB_DESAG       ATGEVLAEAADEITLDL----------IDRLR----ECSIK--RVPVLHT-KGSDTSSSI
RPOB_LAWIP       STGEILAESAEEITEGL----------IQTFR----DAGIT--TFTVLHT-RGNDTSSSI
RPOB_KORVE       NTGEVLLEANQELTADK----LSKMI----------DAGIG--EVNVFFP-ERDDVGTVI
RPOB_SOLUE       TTGEVMIDANSELTTTV----MSKLI----------EAGIT--EFEIFFP-ERDDVGTVI
RPOB_CAMJJ       ESGEVLFDSLTLLDESK----------LAKIK--EQKSFDIANDLANGVDAAIINSFAQD
RPOB_CAMFF       ESGEVIYDTLTQLDENK----------LAKIVA-EQNSIEIANDLASGVDDAIINSFLQD
RPOB_SULDN       ETGEILFDAMTRIDETK----------LKKLSEIGVKNFSIANDLAEGVDGSIINAFNAD
RPOB_BACV8       -SGVQNILVHKEEAN--------------------------------------SSDYSII
RPOB_PARD8       -SGTQNILLHREDQN--------------------------------------LSDYAII
RPOB_PORGI       -SNTQTILLHRNDSN--------------------------------------TSDYSII
RPOB_FLAPJ       -SNVKSILLHKEDNN--------------------------------------VVDYSII
RPOB_GRAFK       -TGSKTILLHKEDNQ--------------------------------------TGDYAII
RPOB_CYTH3       -SGSKSIILHREDVN--------------------------------------IADYTII
RPOB_SALRD       -YDVSRLYLVREDVEDE------------------------------------ALDKSTL
RPOB_PELLD       -AGYKSVKIMKSFNGSD-----------------------------------KGQDKSIV
RPOB_CHLPD       -AGYKSVRVMKSFSGND-----------------------------------KGPDKSII
RPOB_CHLCH       -AGYKSIKVMKSFSNNE-----------------------------------KGMDKSVI
RPOB_CHLTE       -AGYKTVKVMKTTS-PE-----------------------------------KGVDKSVI
RPOB_CHLMU       -AGVQSLKIAVGADE-----------------------------------------NHPI
RPOB_CHLPN       -AGIASVKIAVDADE-----------------------------------------NHPI
RPOB_PARUW       -AGIDVIRIAEDADE-----------------------------------------TSPV
RPOB_RHOBA       -AGVTSVE-AMDLPK-----------------------------------------VPLI
RPOB_TREDE       LDSQIIINCFEREEIKY-------------------------------------TPDPAV
RPOB_TREPA       LRSAVVINCLEREEMKF-------------------------------------S-KSGA
RPOB_BORAP       VSSNVILNCLEKEDAFF-------------------------------------ALKDGS
RPOB_LEPBL       --NPILINALEKD-----------------------------------------------
RPOB_FUSNN       ----LVANTLMNDT----------------------------------------------
RPOB_CYAM1       ------------------------------------------------------------
RPOB_AQUAE       PYGKSLIDTLANDTSPK---------------------------------------DVDK
RPOB_DEIRA       ------------------------------------------------------------
RPOB_DEIGD       ------------------------------------------------------------
RPOB_THET8       ------------------------------------------------------------
RPOB_THEMA       KMLEVVSSSSEEGEEEE------------------------------------------E
RPOB_BACCR       -----------------------------------------------------------L
RPOB_BACSU       -----------------------------------------------------------L
RPOB_BACHD       -----------------------------------------------------------L
RPOB_GEOTN       -----------------------------------------------------------L
RPOB_OCEIH       -----------------------------------------------------------L
RPOB_LISIN       -----------------------------------------------------------L
RPOB_STAS1       -----------------------------------------------------------L
RPOB_STRS2       -----------------------------------------------------------V
RPOB_LACLA       -----------------------------------------------------------L
RPOB_LACGA       -----------------------------------------------------------L
RPOB_LACAC       -----------------------------------------------------------L
RPOB_LACDB       -----------------------------------------------------------L
RPOB_LACPL       -----------------------------------------------------------L
RPOB_LACBA       -----------------------------------------------------------L
RPOB_PEDPA       -----------------------------------------------------------L
RPOB_LACS1       -----------------------------------------------------------L
RPOB_LACSS       -----------------------------------------------------------L
RPOB_LACP3       -----------------------------------------------------------L
RPOB_ENTFA       -----------------------------------------------------------L
RPOB_LEUMM       -----------------------------------------------------------L
RPOB_OENOB       -----------------------------------------------------------L
RPOB_CARHZ       -----------------------------------------------------------I
RPOB_MOOTA       -----------------------------------------------------------I
RPOB_SYMTH       -----------------------------------------------------------I
RPOB_DESHY       -----------------------------------------------------------I
RPOB_CLOAB       -----------------------------------------------------------L
RPOB_CLONN       -----------------------------------------------------------L
RPOB_CLOPS       -----------------------------------------------------------F
RPOB_CLOTE       -----------------------------------------------------------L
RPOB_HUNT2       -----------------------------------------------------------I
RPOB_CLOD6       -----------------------------------------------------------L
RPOB_CALS4       -----------------------------------------------------------L
RPOB_SYNWW       -----------------------------------------------------------I
RPOB_ONYPE       -----------------------------------------------------------I
RPOB_COREF       -----------------------------------------------------------M
RPOB_CORDI       -----------------------------------------------------------M
RPOB_CORJK       -----------------------------------------------------------M
RPOB2_NOCFA      -----------------------------------------------------------M
RPOB_RHOJR       -----------------------------------------------------------L
RPOB_MYCS2       -----------------------------------------------------------M
RPOB1_NOCFA      -----------------------------------------------------------I
RPOB_SACEN       -----------------------------------------------------------L
RPOB_FRAAA       -----------------------------------------------------------M
RPOB_STRCO       -----------------------------------------------------------M
RPOB_THEFY       -----------------------------------------------------------I
RPOB_ACIC1       -----------------------------------------------------------I
RPOB_NOCSJ       -----------------------------------------------------------M
RPOB_ARTS2       -----------------------------------------------------------M
RPOB_LEIXX       -----------------------------------------------------------I
RPOB_CUTAK       -----------------------------------------------------------I
RPOB_BIFAA       -----------------------------------------------------------V
RPOB_TROWT       -----------------------------------------------------------I
RPOB_RUBXD       -----------------------------------------------------------I
RPOB_DEHMC       ---------------------------------------------------------HYI
RPOB_MYCMS       -----------------------------------------------------------L
RPOB_MESFL       -----------------------------------------------------------L
RPOB_MYCMO       -----------------------------------------------------------N
RPOB_MYCPU       -----------------------------------------------------------L
RPOB_MYCS5       -----------------------------------------------------------I
RPOB_MYCH2       -----------------------------------------------------------I
RPOB_CITSI       ------------------------------------------------------------
RPOB_POPTR       ------------------------------------------------------------
RPOB_AETGR       ------------------------------------------------------------
RPOB_OENEH       ------------------------------------------------------------
RPOB_NYMAL       ------------------------------------------------------------
RPOB_PIPCE       ------------------------------------------------------------
RPOB_PHAAO       ------------------------------------------------------------
RPOB_DIOEL       ------------------------------------------------------------
RPOB_PHAVU       ------------------------------------------------------------
RPOB_LOTJA       ------------------------------------------------------------
RPOB_JASNU       ------------------------------------------------------------
RPOB_LACSA       ------------------------------------------------------------
RPOB_SACHY       ------------------------------------------------------------
RPOB_PELHO       ------------------------------------------------------------
RPOB_ANTAG       ------------------------------------------------------------
RPOB_MARPO       ------------------------------------------------------------
RPOB_PHYPA       ------------------------------------------------------------
RPOB_PSINU       ------------------------------------------------------------
RPOB_ANGEV       ------------------------------------------------------------
RPOB_PINTH       -----------------------------------------------------------G
RPOB_CYCTA       ------------------------------------------------------------
RPOB_ADICA       ------------------------------------------------------------
RPOB_HUPLU       ------------------------------------------------------------
RPOB_CHAGL       ------------------------------------------------------------
RPOB_CHAVU       ------------------------------------------------------------
RPOB_STAPU       ------------------------------------------------------------
RPOB_ZYGCR       ------------------------------------------------------------
RPOB_NEPOL       -----------------------------------------------------------L
RPOB_OSTTA       -----------------------------------------------------------D
RPOB_MESVI       ------------------------------------------------------------
RPOB_CHLAT       ------------------------------------------------------------
RPOB_OLTVI       -----------------------------FMKQLKKGRVSSRSSSQELSGSFNLSEDVSL
RPOB_BIGNA       ------------------------------------------------------------
RPOB_PHATC       ------------------------------------------DEVIIQLDKINQKPVLYL
RPOB_THAPS       ------------------------------------------DEIIIQLDKVTQKPIIHL
RPOB_TRIV2       ------------------------------------------------------------
RPOB_TRIEI       ------------------------------------------------------------
RPOB_SYNY3       ------------------------------------------------------------
RPOB_SYNE7       ------------------------------------------------------------
RPOB_THEEB       ------------------------------------------------------------
RPOB_SYNJA       ------------------------------------------------------------
RPOB_GLOVI       ------------------------------------------------------------
RPOB_PROM5       ------------------------------------------------------------
RPOB_GUITH       ------------------------------------------------------------
RPOB_RHDSA       ------------------------------------------------------------
RPOB_PYRYE       ----------------------------------------------------------SV
RPOB_GRATL       ----------------------------------------------------------YK
RPOB_CYAPA       ------------------------------------------------------------
RPOB_CYACA       ------------------------------------------------------------
RPOB_EMIHU       ------------------------------------------------------------
RPOB_EUGLO       ------------------------------------------------------------
                                                                             

RPOB_MYCGE       LTALELEMENKMDSVITERAAKHIVNELSISLR-------------------DIENTEEC
RPOB_MYCPN       VGQLEADMDELMDKIITERAAKHIVHELSISLR-------------------GLENTDEC
RPOB_MYCGA       IESLNTHIGVVLRKLICEKAAKHVIQELSISTR-------------------SLDNVSQK
RPOB_MYCPE       --EKQKELNEVINNIISEKAAKDLVINLSISTK-------------------NIDSKFRL
RPOB_UREPA       NKKLYDEREEIINCIISEKAAKDIVELLGINIK-------------------NIETLRHL
RPOB_ALKEH       SQTLAIDPTRTQLE-----ALVEIYRMMRPGE--------------------PPTKE---
RPOB_HALHL       STTLAADATRSQME-----ALVEIYRMMRPGE--------------------PPTKD---
RPOB_METCA       SNTMRIDLTETQLD-----ALVEIYRMMRPGE--------------------PPTKE---
RPOB_XANC8       SNTLRIDPTKTQLE-----ALVEIYRMMRPGE--------------------PPTKE---
RPOB_XYLFT       SNTLRIDPTRTQLE-----AQVEIYRMMRPGE--------------------PPTKE---
RPOB_LEGPA       SDTLKIDPTGSQLE-----ALVEIYRMMRPGE--------------------PPTKE---
RPOB_COXBU       SDTLRLDTTTNQLE-----ALVEIYRIMRPGE--------------------PPTKE---
RPOB_NITOC       SDSLRLDPTTTPLE-----AQMEIYRVMRPGE--------------------PPTKE---
RPOB_AROAE       SQTLRIDETADQWA-----ARVAIYRMMRPGE--------------------PPTED---
RPOB_AZOSB       SSTLRIDETADQWA-----ARVAIYRMMRPGE--------------------PPTEE---
RPOB_METFK       SQTLRIDEIPDEYS-----ARVAIYRMMRPGE--------------------PPTEE---
RPOB_NITEC       SQTLRVDESTDQMS-----AQVAIYRMMRPGE--------------------PPTED---
RPOB_NITMU       SQTLKIDETADEMA-----AQVAIYRMMRPGE--------------------PPTEE---
RPOB_THIDA       SQTLRTDDTTDEYA-----AKVAIYRMMRPGE--------------------PPTED---
RPOB_DECAR       SNTLRADETATRQA-----ARVAIYRMMRPGE--------------------PPTEE---
RPOB_PARXL       SSTLRIDETADKMA-----ARIAIYRMMRPGE--------------------PPTEE---
RPOB_HERAR       SQTLRMDDTNDQMA-----AKVAIYRMMRPGE--------------------PPTED---
RPOB_RALSO       SQTLRTDDTVDQTA-----ARIAIYRMMRPGE--------------------PPTED---
RPOB_BORA1       SQTLRTDETVDQTA-----ARVAIYRMMRPGE--------------------PPTEE---
RPOB_RHOFT       SQTLRSDETVDEFA-----ARVAIYRMMRPGE--------------------PPTED---
RPOB_POLSJ       SQTLRADETADEFA-----ARVAIYRMMRPGE--------------------PPTED---
RPOB_VEREI       SHTLRSDETVDEFA-----ARVAIYRMMRPGE--------------------PPTED---
RPOB_METPP       SQTLASDETADELA-----ARVAIYRMMRPGE--------------------PPTED---
RPOB_NEIG1       SNTLRTDETAGRQA-----ARVAIYRMMRPGE--------------------PPTEE---
RPOB_CHRVO       SQTLRTDDIQDQTQ-----ARVAIYRMMRPGE--------------------PPTED---
RPOB_ACIBT       ADTLRADLTRDREE-----ALVEIYKVMRPGE--------------------PPTKE---
RPOB_PSYCK       ADTLRADSTSSREE-----ALIEIYKVMRPGE--------------------PPTVE---
RPOB_HAHCH       SDTLRIDATRSQLE-----ALVEIYRMMRPGE--------------------PPTKE---
RPOB_MARHV       SDTLRIDPTRTPLE-----ALVEIYRMMRPGE--------------------PPTKE---
RPOB_SACD2       SDTLRSDPARTQLE-----ALVEIYRMMRPGE--------------------PPTKE---
RPOB_PSEU5       SDTLKIDSTTNQLE-----ALVEIYRMMRPGE--------------------PPTKD---
RPOB_CHRSD       SDTLKIDTTHSQLE-----ALVEIYRMMRPGE--------------------PPTKE---
RPOB_ALCBS       ADTLRADPTRTPLE-----ALVEIYRMMRPGE--------------------PPTKE---
RPOB_SODGM       SETLRVDPTSDRLS-----ALVEIYRMMRPGE--------------------PPTRE---
RPOB_ECOLI       SETLRVDPTNDRLS-----ALVEIYRMMRPGE--------------------PPTRE---
RPOB_BAUCH       SETLRIDSTRDRLS-----ALVEIYRMMRPGE--------------------PPTRE---
RPOB_BLOFL       SETLRIDSTVTRFD-----ALVEIYRVMRPGE--------------------PPTKE---
RPOB_BLOPB       SETLRIDATTNKFD-----ALVEIYRVMRPGE--------------------PPTKE---
RPOB_BUCAI       SETLRIDSSNDRMS-----ALIEIYRVMRPGE--------------------PPTKE---
RPOB_BUCAP       SETLRIDSSHDRIS-----ALMEIYRVMRPGE--------------------PLTKE---
RPOB_BUCBP       SETLNIDPTHDKLS-----ALVEIYRMMRPGE--------------------PPTRE---
RPOB_WIGBR       SETLRIDSTTDKTS-----ALIEIYRMMRPGE--------------------PPTKE---
RPOB_BUCCC       SETLKIDTTKDRLT-----ALIEIYKIMRPGE--------------------PPTKE---
RPOB_ACTP2       SETLRVDPTYDRLS-----ALVEIYRMMRPGE--------------------PPTKE---
RPOB_MANSM       SETLRVDPSSDRLS-----ALVEIYRMMRPGE--------------------PPTKE---
RPOB_HAEI8       SETLRVDPTYDKTS-----ALYEIYRMMRPGE--------------------PPTPE---
RPOB_ALIF1       SDTLRADSTVDRLS-----ALVEIYRMMRPGE--------------------PPTKE---
RPOB_PHOPR       SETLRVDSTTDRLS-----ALVEIYRMMRPGE--------------------PPTRE---
RPOB_VIBCH       SETLRVDSTTDRIS-----ALVEIYRMMRPGE--------------------PPTKE---
RPOB_AERS4       SETLRIDSSSSRLE-----ALVEIYRMMRPGE--------------------PPTRE---
RPOB_COLP3       SDTLRVDSSTNKLE-----ALVEVYRMMRPGE--------------------PPTKD---
RPOB_PSEA6       SDTLRIDSSTNRLE-----ALVEIYRMMRPGE--------------------PPTKD---
RPOB_PSEHT       SNTLNIDSSSSRLE-----ALVEIYRMMRPGE--------------------PPTKD---
RPOB_SHEAM       SDTLRIDSTTNRLE-----ALVEIYRMMRPGE--------------------PPTKD---
RPOB_IDILO       SETLRVDSSNNRLE-----ALVEIYRMMRPGE--------------------PPTRE---
RPOB_PSYIN       SDTLRVDSSSNRLE-----ALVEIYRMMRPGE--------------------PPTKD---
RPOB_DICNV       ADTLRLDETTTELE-----ARAEIYRMMRPGE--------------------PPTKE---
RPOB_HYDCU       SDTLNLDTTTSQLE-----AQIEIYRMMRPGE--------------------PPTKE---
RPOB_VESOH       SDTLRLDETQTEIE-----ARMSIYHVMRPGE--------------------PATED---
RPOB_FRATO       SDTLKYDLTRNTDE-----ALVEIYKVLRPGD--------------------PPAAA---
RPOB_RHIL3       RNTLTADKNENRQD-----ALFDIYRVMRPGE--------------------PPTME---
RPOB_RHIME       RNTLSADKNENRQD-----ALFDIYRVMRPGE--------------------PPTMD---
RPOB_AGRFC       RNTLSADKNQNRQE-----ALFDIYRVMRPGE--------------------PPTMD---
RPOB_RHILO       RNTLNVDKNESRQD-----ALFDIYRVMRPGE--------------------PPTLE---
RPOB_CHESB       RNTLVADKNESRQD-----ALFDIYRVMRPGE--------------------PPTLE---
RPOB_BRUSU       RNTLAVDKNESRQE-----ALFDIYRVMRPGE--------------------PPTMD---
RPOB_BARBK       RNTLKVDKNESRQD-----ALFDIYRVMRPGE--------------------PPTID---
RPOB_RHOPB       RNTLAADKNMTRED-----ALFDIYRVMRPGE--------------------PPTID---
RPOB_GLUOX       RNTLAADKNSCRDE-----ALIDIYRIMRPGE--------------------PPTKE---
RPOB_GRABC       RNTLAIDKNSTRDD-----ALIDIYRVMRPGE--------------------PPTPE---
RPOB_MAGSA       RNTLAIDKNSSREE-----ALIDIYRVMRPGE--------------------PPTLE---
RPOB_RHORT       RNTLAMDKNTTREE-----ALIDIYRVMRPGE--------------------PPTLE---
RPOB_CAUVC       RNTLRVDKNAIRED-----ALFDIYRVMRPGE--------------------PPTVE---
RPOB_MARMM       RATLAADKNDSREQ-----ALVDIYRVMRPGE--------------------PPTPE---
RPOB_HYPNA       RNTLKADKNETRFE-----ALSDIYRVMRPGE--------------------PPTQE---
RPOB_RHOS1       RNTMAADKNMGRDT-----ALMDIYRVMRPGE--------------------PPTVE---
RPOB_PARDP       RNTMAADKNMSRDG-----ALMDIYRVMRPGE--------------------PPTVE---
RPOB_ROSDO       RNTMAQDKNMNRDT-----ALMDIYRVMRPGE--------------------PPTVE---
RPOB_JANSC       RNTLAVDKNLNRES-----ALMDIYRVMRPGE--------------------PPTVE---
RPOB_NOVAD       RNTLKADKAPDRDH-----ALADIYRVMRPGE--------------------PPTRE---
RPOB_ERYLH       RNTLKVDKAENRDE-----GLEAIYKVMRPGE--------------------PPTKE---
RPOB_SPHAL       RNTLKADKAEDRDQ-----ALSDIYRVMRPGE--------------------PPTRE---
RPOB_ZYMMO       RNTLKADKAEDRDH-----ALAEIYRVMRPGE--------------------PPTKE---
RPOB_PELUB       LTTILNDKNNSKND-----AITEIYKVLRPGE--------------------PPTVE---
RPOB_RICBR       RNTLFSDKNQDRES-----ALFDIFRVLRPGE--------------------PANIE---
RPOB_ORITB       RNTLFLDKNKDQKS-----SLVEIFRVLKPGE--------------------MATTA---
RPOB_ANAMM       LNTLFLDKNMTQED-----ALFEIYRVLRSGE--------------------SPNLD---
RPOB_ANAPZ       LNTLFLDRHITQED-----ALFEIYRVLRSGE--------------------SPNLE---
RPOB_EHRRW       LNTLFLDKNISYED-----ALFEIYKVLRSGE--------------------SPSLD---
RPOB_NEOSM       FSTV-LQYDCSYEE-----AMLSIYRVVRPGE--------------------IPSVE---
RPOB_MAGMM       RNTLALDKNSGQDE-----ALIDIYRMMRPGE--------------------PPTVD---
RPOB_ANADE       RDTLMQDKISTPEE-----AIMEIYRRLRPGD--------------------PPTPE---
RPOB_MYXXD       RETLMLDKLETPEQ-----SIMEIYRRLRPGD--------------------PPTPE---
RPOB_SYNFM       RNTLLMDKVNTQED-----ALIEIYRRLRPSN--------------------PPTLE---
RPOB_SYNAS       RDTLLIDRMETPGD-----AIIEIYRRLRPSN--------------------PPTPD---
RPOB_GEOSL       RDTLIADKIAATEE-----ALIEIYRRLRPGD--------------------PPTLK---
RPOB_PELPD       RDTLLMDKISTNDE-----ALIEIYRRLRPGD--------------------PPTLK---
RPOB_PELCD       RETLLLDRMATPED-----ARIEIYRRLRPGD--------------------PPTIK---
RPOB_BDEBA       RNTLLVDKVSNKEE-----SLVEIYKRLRPGE--------------------PPTLE---
RPOB_DESPS       SHTLRLDKVITTAE-----ALLEIYRRLRPSS--------------------PPTLE---
RPOB_DESVV       RDTLVLDKTPDMEA-----AQVEIYRRLRPSS--------------------PPTPE---
RPOB_DESAG       RDTLLLDKTADQEQ-----ARVEIYRRLRPSS--------------------PPTPE---
RPOB_LAWIP       RDTLVQDKIPTTEK-----AQEEIYRRLRPSS--------------------PPTPE---
RPOB_KORVE       SATLRRDSVKTPQE-----ALIEIYRKLRPGD--------------------PPTLD---
RPOB_SOLUE       AATIRKDAVKTQNE-----ALIEIYRKLRPGD--------------------PPTLD---
RPOB_CAMJJ       GETLKLLKQSENIDDENDLAAIRIYKVMRPGE--------------------PVVKD---
RPOB_CAMFF       YETLKLLKQTEGLEDENDLAAIRIYKVMRPGE--------------------PVVKE---
RPOB_SULDN       ADSLKLLKQTEDIEDENHLSAIRIYKVMRPGE--------------------PVTKE---
RPOB_BACV8       FNTLQKDPSNSEKE-----AVLYIYRQLRNAD--------------------PADDA---
RPOB_PARD8       YNTLQKDPSNSEKE-----AVLYIYRQLRNAE--------------------PADEA---
RPOB_PORGI       FNTLQKDPCNSEKE-----ALYYVYRQLRNAE--------------------PADDA---
RPOB_FLAPJ       HNTLQKDPTNSEKE-----AVEHIYRQLRNAE--------------------PPDEE---
RPOB_GRAFK       HNTLQKDPTNSEKE-----AVEHIYRQLRNAE--------------------PPDEE---
RPOB_CYTH3       YNTLQKDNSNSEKE-----AVEQIYRQLRNTD--------------------APDEQ---
RPOB_SALRD       VETLQKDSSHTEEE-----ALEVIYEKLRGSE--------------------APDLD---
RPOB_PELLD       INTILNDSSATEEE-----ALEIVYEELRANE--------------------APDID---
RPOB_CHLPD       INTILNDNSATEEE-----ALEIVYEELRANE--------------------APDID---
RPOB_CHLCH       INTILNDSSATEEE-----ALEIVYEELRANE--------------------APDIE---
RPOB_CHLTE       INTILNDSSATEEE-----ALEIVYEELRSNE--------------------APDID---
RPOB_CHLMU       IKMLAKDPTDSYEA-----ALKDFYRRLRPGE--------------------PATLA---
RPOB_CHLPN       IKMLAKDPTDSYEA-----ALKDFYRRLRPGE--------------------PATLA---
RPOB_PARUW       IKMLAKDPTDSYES-----ALKDFYRKIRPGE--------------------PATLS---
RPOB_RHOBA       FNTLADDNTASHEE-----ALLRIYQRLRPGN--------------------PPQLE---
RPOB_TREDE       NDEPTVED-----------ALNAVYSVIRPGD--------------------PITYE---
RPOB_TREPA       QDELSREE-----------ALCIVYSALRPSD--------------------PMTMD---
RPOB_BORAP       K-ELPKES-----------VMLAVYGALFPGE--------------------PISID---
RPOB_LEPBL       -GVNDYED-----------AILKFHSLMRQGE--------------------PSTIE---
RPOB_FUSNN       --TLTEDE-----------AVVEVFKKLRPGD--------------------QVTVD---
RPOB_CYAM1       ------EA-----------ALVEFYKKMRPGE--------------------PATVH---
RPOB_AQUAE       RSPVKVPAEYTLRDY----GLMEMYKRLRHIE--------------------AITMEIDS
RPOB_DEIRA       -------------------ALLRLFTVLRPGD--------------------PPKRD---
RPOB_DEIGD       -------------------ALLRLFTVLRPGD--------------------PPKRD---
RPOB_THET8       -------------------ALIRLFTLLRPGD--------------------PPKRD---
RPOB_THEMA       KTKIYGLNEVTVVD-----AYLEIFRRLRPEE--------------------LPRIN---
RPOB_BACCR       SNTLEKDNTDS-----TEKALLEIYERLRPGE--------------------PPTVE---
RPOB_BACSU       RNTLDKDNTEN-----SDKALLEIYERLRPGE--------------------PPTVE---
RPOB_BACHD       RNTLEKDNTDS-----AEKALLEIYERLRPGE--------------------PPTVE---
RPOB_GEOTN       RNTLEKDNTDS-----TEKALIEIYERLRPGE--------------------PPTLE---
RPOB_OCEIH       RNTLEKDNTEN-----AEKALLEIYERLRPGE--------------------PPTVE---
RPOB_LISIN       RNTLEKDNTDN-----AEKALLEIYERLRPGE--------------------PPTVD---
RPOB_STAS1       RNTLEKDGTET-----TDQALLEIYERLRPGE--------------------PPTVE---
RPOB_STRS2       RNTIEKDIHKNPADSRTDEALKEIYERLRPGE--------------------PKTAE---
RPOB_LACLA       TDTIAKDVHKNPADTRVEEALKDIYDRLRPGE--------------------PKTAD---
RPOB_LACGA       RFTLEKDIHKNPADSRVAEALKDIYERLRPGE--------------------PKTTD---
RPOB_LACAC       QFTLDKDVHKNPADSRVAEALKDIYERLRPGE--------------------PKTTD---
RPOB_LACDB       DLTLDKDVHKNPADSRVAEALKDIYDRLRPGE--------------------PKTTD---
RPOB_LACPL       MLTLEKDVHKNTDDSRVEESLKDIYERLRPGE--------------------PKTAD---
RPOB_LACBA       MQTLEKDIHKNTDDSRVEESLKDIYERLRPGE--------------------PKTAD---
RPOB_PEDPA       DFTLDKDVHKNPEDSRVAESLKDIYERLRPGE--------------------PKTAD---
RPOB_LACS1       MLTLEKDVHKNMDDSRVEESLKDIYERLRPGE--------------------PKTAD---
RPOB_LACSS       MLTLEKDIHKNTDDSRTEEALKDVYERLRPGE--------------------PKTAD---
RPOB_LACP3       MLTLEKDVHKNTDDSRTDEALKDIYERLRPGE--------------------PKTAD---
RPOB_ENTFA       RNTIEKDLHKNASDSRTEEGLKDIYERLRPGE--------------------PKTAD---
RPOB_LEUMM       NMTLEKDVHKDMSDSRVEEALKDVYERLRPGE--------------------PKTAD---
RPOB_OENOB       NLAIEKDVHKDPSMSRVGEALEDIYERLRPGE--------------------PKTID---
RPOB_CARHZ       IATLERDNTDS-----REEALIEIYKKLRPGE--------------------PPTVE---
RPOB_MOOTA       QNTLEKDNTES-----EEEALVEIYKRLRPGE--------------------PPTVD---
RPOB_SYMTH       RRTLEKDSTES-----EEEALIEIYKRLRPGE--------------------PPAAD---
RPOB_DESHY       RITLERDNTES-----AEEALVEIYKRLRPGE--------------------PPTVD---
RPOB_CLOAB       KATIEKDNTKT-----REEALLEIYKRLRPGE--------------------PPTVD---
RPOB_CLONN       KATIEKDNTKT-----REEALLEIYKRLRPGE--------------------PPTVD---
RPOB_CLOPS       KATIEKDNTKT-----KEEALLEIYKRLRPGE--------------------PPTVD---
RPOB_CLOTE       KASIEKDNTKT-----KEEALLEIYKRLRPGE--------------------PPTVD---
RPOB_HUNT2       LATIQKDSTKT-----EEEGLLEIYKRLRPGE--------------------PPTVE---
RPOB_CLOD6       SATLEKDNTKT-----VEEGLVEIYKKLRPGE--------------------PPTVE---
RPOB_CALS4       KATLDKDTTKS-----EEEALIEIYKRLRPGE--------------------PPTVE---
RPOB_SYNWW       ARTLEKDTSTN-----KKEALIEFYRRLRPGE--------------------LATED---
RPOB_ONYPE       DSVFDKETDMD-----SDNALVELYSKIRQGE--------------------KVPVD---
RPOB_COREF       MSTLESDG-VAN----TDEALLEIYRKQRPGE--------------------QPTRD---
RPOB_CORDI       MSTLESDG-VSN----TDEALLEIYRKQRPGE--------------------QPTRD---
RPOB_CORJK       MSTLEKDG-VDN----TDEALLEIYRKQRPGE--------------------SPTRD---
RPOB2_NOCFA      MSTLEKDN-TAG----QDEALLDIYRKLRPGE--------------------PPTKE---
RPOB_RHOJR       MATLEKDN-TAG----TDEALLDIYRKLRPGE--------------------PPTKE---
RPOB_MYCS2       MGTLEKDT-TSG----TDEALLDIYRKLRPGE--------------------PPTKE---
RPOB1_NOCFA      MASLAKDN-VAG----TDDALLEIHRKLRPGE--------------------PPTKE---
RPOB_SACEN       MATLEKDH-TAG----QDEALLDIYRKLRPGE--------------------PPTKE---
RPOB_FRAAA       RITLEKDH-TAS----QDDALLDIYRKLRPGE--------------------PPTRE---
RPOB_STRCO       RATLEKDH-TQG----QDDALLDIYRKLRPGE--------------------PPTRE---
RPOB_THEFY       RATLEKDP-TAG----TDDALLDIYRKLRPGE--------------------PPTKE---
RPOB_ACIC1       RATLEKDH-VHT----QEEALLDIYRKLRPGE--------------------PPTYE---
RPOB_NOCSJ       MLTLEKDH-TQG----QDDALLDIYRKLRPGE--------------------PPTRE---
RPOB_ARTS2       RATLEKDA-TET----REDALLDIYRKLRPGE--------------------PPTVE---
RPOB_LEIXX       ELTLEKDA-ILT----KEEALKDIYRKLRPGE--------------------QVAAE---
RPOB_CUTAK       RQTLEKDHGVET----QDQALLDIYKKLRPGE--------------------PPSRD---
RPOB_BIFAA       MDALAKET-VQT----QDEALTDLYRKIRPAD--------------------TPTPE---
RPOB_TROWT       SVQHEKNI-GLS----RDDALREIYRRVRPGE--------------------QASAE---
RPOB_RUBXD       RNTLERDD-TTS----REDALLEVFRRQRPGE--------------------PVNLE---
RPOB_DEHMC       QSSIDRDPLIKD----EISALIDIYSRLRPGD--------------------PPNAD---
RPOB_MYCMS       QQDSIIGDFKID----WSNQVQEIYKKITQGE--------------------TATSE---
RPOB_MESFL       KNDNDTGDTYAD----WAQHVQEIYKKIRQGE--------------------TATSD---
RPOB_MYCMO       PILKET-LNKEK-FKTEDDALEYLYSVIWRGNN-------------------RITAE---
RPOB_MYCPU       SKDKILGKNKDI-VEIRKEAQENIFRIVRRGD--------------------RITKE---
RPOB_MYCS5       RKNKTIDITEFSRQEIMDLCQEKIFRIIRKGD--------------------RISEE---
RPOB_MYCH2       RRHKLESLEENL---------ELIYRIVRKDD--------------------RITEE---
RPOB_CITSI       -NKE------KKKIGSKENAILEFYQQFACVGG------------------DPVFSESLC
RPOB_POPTR       -DKE------KKKIGSRENAILEFYQQFTCVGG------------------GPVFSESLC
RPOB_AETGR       -DKE------KKKIGSKENAILEFYQQFSCVGG------------------DPIFSESLC
RPOB_OENEH       -EKE------KKTIGSKENAILEFYQQFSCVGG------------------DPVFSESLC
RPOB_NYMAL       -EKE------KKKIGSKENAILEFYQKFACVGG------------------DPVFSESLC
RPOB_PIPCE       -ERD------KKKIGSRENAILEFYQQFACVGG------------------DPVFSESLC
RPOB_PHAAO       -DKE------KKKIGSKENAILEFYQQFACVGG------------------DPVFSESLC
RPOB_DIOEL       -DKE------KKKIGSKENAILEFYQQFACVGG------------------DPVFSESLC
RPOB_PHAVU       -DKD------KKKIGSKENAILEFYRQFACVGG------------------DPVFSESLW
RPOB_LOTJA       -DKE------EKKIGSKESAILEFYRQFACVGG------------------DPVFPESLC
RPOB_JASNU       -DKE------RKKIGSKENAILEFYQQFACVGG------------------DPVFSESLC
RPOB_LACSA       -DK--------KQIGSKENAILEFYQQFACVEG------------------DPVFSESLS
RPOB_SACHY       -AKE------KKRIESKEKAILEFYQQFACVGG------------------DLVFSESLC
RPOB_PELHO       -LKK------ECGFKEKKYAILELYAKYKDFTEY----------------KDSLDFDFLC
RPOB_ANTAG       RKTK------KEHLQSTEDAIVELYKQIYCIGG------------------DLNFSESIS
RPOB_MARPO       KNTK------KEYPNSTEDAIVELYKHLYCIGG------------------DLFFSESIR
RPOB_PHYPA       KKKK------KEHLQSTEDAMVELYKQLYYIGG------------------DLLFSESIR
RPOB_PSINU       --RQ------DKDIKSSEDAIIELYKNLYCVSG------------------DVTFSESIR
RPOB_ANGEV       --RQ------AENIQSYEDAIVELYKNLYSAGG------------------NLVFSDSIC
RPOB_PINTH       RWER------EEYLWSREKAILEFYKKLYCISG------------------DLVFSESLC
RPOB_CYCTA       RQEQ------KEYLRSKKNAILEFYKKLYCVSG------------------DLVFSESLC
RPOB_ADICA       RQK--------ESIESPEDAIVELYKHLYSATD-----------------ADVFFSESIF
RPOB_HUPLU       EAKD------EENIEWKENAVSELYEQIFGTTD-----------------EEDVESYDIF
RPOB_CHAGL       ---K------KNVLSNQKDAILEIYKQLFSAGG------------------DPNFSDNIL
RPOB_CHAVU       --KE------KRTPYSPEEAIIELYRHSCSVSG------------------EISFSENIR
RPOB_STAPU       --SG------LKNEGERTLELIALYKQLPGPKK-----------------VKPKANPLII
RPOB_ZYGCR       --LC------VEDAK------IDLCKRL--KLK-----------------QKTTQIELGV
RPOB_NEPOL       AKKRWQDKVYELIPQSTTDALFHLYTKLSPDKP-------------------GNTLTARR
RPOB_OSTTA       WK------------LTTDEAILLLMSRLFPNRP-------------------ATVLRGRK
RPOB_MESVI       -------TIQETDPYLEND--IQHDDDFENEST-------------------STLLSTRE
RPOB_CHLAT       -------TIEEGDPYSENDALIDLHSQLYPERP-------------------STLFAARE
RPOB_OLTVI       RLDDSSKNMGAENVQRAPLQKSTKKATLFGDFSRSSVYCKTQEEALWALYALTHPLKNPD
RPOB_BIGNA       ------HNLGNFKSQKEALEKIELYSQLESSIN-------------------SRNLKNQN
RPOB_PHATC       LKEMGLTDLEIYQNLEYADFFYFNKPLLINSKR------------------LSEPLSRFN
RPOB_THAPS       LKEMGVTDLEICQNLQNSEFFYFNKPILTNSIH------------------QPNKLLRFN
RPOB_TRIV2       ----------KEGQFSEEEALMELYRKLRPGEP-------------------PTVLGGQQ
RPOB_TRIEI       ----------KEGQYGEEEALLELYRKLRPGEP-------------------PTIAGGEQ
RPOB_SYNY3       ----------KEGNPTEEEALVELYKKLRPGEP-------------------PTVSGGQQ
RPOB_SYNE7       ----------KEGQFSEDEALMELYRKLRPGEP-------------------PTVSGGQQ
RPOB_THEEB       ----------KEGKFSEEEALIELYKKLRPGEP-------------------PTVSGGQQ
RPOB_SYNJA       ----------KEGHYSEEEALMELYRKLRPGEP-------------------PTVSGGQQ
RPOB_GLOVI       ----------KEGNYSEEEALLELYRKLRPGEP-------------------PTVSGGQQ
RPOB_PROM5       --------ANDEGINSEDQALLELYKKLRPGEP-------------------PSVSGGQQ
RPOB_GUITH       ----------FEGNYTTETALIQMYNKLRPGEP-------------------ATVTGGQQ
RPOB_RHDSA       ----------VEGNYTTEEALIQMYTKLRPGEP-------------------ATVNGGQQ
RPOB_PYRYE       KELAKEIGKNNIEEVTDEEALLIVYSKLRPNEP-------------------ATVAVAKQ
RPOB_GRATL       KEFSKDVNNVDIEKITEEEALVIVYSKLRPNEP-------------------ATLAVAKQ
RPOB_CYAPA       ----------EHGDCTEEEALIEFHRQLRPGEP-------------------PNSIQGRY
RPOB_CYACA       ----------KDENYTQQEALEELHKKLFPGEP-------------------ATSEASTK
RPOB_EMIHU       ----------TDEQLTTEQCLLEVHSHLKPEEP-------------------ATAKGCQK
RPOB_EUGLO       ----------------IEIPTINLTQLSKENN----------------------------
                                                                             

RPOB_MYCGE       --HEVSFHALLCARFFRNKRYNLSNAGRYKVSRKLRLTERIYQKTLACDLFLK-------
RPOB_MYCPN       --PENSYHALLCSRFFRQRRYNLSAAGRYKVSRKLRITERIYQKTLACDLHLK-------
RPOB_MYCGA       --EEISYQSILLQHFFQKKRYDLSSAGRHKFVRKLRVSERLYQRTIAQDIKDL-------
RPOB_MYCPE       SNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-------
RPOB_UREPA       --GKASYQIALQQHFFNKRLYDISSAGRYKFEKKLLLSERLYQKVIANDIIDK-------
RPOB_ALKEH       -----AAENLFQNLFFSPDRYDLSPVGRMKFNLRVGR-----------------------
RPOB_HALHL       -----AAENLFHTLFFTSDRYDLSPVGRMKFNLRVGR-----------------------
RPOB_METCA       -----AAQTLFENLFFSAERYDLSAVGRMKFNRRLGR-----------------------
RPOB_XANC8       -----AAQNLFHNLFFTFERYDLSTVGRMKFNHRVGR-----------------------
RPOB_XYLFT       -----AAQNLFHNLFFTFDRYDLSMVGRMKFNRRVGR-----------------------
RPOB_LEGPA       -----AAEALFKNLFFVEERYDLSAVGRMKFNRRVGI-----------------------
RPOB_COXBU       -----AAESLFENLFFSPERYSLSAVGRMKFNRRVGR-----------------------
RPOB_NITOC       -----AAQNLFQNLFFNPERYDLSPVGRMKFNRRLGK-----------------------
RPOB_AROAE       -----AVEALFQGLFYSEERYDLSSVGRMKFNRRAYPEKIED------------------
RPOB_AZOSB       -----AVEALFQGLFYAPERYDLSTVGRMKFNRRAYPEKIDD------------------
RPOB_METFK       -----AVQALFEGLFFNEDRYDLSAVGRMKFNRRAFPEKIEE------------------
RPOB_NITEC       -----AVLALFNGLFYSPERYDLSVVGRMKFNRR--------------------------
RPOB_NITMU       -----AVKALFIGLFYAPERYDLSVVGRMKFNRR--------------------------
RPOB_THIDA       -----AVNALFVNLFFSDERYDLSAVGRMKFNRR--------------------------
RPOB_DECAR       -----AVEILFNGLFYSDERYDLSGVGRMKFNRRLARQDVIEYKLMVKGLASKAEAALKN
RPOB_PARXL       -----AVEALFNRLFYSEDAYDLSKVGRMKFNRRVGR-----------------------
RPOB_HERAR       -----SVEALFNGLFYNPDRYDLSAVGRMKFNRRIGR-----------------------
RPOB_RALSO       -----AVEALFQRLFYSEDSYDLSRVGRMKVNSRLNR-----------------------
RPOB_BORA1       -----AVEALFQRLFYSEETYDLSRVGRMKVNSRLGRG----------------------
RPOB_RHOFT       -----AVQALFQRLFYNPDTYDLSRVGRMKFNAKMGR-----------------------
RPOB_POLSJ       -----AVQALFQRLFYNPDTYDLSKVGRMKFNARVGR-----------------------
RPOB_VEREI       -----AVQALFQRLFYNPDTYDLSRVGRMKFNARIGR-----------------------
RPOB_METPP       -----AVQALFNRLFYSEDTYDLSRVGRMKFNARVGR-----------------------
RPOB_NEIG1       -----AVEQLFNRLFFSEDSYDLSRVGRMKFNTRTYEQKLSEAQQNS-------------
RPOB_CHRVO       -----AVEALFQRLFFSDETYDLSRVGRMKFSSRTYQYKFDDKTPE--------------
RPOB_ACIBT       -----AAENLFNNLFFSSERYDLSPVGRMKFNRRLGR-----------------------
RPOB_PSYCK       -----TAEKLFDSMFFNADRYDLSNVGRMKFNRRLGL-----------------------
RPOB_HAHCH       -----SAENLFNNLFFSEERYDLSAVGRMKFNRRLGR-----------------------
RPOB_MARHV       -----SAENLFNNLFFSEERYDLSAVGRMKLNRRLGR-----------------------
RPOB_SACD2       -----SAETLFQNLFFSSERYDLSAVGRMKFNRRLGR-----------------------
RPOB_PSEU5       -----AAETLFNNLFFAAERYDLSAVGRMKFNRRIGR-----------------------
RPOB_CHRSD       -----AAETLFHNLFFTEDRYDLSGVGRMKFNRRLRR-----------------------
RPOB_ALCBS       -----AAENLFKNLFFTDERYDLSTVGRMKFNRRLGR-----------------------
RPOB_SODGM       -----AAENLFENLFFSEDRYDLSAVGRMKFNRSLLR-----------------------
RPOB_ECOLI       -----AAESLFENLFFSEDRYDLSAVGRMKFNRSLLR-----------------------
RPOB_BAUCH       -----AAENLFENIFFSEDRYDLSAVGRMKFNRALLR-----------------------
RPOB_BLOFL       -----AAEYLFESLFFLEERYDLSDVGRMKFNRSLQR-----------------------
RPOB_BLOPB       -----AAEYLFENLFFSEERYDLSSVGRMKFNRSLQR-----------------------
RPOB_BUCAI       -----ATENLFENLFFSEDRYDLSTVGRMKFNRSLLR-----------------------
RPOB_BUCAP       -----ATENLFENLFFSEDRYDLSSVGRMKFNRSLLR-----------------------
RPOB_BUCBP       -----AAENLFENLFFSEERYDLSSVGRMKFNRSLQK-----------------------
RPOB_WIGBR       -----AAENLFYNLFFSEDRYDLSSVGRMKFNKSLSI-----------------------
RPOB_BUCCC       -----AAENLFNNLFFSQERYDLSPVGRMKFNKSLKR-----------------------
RPOB_ACTP2       -----AAEALFDNMFFSADRYDLSAVGRMKFNRSLNL-----------------------
RPOB_MANSM       -----AAEALFDNLFFSAERYDLSAVGRMKFNRSLGL-----------------------
RPOB_HAEI8       -----SSEALFNNLFFSAERYDLSTVGRMKFNRSLAF-----------------------
RPOB_ALIF1       -----AAEALFESLFFSEERYDLSTVGRMKFNSSIGR-----------------------
RPOB_PHOPR       -----AAEQLFNSLFFSEDRYDLSAVGRMKFNSSLLR-----------------------
RPOB_VIBCH       -----AAESLFESLFFSAERYDLSTVGRMKFNSSIGR-----------------------
RPOB_AERS4       -----AAEQLFENLFFSSERYDLSTVGRMKFNRRLSR-----------------------
RPOB_COLP3       -----AAEGLFSNLFFASERYDLSTVGRMKFNRRVGN-----------------------
RPOB_PSEA6       -----AAETLFTNLFFSEDRYDLSSVGRMKFNRRLGR-----------------------
RPOB_PSEHT       -----AAEALFQNLFFSEERYDLSTVGRMKFNSRVGY-----------------------
RPOB_SHEAM       -----AAEALFQNLFFSEERYDLSKVGRMKFNRRLEI-----------------------
RPOB_IDILO       -----AAETLFDNLFFSEERYDLSTVGRMKFNRRLGR-----------------------
RPOB_PSYIN       -----AAEGLFHNLFFAEERYELSKVGRMKFNRRVGI-----------------------
RPOB_DICNV       -----AADSLFEGLFFDEARYDLSRVGRMKFNRSLGR-----------------------
RPOB_HYDCU       -----SSEALFNSLFFDEARYDLSSVGRMKLNRRLGR-----------------------
RPOB_VESOH       -----AVNLLFNNLFFKNDRYDLSKVGRMKLNRRLGI-----------------------
RPOB_FRATO       -----SVKALFEGLFFIESRYSLSDIGRMKLNARLGSD----------------------
RPOB_RHIL3       -----SAEAMFNSLFFDAERYDLSAVGRVKMNMRLD------------------------
RPOB_RHIME       -----SAEAMFNALFFDAERYDLSAVGRVKMNMRLD------------------------
RPOB_AGRFC       -----SAEAMFNSLFFDAERYDLSAVGRVKMNMRLD------------------------
RPOB_RHILO       -----TAEAMFNSLFFDSERYDLSAVGRVKMNMRLE------------------------
RPOB_CHESB       -----TAEAMFHSLFFDAERYDLSAVGRVKMNMRLE------------------------
RPOB_BRUSU       -----SAEAMFHSLFFDSERYDLSAVGRVKMNMRLD------------------------
RPOB_BARBK       -----TAEAMFHSLFFDSERYDLSAVGRVKMNLRMG------------------------
RPOB_RHOPB       -----SAQNMFQSLFFDSERYDLSAVGRVKMNMRLE------------------------
RPOB_GLUOX       -----TAEAMFHGLFFDQGRYDLSAVGRVKMNMRLD------------------------
RPOB_GRABC       -----TAEALFRGLFFDMDRYDLSSVGRVKMNMRLG------------------------
RPOB_MAGSA       -----TAEALFTGLFFDSERYDLSAVGRVKMNSRL-------------------------
RPOB_RHORT       -----TADALFKGLFFDSERYDLSAVGRVKMNARLGF-----------------------
RPOB_CAUVC       -----AAEAMFKSLFFDAERYDLSSVGRVKMNMRLEQ-----------------------
RPOB_MARMM       -----TAEAMFQGLFFDSERYDLSAVGRVKMNMRLDL-----------------------
RPOB_HYPNA       -----AADALFGQLFFDPERYDLSAVGRVKMNMRLSVAVR--------------------
RPOB_RHOS1       -----AASNLFDTLFFDSERYDLSAVGRVKMNMRLD------------------------
RPOB_PARDP       -----AASALFDSLFFDSERYDLSAVGRVKMNMRLD------------------------
RPOB_ROSDO       -----AASALFDTLFFDAERYDLSAVGRVKMNMRLA------------------------
RPOB_JANSC       -----AASNLFDQLFFDSERYDLSAVGRVKMNMRLD------------------------
RPOB_NOVAD       -----TAEALFDGLFFDGDRYDLSAVGRVKLNMRLG------------------------
RPOB_ERYLH       -----TAEALFEGLFFDGERYDLSAVGRVKLNMRLD------------------------
RPOB_SPHAL       -----TAEALFAGLFFDPERYDLSAVGRVKLNMRLG------------------------
RPOB_ZYMMO       -----TAEALFYGLFFDPERYDLSAVGRVKLNMRLD------------------------
RPOB_PELUB       -----IATQIFNNLFFSSDRYDLSDVGRVKMNSRLN------------------------
RPOB_RICBR       -----AAESLFYNLFFDPERYDLSEVGRIKMNSRLE------------------------
RPOB_ORITB       -----ASRGLLDSLLFDNNRYDLSEVGRIKINSRLN------------------------
RPOB_ANAMM       -----AVKSFFKGLFFESERYDLSVVGRIKLNSHLG------------------------
RPOB_ANAPZ       -----AVKSFFKGLFFEPDRYDLSVVGRIKLNSHLR------------------------
RPOB_EHRRW       -----TMKAFFDGLFFEKERYDLSTVGRIKLNDHLG------------------------
RPOB_NEOSM       -----SAEKLFESLFFSPERYDLLNVGRIRLNAKFN------------------------
RPOB_MAGMM       -----AAKALFNNLFFNSDRYDLSTVGRLKMNSRLS------------------------
RPOB_ANADE       -----TATNLFVNLFFNAERYDLSKVGRLKLNYKFGIEEPL-------------------
RPOB_MYXXD       -----TAINLFTNLFFNPERYDLSKVGRLKLNFKFGLEEPL-------------------
RPOB_SYNFM       -----VATEFFNNLFFNPDHYDLSEVGRLKLNLQLGLEVPL-------------------
RPOB_SYNAS       -----TAQKFFNSLFFENESYDLSTVGRAKMNYKLRLDVST-------------------
RPOB_GEOSL       -----SAQALFENLFFNAERYDLSAVGRLKLNFKLGLNVPL-------------------
RPOB_PELPD       -----SSLALFENLFFNPERYDLSAVGRLKLNFKLGLKVWP-------------------
RPOB_PELCD       -----SANALFESLFFNPERYDLSVVGRIKLNYKLGLQSPE-------------------
RPOB_BDEBA       -----AATTFFGRLFFDPETYDLSEVGRIKINHRFGISMDECPP----------------
RPOB_DESPS       -----IATTFFENLFFNPDLYDLSEVGRYKINAKLGLKTDI-------------------
RPOB_DESVV       -----IAASFFDNLFRSADYYDLSPVGRYKLNQRLGIDQSVDL-----------------
RPOB_DESAG       -----IASTFFENLFRNPDYYDLSPVGRYKLNQRLGLTTTQE------------------
RPOB_LAWIP       -----IAASFFDNLFRNNSYYDLSPVGRYKLNQRLDNYENATL-----------------
RPOB_KORVE       -----TATALFHGMFFDARKYDFSRVGRLKFNIKLFDRQD--------------------
RPOB_SOLUE       -----TATQLFQGMFFDPRKYDFSRVGRMKFNIKLYDRSD--------------------
RPOB_CAMJJ       -----AAKAFVNDLFFNPERYDLTKVGRMKMNHKLGL-----------------------
RPOB_CAMFF       -----AARTFVNDLFFNPERYDLTKVGRMKMNHKLGL-----------------------
RPOB_SULDN       -----AAKVFVNQLFFDPERYDLTKVGRMKMNHKLGL-----------------------
RPOB_BACV8       -----SAREVINNLFFSEKRYDLGEVGRYRINKKLGLT----------------------
RPOB_PARD8       -----SAREVITNLFFSEKRYDLGEVGRYRINKKLGLT----------------------
RPOB_PORGI       -----SAREVITNLFFSDKRYDLGDVGRYRINKKLNLN----------------------
RPOB_FLAPJ       -----TARGIIDKLFFSDQRYNLGEVGRYRINKKLGLD----------------------
RPOB_GRAFK       -----TARGIIDKLFFSDQRYSLGEVGRYRMNKKLGLD----------------------
RPOB_CYTH3       -----TARDIIHNLFFSDKRYDLGEVGRYRINKKLGSG----------------------
RPOB_SALRD       -----SAREALERLFFNEDRYDLGDVGRHRMNARLDVD----------------------
RPOB_PELLD       -----AARSFLERTFFNQKKYDLGEVGRYRIGKKLSREFSEMDEYLGGKGELKQLSD---
RPOB_CHLPD       -----AARSFLERTFFNQKKYDLGDVGRYRIRKKLSKEFEELHGYLDGQPELKKLSD---
RPOB_CHLCH       -----AARSFLERTFFNQKKYDLGDVGRYRIKKKLRREFEELYSFIGEKPELKALSD---
RPOB_CHLTE       -----AARSFLERTFFNQKKYDLGDVGRYRIQKKLQNELAELSAYLEKRPELKELSD---
RPOB_CHLMU       -----NARSTIMRLFFDSKRYNLGRVGRYKLNKKLGFPLDDE------------------
RPOB_CHLPN       -----NARSTIMRLFFDPKRYNLGRVGRYKLNRKLGFSIDDE------------------
RPOB_PARUW       -----NARSAIMRLFFDPKRYNLGRVGRYKLNSKLGCEINDE------------------
RPOB_RHOBA       -----KARTLFQEKFYDDNRYRLGKVGRFRLNRKLGLGVEE-------------------
RPOB_TREDE       -----NAKEDLHNMFFTARRYDIGKVGRYKLNKKFDY-----------------------
RPOB_TREPA       -----AAEKDLQTMFFSPRRYDLGRVGRYKLNKKFRS-----------------------
RPOB_BORAP       -----NAENDLKTIFFSERRYDLGRVGRYKLSKKFG------------------------
RPOB_LEPBL       -----NATTELTRLFFSPKTFDLGEVGRYKINSKFEF-----------------------
RPOB_FUSNN       -----SARSLIRQMFFNPQRYDLEPVGRYKMNKRLKL-----------------------
RPOB_CYAM1       -----SAKQLLYARFFDPKKYDLSEVGRYKLNQKLHL-----------------------
RPOB_AQUAE       VIE--RARIFFNVFFRDLKRYDLSRVGRVKINAKVHRIPKVLKPADVDLLDQLPPLA---
RPOB_DEIRA       -----KAIQYLFGLLADPRRYDLGEPGRFKMNTKLGVQ----------------------
RPOB_DEIGD       -----KAIQYLYGLLADPKRYDLGEPGRFKMNTKLGTR----------------------
RPOB_THET8       -----KAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIR----------------------
RPOB_THEMA       -----AAKRYLHDLFFNPERYDLSEVGRYKVNERLRNAYIRYLIEVEG------------
RPOB_BACCR       -----NAKSLLVSRFFDPKRYDLANVGRYKINKKLHIKNRLFNQRLAE------------
RPOB_BACSU       -----NAKSLLDSRFFDPKRYDLANVGRYKINKKLHIKNRLFNQRLAE------------
RPOB_BACHD       -----NAKSLLDSRFFDPKRYDLANVGRYKVNKKLHIKNRLFNQRLAE------------
RPOB_GEOTN       -----NAKSLLASRFFDPKRYDLASVGRYKINKKLHIKNRLFNQRLAE------------
RPOB_OCEIH       -----NAKSLLVSRFFDPKRYDLAHVGRYKMNKKLHMKNRLFNQILAE------------
RPOB_LISIN       -----NARSLLVSRFFDPKRYDLASVGRYKINKKLHLKNRLFNQTLAE------------
RPOB_STAS1       -----NAKSLLYSRFFDPKRYDLASVGRYKANKKLHLKHRLFNQKLAE------------
RPOB_STRS2       -----SSRSLLTARFFDPRRYDLAPVGRYKINKKLNLRTRLLNQTLAE------------
RPOB_LACLA       -----SSRGLLVARFFDPKRYDFAPVGRYKFNKKLALKNRLLGLTLAE------------
RPOB_LACGA       -----SSRSLLYARFFDPRRYDLAPVGRYKINKKLSLKNRLLRQTLAE------------
RPOB_LACAC       -----SSRSLLYARFFDPRRYDLAPVGRYKINKKLSLKNRLYGQTLAE------------
RPOB_LACDB       -----SSRSLLVSRFFDPRRYDLAAVGRYKVNKKLSLKNRLLGYTLAE------------
RPOB_LACPL       -----SSRSLLTARFFDPKRYDFAPVGRYKVNKKLSMKTRLMDQTLAE------------
RPOB_LACBA       -----SSRSLLTARFFDPKRYDMAPVGRYKTNKKLSLKTRLLGLTLAE------------
RPOB_PEDPA       -----SSRSLLTARFFDPKRYDMAPVGRYKVNKKLSLKTRLLGQTLAE------------
RPOB_LACS1       -----SSRSLLTARFFDPKRYDLAPVGRYKINKKLDLKTRLLNLTVAE------------
RPOB_LACSS       -----SSRSLLFARFFDAKRYDLASVGRYKINKKLSLKTRLLGQTLAE------------
RPOB_LACP3       -----SSRSLLYARFFDPKRYDLASVGRYKVNKKLSLKTRLLNQVLAE------------
RPOB_ENTFA       -----SSRSLLTARFFDPKRYDLANVGRYKVNKKLDLKTRLLNLTLAE------------
RPOB_LEUMM       -----SSRALLVARFFDPKRYDLASVGRYKINKKLSLKTRLLNQTLAE------------
RPOB_OENOB       -----SSRSLLAARFFDPKRYDLGNVGRYKVNKKLSLKSRLLGQTLAE------------
RPOB_CARHZ       -----SAKTLLDSMFFDPKRYDLGNVGRYKLFKKLN------------------------
RPOB_MOOTA       -----SARNLLESLFFDPRRYDLGNVGRYKLHKKFN------------------------
RPOB_SYMTH       -----NARQLLETLFFEPKRYDLMHVGRYRLNKKLALKRRIVGTSTVD------------
RPOB_DESHY       -----SARSLLEALFFDPKRYDLAKVGRYKLNKKLNL-----------------------
RPOB_CLOAB       -----SAFSLINSLFFDPKRYDLSRVGRYKFNKKLAVSIRIANKTAAK------------
RPOB_CLONN       -----SALSLINSLFFDAKRYDLSRVGRYKFNKKLAIYIRLLNQVAAE------------
RPOB_CLOPS       -----SAISLIDSLFFDAKRYDLSRVGRYKFNKKLAIGLRIANQIAAE------------
RPOB_CLOTE       -----SAMSLIGSLFFDAKRYDLSRVGRYKFNKKLALHLRIANQISAQ------------
RPOB_HUNT2       -----SAKALLHGLFFDPKRYDLAKPGRFKFNKKLSIAARIHGFIAGE------------
RPOB_CLOD6       -----SASSLLNALFFDPKRYDLAKVGRYKFNKKLALCYRIMNKISAE------------
RPOB_CALS4       -----SARSLFNALFFDPKRYDLAKVGRYKFNKKLALKARIANHKSAK------------
RPOB_SYNWW       -----AAEQLLKNLFFDPRRYDMAAVGRYKVNKKLGLNIP--------------------
RPOB_ONYPE       -----TARDFIRTRLFDQKKYDLAKVGRYKFNKKLDVLTRAENTYLAC------------
RPOB_COREF       -----LAQSLLDNSFFKAKRYDLAKVGRYKINRKLGLGG-DNDG----------------
RPOB_CORDI       -----LAQSLLDNSFFRAKRYDLAKVGRYKVNRKLGLGG-DNEG----------------
RPOB_CORJK       -----SAQALLENSFFKAKRYDLAKVGRYKVNRKLGLGG-DTDG----------------
RPOB2_NOCFA      -----SAQTLLENLFFKEKRYDLARVGRYKINKKLGIHVGEPVT----------------
RPOB_RHOJR       -----SAQTLLENLFFKDKRYDLARVGRYKINKKLGLNLGQPIV----------------
RPOB_MYCS2       -----SAQTLLENLFFKEKRYDLARVGRYKVNKKLGLNAGKPIT----------------
RPOB1_NOCFA      -----SAQNLLANLFFTEKRYDLARVGRYKIDKKLGLRA--PGA----------------
RPOB_SACEN       -----SAQTLLENLFFKEKRYDLARVGRYKVNKKLGLDL--PFE----------------
RPOB_FRAAA       -----SAQTLLENLFFNPKRYDLAKVGRYKVNKKLTLEIAHDV-----------------
RPOB_STRCO       -----AAQTLLENLYFNPKRYDLAKVGRYKVNKKLGADEPLDA-----------------
RPOB_THEFY       -----AAQALLENLYFNPKRYDLAKVGRYKINKKLGLEIDITQ-----------------
RPOB_ACIC1       -----AAQTLLNNLYFNPKRYDLAKVGRYKVNKKLGLDLPYTQ-----------------
RPOB_NOCSJ       -----AAQTLLNNYYFNPKRYDLAKVGRYKINKKLGLLEAFDQ-----------------
RPOB_ARTS2       -----AAQSLLDNLYFNSKRYDLAKVGRYKINRKLGIDRSLGDKE---------------
RPOB_LEIXX       -----AARALLDNFYFNPKRYDLAKVGRYKINRKLGLEAPLTD-----------------
RPOB_CUTAK       -----AAQQLLENYYFNPKRYDLAKVGRYKINKKLGLSLPFDQ-----------------
RPOB_BIFAA       -----AGKNLLDSFYFNTKRYDLARVGRYKINRKLGLEKDVNDR----------------
RPOB_TROWT       -----AGRALLENFYFTSRRFDLARVGRYKVNRKLGVDVDPTRM----------------
RPOB_RUBXD       -----NAQNLVDGLFFDPKRYDLSEVGRYKVNKKLRLDVPRDVH----------------
RPOB_DEHMC       -----NARKLINEMFFDPQHYDLGKVGRYKVNRRLELPSREVGE----------------
RPOB_MYCMS       -----GASKFINSILFDKRKYDLTKAGRFKLKQKLSIKNRILNRVIAEDIVD--------
RPOB_MESFL       -----GASKYINGLLFDRRKYDLTKAGRFKLQQKLAVKNRLMGRILAEDIVD--------
RPOB_MYCMO       -----SKSNLLSNILFNPRRYNLSKTGRYMLNRKLSLVDRIIGTYLAEDLF---------
RPOB_MYCPU       -----ASQNLISNLLFNEKRYNLSKTGRYMLNRKLSLFDRIITTYLAQDIVLK-------
RPOB_MYCS5       -----SKRSLLSGMLFDKKRYNLSKTGRYMLNNKLSLVERITNTYLAQKVV---------
RPOB_MYCH2       -----GLKNLIPSIIFNERRYNLASTGRFMLNAKLNLVERISQTYLAEDLVS--------
RPOB_CITSI       ---------KELQKKFFHQRCELGKIGRRNMNQRLN------------------------
RPOB_POPTR       ---------KELQKKFFQQRCELGRIGRLNMNQRLN------------------------
RPOB_AETGR       ---------KELQKKFFHQRCELGRIGRRNINWRLN------------------------
RPOB_OENEH       ---------KELHTKFFQQRCELGRIGRQNMNRRLN------------------------
RPOB_NYMAL       ---------KELQKKFFQQRCELGRIGRRNMNQRLN------------------------
RPOB_PIPCE       ---------RELQKKFFQQRCELGRIGRRNMNRRLN------------------------
RPOB_PHAAO       ---------KELQKKFFQQRCELGKIGRQNLNRRLN------------------------
RPOB_DIOEL       ---------KELQKKFFQQRCELGRIGRRNTNQRLN------------------------
RPOB_PHAVU       ---------KELQKKFFQQRCELGRIGRRNMNQKLN------------------------
RPOB_LOTJA       ---------RELQKKFFQQRCELGEIGRRNMNRRLN------------------------
RPOB_JASNU       ---------KELQTKFFQQRCELGRIGRRNMNRRLN------------------------
RPOB_LACSA       ---------KDLQKKFFQQRCELGGIGRRNMNRRLN------------------------
RPOB_SACHY       ---------EELQKKFFQQKCELGRVGRRNMNRRLN------------------------
RPOB_PELHO       ---------ETLRKTFFSHKCELGRVGRQNINRRLN------------------------
RPOB_ANTAG       ---------KELQKKFFQQRCELGKIGRLNLNKKLN------------------------
RPOB_MARPO       ---------KELQKKFFQQRCELGKIGRLNLNKKLN------------------------
RPOB_PHYPA       ---------KELQKKFFQQRCELGKIGRLNVNKKLS------------------------
RPOB_PSINU       ---------KELQRKLFKQRFELGQIGRRNPNNKLN------------------------
RPOB_ANGEV       ---------KELQTKFFQQKFELGQFGRRNLNKKLN------------------------
RPOB_PINTH       ---------KELQKKFFRKRCELGKIGRRNLNQKLN------------------------
RPOB_CYCTA       ---------KELRKKFLQQRCELGKIGRRNPNQKLN------------------------
RPOB_ADICA       ---------RELQKRFFQHRCELGRIGRRNLNIKLT------------------------
RPOB_HUPLU       ---------EELKKEFFEPKFELGRIGRFNINKKLN------------------------
RPOB_CHAGL       ---------SELQRTFFQQRCEIGLIGRSNLNKKLG------------------------
RPOB_CHAVU       ---------KELYHKFFKIRCEIGSIGRLNINKKLN------------------------
RPOB_STAPU       ---------SEQIQQWCAQVYKLGTSGRLNLNRRLN------------------------
RPOB_ZYGCR       ---------TDPIYSLFLKPYELGRMGRLNLNKRLN------------------------
RPOB_NEPOL       ---------VLYEKLMDAKRYDVGLVGRVKLNKKLK------------------------
RPOB_OSTTA       ---------FLFNQFFNPRRYSLSDVGRKRVNQKFR------------------------
RPOB_MESVI       ---------ILESRFFQSKYYDLGKVGRYKINKKLQ------------------------
RPOB_CHLAT       ---------LLKSKFFDPKYYDLGKVGRYKINKKLQ------------------------
RPOB_OLTVI       EVTANLGKSFLYRKFMNSRVYDLSPLGRLRLNQKLN------------------------
RPOB_BIGNA       -------KITIFDRFMNPKYYDLGTRGRIQINKKFNN-----------------------
RPOB_PHATC       LGLSYFKNISEFSRIFDPTYYRLGRVGRLKINSRLN------------------------
RPOB_THAPS       LNKNYYKNISEFSRIFDPSYYRLGKIGRSKLNNRLD------------------------
RPOB_TRIV2       ---------LLDSRFFDPKRYDLGRVGRYKLNKKLR------------------------
RPOB_TRIEI       ---------LLHSRFFDQKRYDLGQVGRYKLNNKLR------------------------
RPOB_SYNY3       ---------LLESRFFDPKRYDLGRVGRYKLNKKLR------------------------
RPOB_SYNE7       ---------LLESRFFDPKRYDLGRVGRYKLNKKLG------------------------
RPOB_THEEB       ---------LLESRFFDPKRYDLGRVGRYKLNRKLQ------------------------
RPOB_SYNJA       ---------LLESRFFDPKRYDLGRVGRYKLNKKLN------------------------
RPOB_GLOVI       ---------LLETRFFDPKRYDLGRVGRYKLNKKLR------------------------
RPOB_PROM5       ---------LLHSRFFDPKRYDLGRVGRYKINKKLR------------------------
RPOB_GUITH       ---------LLYSRFFDPKRYDLGKVGRYKLNKKLN------------------------
RPOB_RHDSA       ---------ILYSRFFDPKRYDLGKVGRYKINKKLA------------------------
RPOB_PYRYE       ---------MLYSRFFDPKRYDLGEVGRYKINKKLG------------------------
RPOB_GRATL       ---------MLYTRFFDPKRYDLGAVGRHKINQKLN------------------------
RPOB_CYAPA       ---------LLYSRFFDPKRYDLGFVGRYKLNKKLN------------------------
RPOB_CYACA       ---------ILYFKFFNPKKYDLGIVGRKKINKKLD------------------------
RPOB_EMIHU       ---------LLYAKFFDSKKYDLGYVGRHKLNQALM------------------------
RPOB_EUGLO       ---IKTIRNNLYNRFLNSDNYNLGDTGRFKINKKIYKT----------------------
                                       .   **                                

RPOB_MYCGE       --------------------------------------------DGKLLLKKGTLLLKEE
RPOB_MYCPN       --------------------------------------------NGELLLKKGTLLVKEE
RPOB_MYCGA       --------------------------------------------DGNVVIKQGTLMLKEQ
RPOB_MYCPE       --------------------------------------------NGKVVIKKNTLIQKHE
RPOB_UREPA       --------------------------------------------KNNILIPKDTLITKEH
RPOB_ALKEH       ------------------------------------------------DEVTGPGVLDN-
RPOB_HALHL       ------------------------------------------------DEVRGPGILYDG
RPOB_METCA       ------------------------------------------------TDPTGPGVLEN-
RPOB_XANC8       ------------------------------------------------KEVLGESVLYDK
RPOB_XYLFT       ------------------------------------------------KEVAGEPVLYDK
RPOB_LEGPA       ------------------------------------------------KSDEGPGTLTK-
RPOB_COXBU       ------------------------------------------------KELTGLDVLSK-
RPOB_NITOC       ------------------------------------------------EDITGPSILSK-
RPOB_AROAE       ---------------------------------KAPSWLKRFYETVGPRGEEGPATLSN-
RPOB_AZOSB       ---------------------------------KAPGWLKRFYDKVGPHGEEGEGVLAN-
RPOB_METFK       ---------------------------------RTAAWLRRFYEKVGPQGAEGPGTLSN-
RPOB_NITEC       ---------------------------------------------VGREELTGSTTLSN-
RPOB_NITMU       ---------------------------------------------VGKTELDGPTTLSN-
RPOB_THIDA       ---------------------------------------------IGRDELTGTGTLST-
RPOB_DECAR       LAEASGFALSAIQDLVSLMPFGARAMVENSTLSEVEALAAKLKPLGANVEVREQLTLSP-
RPOB_PARXL       ------------------------------------------------DEIVGPMTLQD-
RPOB_HERAR       ------------------------------------------------DSLTGDMTLSN-
RPOB_RALSO       ------------------------------------------------SEGTGPMVLTD-
RPOB_BORA1       ------------------------------------------------DDANGPMTLTD-
RPOB_RHOFT       ------------------------------------------------PESTGPMVLTN-
RPOB_POLSJ       ------------------------------------------------DDSTGPMVMTN-
RPOB_VEREI       ------------------------------------------------DESTGPMVLSN-
RPOB_METPP       ------------------------------------------------DTAEGRMVLAN-
RPOB_NEIG1       ------------------------------------WYGRLLNETFAGAADKGGYVLSV-
RPOB_CHRVO       ------------------------------------WFKTLIGEKFASRRDVMEGTLAT-
RPOB_ACIBT       ------------------------------------------------PYEVGTDQKSRE
RPOB_PSYCK       ------------------------------------------------DFVDTDDADIQR
RPOB_HAHCH       ------------------------------------------------EETEGLGVLSH-
RPOB_MARHV       ------------------------------------------------EESTGEGTLTH-
RPOB_SACD2       ------------------------------------------------DSEVGSGTLSN-
RPOB_PSEU5       ------------------------------------------------TEIEGSGVLSR-
RPOB_CHRSD       ------------------------------------------------EGDTGSGVLDN-
RPOB_ALCBS       ------------------------------------------------EDETGPGILYDG
RPOB_SODGM       ------------------------------------------------EEIEGSGILSK-
RPOB_ECOLI       ------------------------------------------------EEIEGSGILSK-
RPOB_BAUCH       ------------------------------------------------EEIEGSGLLSK-
RPOB_BLOFL       ------------------------------------------------DDISGSGVLTK-
RPOB_BLOPB       ------------------------------------------------VQIEDLGTLKK-
RPOB_BUCAI       ------------------------------------------------EETKGSSTLNK-
RPOB_BUCAP       ------------------------------------------------KKIEGVSTLNK-
RPOB_BUCBP       ------------------------------------------------QNITERGVLNQ-
RPOB_WIGBR       ------------------------------------------------NSSEGSSLLDK-
RPOB_BUCCC       ------------------------------------------------KEKKGSGILNK-
RPOB_ACTP2       ------------------------------------------------EEGVGSGILSN-
RPOB_MANSM       ------------------------------------------------AEGVGNGVLSK-
RPOB_HAEI8       ------------------------------------------------PEGEGAGILSN-
RPOB_ALIF1       ------------------------------------------------DNDEGAGVLDE-
RPOB_PHOPR       ------------------------------------------------EETTGSGILDH-
RPOB_VIBCH       ------------------------------------------------EDAEEQGTLDE-
RPOB_AERS4       ------------------------------------------------EDETGAGTLTK-
RPOB_COLP3       ------------------------------------------------ADDVGTGILSK-
RPOB_PSEA6       ------------------------------------------------ETSIGAGTLDK-
RPOB_PSEHT       ------------------------------------------------DTDTGPGTLSK-
RPOB_SHEAM       ------------------------------------------------ADDVGTGVLSN-
RPOB_IDILO       ------------------------------------------------EDLSGDNTLSR-
RPOB_PSYIN       ------------------------------------------------DGDEGAGILSK-
RPOB_DICNV       ------------------------------------------------EESEGSGILSK-
RPOB_HYDCU       ------------------------------------------------KDNEGSLVLEN-
RPOB_VESOH       ------------------------------------------------SRETGEHVLTN-
RPOB_FRATO       ------------------------------------------------KVSKDIYTLEN-
RPOB_RHIL3       -----------------------------------------------LTVEDTVRILRK-
RPOB_RHIME       -----------------------------------------------LDVPDTVRTLRK-
RPOB_AGRFC       -----------------------------------------------LDAEDTVRTLRK-
RPOB_RHILO       -----------------------------------------------LKAEDTVRVLRK-
RPOB_CHESB       -----------------------------------------------LDCPDTVRVLRS-
RPOB_BRUSU       -----------------------------------------------LDAEDTVRVLRK-
RPOB_BARBK       -----------------------------------------------LDCPDTVRVLRQ-
RPOB_RHOPB       -----------------------------------------------LDAPDTHRTLRK-
RPOB_GLUOX       -----------------------------------------------VDAPDTLRVLRK-
RPOB_GRABC       -----------------------------------------------VDAPDTVRTLRK-
RPOB_MAGSA       ---------------------------------------------NTPEVADTVRVLRK-
RPOB_RHORT       ---------------------------------------------TMQEAPDTMRVLRK-
RPOB_CAUVC       ------------------------------------------------DVSDEVRILRK-
RPOB_MARMM       ------------------------------------------------DAPDDMRTLRK-
RPOB_HYPNA       ---------------------------------------------EYESAADNMRTLRN-
RPOB_RHOS1       -----------------------------------------------LGKPDTQRTLDR-
RPOB_PARDP       -----------------------------------------------LDAPDTQRTLRK-
RPOB_ROSDO       -----------------------------------------------LDAEDTQRTLRR-
RPOB_JANSC       -----------------------------------------------LDAEDTMRTLRK-
RPOB_NOVAD       -----------------------------------------------LDCPDTVTTLRT-
RPOB_ERYLH       -----------------------------------------------LDAEDTVTTLRK-
RPOB_SPHAL       -----------------------------------------------LDAEDTVTTLRS-
RPOB_ZYMMO       -----------------------------------------------LDCPDTVTTLRA-
RPOB_PELUB       -----------------------------------------------LECSDKITILRN-
RPOB_RICBR       -----------------------------------------------LNISDETTVLTT-
RPOB_ORITB       -----------------------------------------------LDIDLKNTCITV-
RPOB_ANAMM       -----------------------------------------------LDVDENTTVLTK-
RPOB_ANAPZ       -----------------------------------------------LDIDENLTVLTK-
RPOB_EHRRW       -----------------------------------------------LDISEDVTVLTK-
RPOB_NEOSM       -----------------------------------------------LSHDESLTVLTK-
RPOB_MAGMM       -----------------------------------------------LNTELHIRTLQH-
RPOB_ANADE       ----------------------------------------------------ENTVLT--
RPOB_MYXXD       ----------------------------------------------------DGQILT--
RPOB_SYNFM       ----------------------------------------------------DYRTLR--
RPOB_SYNAS       ----------------------------------------------------DVTVLR--
RPOB_GEOSL       ----------------------------------------------------DCQTLT--
RPOB_PELPD       ----------------------------------------------------ECTVLNAP
RPOB_PELCD       ----------------------------------------------------DQTTLT--
RPOB_BDEBA       ----------------------------------------------------SHRTLT--
RPOB_DESPS       ----------------------------------------------------EHRALT--
RPOB_DESVV       ------------------------------------------------------RTLTD-
RPOB_DESAG       ------------------------------------------------------RVLTD-
RPOB_LAWIP       ------------------------------------------------------RTLSD-
RPOB_KORVE       ------------------------------------------------PTGLDKRTLDP-
RPOB_SOLUE       ------------------------------------------------ATALDKRTLDS-
RPOB_CAMJJ       ------------------------------------------------EVPEYVTVLTN-
RPOB_CAMFF       ------------------------------------------------SVPEYVTVLTN-
RPOB_SULDN       ------------------------------------------------NIPEYITVLTH-
RPOB_BACV8       -------------------------------------------------TDMDVKVLTK-
RPOB_PARD8       -------------------------------------------------TSADVKVLTK-
RPOB_PORGI       -------------------------------------------------IDPDIKVLTN-
RPOB_FLAPJ       -------------------------------------------------TPMEKQVLTK-
RPOB_GRAFK       -------------------------------------------------VEMDKQVLTK-
RPOB_CYTH3       -------------------------------------------------MGSEVKVLTK-
RPOB_SALRD       -------------------------------------------------VDTDEKVLTK-
RPOB_PELLD       --------------------------------TIHQKILQTIQSFSDEPIGEEVLVLTH-
RPOB_CHLPD       --------------------------------TIYEKILHTIQSFSDEPIGGDILVLTH-
RPOB_CHLCH       --------------------------------TIEEKILQTIQTYSDEPIGEDILVLTH-
RPOB_CHLTE       --------------------------------AIYERILQTISTYSEEPIGEDILVLTH-
RPOB_CHLMU       --------------------------------------------------TLSQVTLRK-
RPOB_CHLPN       --------------------------------------------------ALSQVTLRK-
RPOB_PARUW       --------------------------------------------------KLQTVTLDK-
RPOB_RHOBA       ----------------------------------------------------TVMTLRP-
RPOB_TREDE       ---------------------------------------------------SDDVKGT--
RPOB_TREPA       ---------------------------------------------------DSPTTEC--
RPOB_BORAP       ---------------------------------------------------SDDLSTS--
RPOB_LEPBL       ---------------------------------------------------NNPKEFSGE
RPOB_FUSNN       ---------------------------------------------------DVPEEQI--
RPOB_CYAM1       ---------------------------------------------------DIPLSVH--
RPOB_AQUAE       ------------------------------------------LAEDYGEYKAGTRVTKDL
RPOB_DEIRA       ------------------------------------------------RQERTLLKFEDG
RPOB_DEIGD       ------------------------------------------------RQDRTLLTFEDG
RPOB_THET8       ------------------------------------------------LSGRTLARFEDG
RPOB_THEMA       ---------------------------------------EDPEEARKKVYNETSLVLKPL
RPOB_BACCR       ---------------------------------------------TLVDPETGEILAAEG
RPOB_BACSU       ---------------------------------------------TLVDPETGEILAEKG
RPOB_BACHD       ---------------------------------------------TLIDPETGEVIAEEG
RPOB_GEOTN       ---------------------------------------------TIADPETGEIIAEAG
RPOB_OCEIH       ---------------------------------------------PIVDPETGEVIAEKG
RPOB_LISIN       ---------------------------------------------TLVDPETGEIIASKG
RPOB_STAS1       ---------------------------------------------PIVNTETGEIVAEEG
RPOB_STRS2       ---------------------------------------------HVINGETGEIVLEAG
RPOB_LACLA       ---------------------------------------------PIVDPETGEILVNTD
RPOB_LACGA       ---------------------------------------------TLADPDTGEIIAKKG
RPOB_LACAC       ---------------------------------------------TLADPDTGEIIVKKD
RPOB_LACDB       ---------------------------------------------TLADPDTGEVLAAKG
RPOB_LACPL       ---------------------------------------------TLADPDTGEVIAQKD
RPOB_LACBA       ---------------------------------------------TLADPDTGEIIAAKG
RPOB_PEDPA       ---------------------------------------------TLADPDTGEVIAQKG
RPOB_LACS1       ---------------------------------------------TLADPDTGEIIVNKD
RPOB_LACSS       ---------------------------------------------TLADPDTGEVIAAKD
RPOB_LACP3       ---------------------------------------------TLADPDTGEVIAQKG
RPOB_ENTFA       ---------------------------------------------TLVDPETGEIIVEKG
RPOB_LEUMM       ---------------------------------------------TLADPDSGEIIAEKG
RPOB_OENOB       ---------------------------------------------DILNSD-GEVVVPKD
RPOB_CARHZ       ------------------------------------------------------------
RPOB_MOOTA       ------------------------------------------------------------
RPOB_SYMTH       ---------------------------------------------RVVHPETGEVLAEAG
RPOB_DESHY       ------------------------------------------------------------
RPOB_CLOAB       ---------------------------------------------DIVNPETGEIIVEKG
RPOB_CLONN       ---------------------------------------------DVVNPFTGEIIVQKG
RPOB_CLOPS       ---------------------------------------------DIVDKLTGEVLVAKG
RPOB_CLOTE       ---------------------------------------------DIVNPATGEIVVQEG
RPOB_HUNT2       ---------------------------------------------NIKDPDTGEIIVAEG
RPOB_CLOD6       ---------------------------------------------DIINPETGEVFVKAG
RPOB_CALS4       ---------------------------------------------RIVNPITGEVLVEEG
RPOB_SYNWW       ------------------------------------------------------------
RPOB_ONYPE       ---------------------------------------------DFVNPETQEIIIAQD
RPOB_COREF       ------------------------------------------------------------
RPOB_CORDI       ------------------------------------------------------------
RPOB_CORJK       ------------------------------------------------------------
RPOB2_NOCFA      ------------------------------------------------------------
RPOB_RHOJR       ------------------------------------------------------------
RPOB_MYCS2       ------------------------------------------------------------
RPOB1_NOCFA      ------------------------------------------------------------
RPOB_SACEN       ------------------------------------------------------------
RPOB_FRAAA       ------------------------------------------------------------
RPOB_STRCO       ------------------------------------------------------------
RPOB_THEFY       ------------------------------------------------------------
RPOB_ACIC1       ------------------------------------------------------------
RPOB_NOCSJ       ------------------------------------------------------------
RPOB_ARTS2       ------------------------------------------------------------
RPOB_LEIXX       ------------------------------------------------------------
RPOB_CUTAK       ------------------------------------------------------------
RPOB_BIFAA       ------------------------------------------------------------
RPOB_TROWT       ------------------------------------------------------------
RPOB_RUBXD       ------------------------------------------------------------
RPOB_DEHMC       ------------------------------------------------------------
RPOB_MYCMS       -------------------------------------------ANNNVLIAKDTEVNKHN
RPOB_MESFL       -------------------------------------------ASGKILVAKNTEISKAN
RPOB_MYCMO       --------------------------------------SAKGTKNAKLVFAKGTLITREI
RPOB_MYCPU       --------------------------------------NVDPTMEAKILYPKGTYITNDI
RPOB_MYCS5       -------------------------------------------SHLGNTFDVGTYVTYEI
RPOB_MYCH2       -------------------------------------------KKNKILFKKGTYITRQL
RPOB_CITSI       -----------------------------------------------LNIPQNNTFLLP-
RPOB_POPTR       -----------------------------------------------LDIPHNNTFLLP-
RPOB_AETGR       -----------------------------------------------LTIPQNNIFLLP-
RPOB_OENEH       -----------------------------------------------LDIPQHNTFLLP-
RPOB_NYMAL       -----------------------------------------------LDIPPNNTFLLP-
RPOB_PIPCE       -----------------------------------------------LDIPQNNTFLLP-
RPOB_PHAAO       -----------------------------------------------LDIPQNNTFLLP-
RPOB_DIOEL       -----------------------------------------------LDIPQKNTFLLP-
RPOB_PHAVU       -----------------------------------------------LDIPQNNTFLLP-
RPOB_LOTJA       -----------------------------------------------LDIPQNNTFLLP-
RPOB_JASNU       -----------------------------------------------LDIPQNNTFLLP-
RPOB_LACSA       -----------------------------------------------LDIPQNNTFLLP-
RPOB_SACHY       -----------------------------------------------LDIPQNNTFLLP-
RPOB_PELHO       -----------------------------------------------LDISHKNTFLLP-
RPOB_ANTAG       -----------------------------------------------LDVPENENFLLP-
RPOB_MARPO       -----------------------------------------------LNVPENEIFVLP-
RPOB_PHYPA       -----------------------------------------------LDIPENEFFLLP-
RPOB_PSINU       -----------------------------------------------LNVPENESFLLP-
RPOB_ANGEV       -----------------------------------------------LDVPGNEHLLLP-
RPOB_PINTH       -----------------------------------------------LDIPENEIFSLP-
RPOB_CYCTA       -----------------------------------------------LDIPENEIFSLP-
RPOB_ADICA       -----------------------------------------------LDVPETESFLLP-
RPOB_HUPLU       -----------------------------------------------LNVPKDEIFLLP-
RPOB_CHAGL       -----------------------------------------------LNIPDEEIFLLP-
RPOB_CHAVU       -----------------------------------------------LDIPEEERFLVP-
RPOB_STAPU       -----------------------------------------------LNFSKSNDSLLP-
RPOB_ZYGCR       -----------------------------------------------LRVSEFEILLRS-
RPOB_NEPOL       -----------------------------------------------LPVPEHVHTLRP-
RPOB_OSTTA       -----------------------------------------------MRSKTKHLTLTP-
RPOB_MESVI       -----------------------------------------------LNIPENIRVLTV-
RPOB_CHLAT       -----------------------------------------------LSIPEDIRVLTP-
RPOB_OLTVI       -----------------------------------------------LSVNENITTITA-
RPOB_BIGNA       -----------------------------------------------IEETIQHSTLTS-
RPOB_PHATC       -----------------------------------------------LKMSERLQTITY-
RPOB_THAPS       -----------------------------------------------INLSKRITTITY-
RPOB_TRIV2       -----------------------------------------------LSVPDTVRVLTS-
RPOB_TRIEI       -----------------------------------------------LNLPNTVRVLTK-
RPOB_SYNY3       -----------------------------------------------LNEADTTRVLTP-
RPOB_SYNE7       -----------------------------------------------LNVADTVRTLTS-
RPOB_THEEB       -----------------------------------------------LNIPDSVRILTP-
RPOB_SYNJA       -----------------------------------------------LNVAENVRVLTV-
RPOB_GLOVI       -----------------------------------------------LSVPETTRILTP-
RPOB_PROM5       -----------------------------------------------LTVPDNVRTLTH-
RPOB_GUITH       -----------------------------------------------LSVPENVRVLTP-
RPOB_RHDSA       -----------------------------------------------LSIPENIKVLTP-
RPOB_PYRYE       -----------------------------------------------LNIPKTFRVLSP-
RPOB_GRATL       -----------------------------------------------LKVPTHFRVLSP-
RPOB_CYAPA       -----------------------------------------------LNVSPNIRILTT-
RPOB_CYACA       -----------------------------------------------LNSPENIRILTI-
RPOB_EMIHU       -----------------------------------------------LDIDSDVRILTS-
RPOB_EUGLO       ------------------------------------------------EFFTNKKILMP-
                                                                             

RPOB_MYCGE       IDKIKQAAKNNE------------------------------------------------
RPOB_MYCPN       IDKIKQAAQNNQ------------------------------------------------
RPOB_MYCGA       LDLFKRLSKEKR------------------------------------------------
RPOB_MYCPE       LDTIKQLTKEGK------------------------------------------------
RPOB_UREPA       IELIKKESRDKN------------------------------------------------
RPOB_ALKEH       ------------------------------------------------------------
RPOB_HALHL       KYFAGL------------------------------------------------------
RPOB_METCA       ------------------------------------------------------------
RPOB_XANC8       KYFA--------------------------------------------------------
RPOB_XYLFT       KYFS--------------------------------------------------------
RPOB_LEGPA       ------------------------------------------------------------
RPOB_COXBU       ------------------------------------------------------------
RPOB_NITOC       ------------------------------------------------------------
RPOB_AROAE       ------------------------------------------------------------
RPOB_AZOSB       ------------------------------------------------------------
RPOB_METFK       ------------------------------------------------------------
RPOB_NITEC       ------------------------------------------------------------
RPOB_NITMU       ------------------------------------------------------------
RPOB_THIDA       ------------------------------------------------------------
RPOB_DECAR       ------------------------------------------------------------
RPOB_PARXL       ------------------------------------------------------------
RPOB_HERAR       ------------------------------------------------------------
RPOB_RALSO       ------------------------------------------------------------
RPOB_BORA1       ------------------------------------------------------------
RPOB_RHOFT       ------------------------------------------------------------
RPOB_POLSJ       ------------------------------------------------------------
RPOB_VEREI       ------------------------------------------------------------
RPOB_METPP       ------------------------------------------------------------
RPOB_NEIG1       ------------------------------------------------------------
RPOB_CHRVO       ------------------------------------------------------------
RPOB_ACIBT       ------------------------------------------------------------
RPOB_PSYCK       ------------------------------------------------------------
RPOB_HAHCH       ------------------------------------------------------------
RPOB_MARHV       ------------------------------------------------------------
RPOB_SACD2       ------------------------------------------------------------
RPOB_PSEU5       ------------------------------------------------------------
RPOB_CHRSD       ------------------------------------------------------------
RPOB_ALCBS       RYFSA-------------------------------------------------------
RPOB_SODGM       ------------------------------------------------------------
RPOB_ECOLI       ------------------------------------------------------------
RPOB_BAUCH       ------------------------------------------------------------
RPOB_BLOFL       ------------------------------------------------------------
RPOB_BLOPB       ------------------------------------------------------------
RPOB_BUCAI       ------------------------------------------------------------
RPOB_BUCAP       ------------------------------------------------------------
RPOB_BUCBP       ------------------------------------------------------------
RPOB_WIGBR       ------------------------------------------------------------
RPOB_BUCCC       ------------------------------------------------------------
RPOB_ACTP2       ------------------------------------------------------------
RPOB_MANSM       ------------------------------------------------------------
RPOB_HAEI8       ------------------------------------------------------------
RPOB_ALIF1       ------------------------------------------------------------
RPOB_PHOPR       ------------------------------------------------------------
RPOB_VIBCH       ------------------------------------------------------------
RPOB_AERS4       ------------------------------------------------------------
RPOB_COLP3       ------------------------------------------------------------
RPOB_PSEA6       ------------------------------------------------------------
RPOB_PSEHT       ------------------------------------------------------------
RPOB_SHEAM       ------------------------------------------------------------
RPOB_IDILO       ------------------------------------------------------------
RPOB_PSYIN       ------------------------------------------------------------
RPOB_DICNV       ------------------------------------------------------------
RPOB_HYDCU       ------------------------------------------------------------
RPOB_VESOH       ------------------------------------------------------------
RPOB_FRATO       ------------------------------------------------------------
RPOB_RHIL3       ------------------------------------------------------------
RPOB_RHIME       ------------------------------------------------------------
RPOB_AGRFC       ------------------------------------------------------------
RPOB_RHILO       ------------------------------------------------------------
RPOB_CHESB       ------------------------------------------------------------
RPOB_BRUSU       ------------------------------------------------------------
RPOB_BARBK       ------------------------------------------------------------
RPOB_RHOPB       ------------------------------------------------------------
RPOB_GLUOX       ------------------------------------------------------------
RPOB_GRABC       ------------------------------------------------------------
RPOB_MAGSA       ------------------------------------------------------------
RPOB_RHORT       ------------------------------------------------------------
RPOB_CAUVC       ------------------------------------------------------------
RPOB_MARMM       ------------------------------------------------------------
RPOB_HYPNA       ------------------------------------------------------------
RPOB_RHOS1       ------------------------------------------------------------
RPOB_PARDP       ------------------------------------------------------------
RPOB_ROSDO       ------------------------------------------------------------
RPOB_JANSC       ------------------------------------------------------------
RPOB_NOVAD       ------------------------------------------------------------
RPOB_ERYLH       ------------------------------------------------------------
RPOB_SPHAL       ------------------------------------------------------------
RPOB_ZYMMO       ------------------------------------------------------------
RPOB_PELUB       ------------------------------------------------------------
RPOB_RICBR       ------------------------------------------------------------
RPOB_ORITB       ------------------------------------------------------------
RPOB_ANAMM       ------------------------------------------------------------
RPOB_ANAPZ       ------------------------------------------------------------
RPOB_EHRRW       ------------------------------------------------------------
RPOB_NEOSM       ------------------------------------------------------------
RPOB_MAGMM       ------------------------------------------------------------
RPOB_ANADE       ------------------------------------------------------------
RPOB_MYXXD       ------------------------------------------------------------
RPOB_SYNFM       ------------------------------------------------------------
RPOB_SYNAS       ------------------------------------------------------------
RPOB_GEOSL       ------------------------------------------------------------
RPOB_PELPD       CMFGAEDIASFDELFRLLLAADNRFSQYVLARLPEDFVKVLRKHEPSQPVAEKLREQLLK
RPOB_PELCD       ------------------------------------------------------------
RPOB_BDEBA       ------------------------------------------------------------
RPOB_DESPS       ------------------------------------------------------------
RPOB_DESVV       ------------------------------------------------------------
RPOB_DESAG       ------------------------------------------------------------
RPOB_LAWIP       ------------------------------------------------------------
RPOB_KORVE       ------------------------------------------------------------
RPOB_SOLUE       ------------------------------------------------------------
RPOB_CAMJJ       ------------------------------------------------------------
RPOB_CAMFF       ------------------------------------------------------------
RPOB_SULDN       ------------------------------------------------------------
RPOB_BACV8       ------------------------------------------------------------
RPOB_PARD8       ------------------------------------------------------------
RPOB_PORGI       ------------------------------------------------------------
RPOB_FLAPJ       ------------------------------------------------------------
RPOB_GRAFK       ------------------------------------------------------------
RPOB_CYTH3       ------------------------------------------------------------
RPOB_SALRD       ------------------------------------------------------------
RPOB_PELLD       ------------------------------------------------------------
RPOB_CHLPD       ------------------------------------------------------------
RPOB_CHLCH       ------------------------------------------------------------
RPOB_CHLTE       ------------------------------------------------------------
RPOB_CHLMU       ------------------------------------------------------------
RPOB_CHLPN       ------------------------------------------------------------
RPOB_PARUW       ------------------------------------------------------------
RPOB_RHOBA       ------------------------------------------------------------
RPOB_TREDE       ------------------------------------------------------------
RPOB_TREPA       ------------------------------------------------------------
RPOB_BORAP       ------------------------------------------------------------
RPOB_LEPBL       KAR---------------------------------------------------------
RPOB_FUSNN       ------------------------------------------------------------
RPOB_CYAM1       ------------------------------------------------------------
RPOB_AQUAE       LKELFKQYK---------------------------------------------------
RPOB_DEIRA       ------------------------------------------------------------
RPOB_DEIGD       ------------------------------------------------------------
RPOB_THET8       ------------------------------------------------------------
RPOB_THEMA       DIVLASRILFDYFERRYVNDFEIDSYELKNLIRIFKEEYLE-------------------
RPOB_BACCR       TILDRRTLDRILPYLEKN---------------IGFKTAKPM------------------
RPOB_BACSU       QILDRRTLDKVLPYLENG---------------IGFRKLYPN------------------
RPOB_BACHD       SIIDRRTLDRILPYLENN---------------VGFRTVRMS------------------
RPOB_GEOTN       TMIDRRTLNRLLPYLEKG---------------AGLQTYRPT------------------
RPOB_OCEIH       EKLERKLLDKILPYLERAEDR------------FGESVLSPH------------------
RPOB_LISIN       DILDRRNLDQIIPNLENG---------------VGFRTLRPT------------------
RPOB_STAS1       TVLDRRNLDEIMDVLEAN----------------ANSEVFEL------------------
RPOB_STRS2       TVLSRDVLEKVEAQFDE----------------LNLVEYIPN------------------
RPOB_LACLA       TLVTRDVLDLIEPLLDNG---------------LGNFVVEPS------------------
RPOB_LACGA       DVVTHEILDKLSPYLDRDD--------------FKMVTYEPS------------------
RPOB_LACAC       TVVTHEIMDKLAPYLDRDD--------------FKMVTYQPS------------------
RPOB_LACDB       TVVNNEVMDVLKDYLDRDD--------------FKTVTYTPS------------------
RPOB_LACPL       TVIDKNVMAKLSPYLERDD--------------FKTVTYTPS------------------
RPOB_LACBA       TVVDKDVMKSLAPFLDQDD--------------FKMVTFQPS------------------
RPOB_PEDPA       EMVNKDVMKKLAVFLDRPD--------------FKMVTYQPS------------------
RPOB_LACS1       EVIDKQVMDKLAPYLARDD--------------FKTFTFHPS------------------
RPOB_LACSS       TVVDRQVMDALAPYLDCED--------------FKAVTYQPS------------------
RPOB_LACP3       TKVDRQVMDKLAPYLDRDD--------------FKTITYQPS------------------
RPOB_ENTFA       TVLTHQIMETLGEYID-NG--------------LNSVTYYPS------------------
RPOB_LEUMM       TLVDKEVISKLTPYLDRED--------------FKTTTYTPS------------------
RPOB_OENOB       TKIDKKSMKLISPLLDEED--------------FHVENLQPD------------------
RPOB_CARHZ       ---HGVLYRYLEEDGEKEYDKYLND-----------------------------------
RPOB_MOOTA       ---HGILTREVDG-----------------------------------------------
RPOB_SYMTH       VQIDKRLAEKIDEAGVDALTVRLRD-----------------------------------
RPOB_DESHY       ------------------------------------------------------------
RPOB_CLOAB       QRISKEKALEIQNSGINSVDISVDD-NIIRVIGNNFVDIKSY------------------
RPOB_CLONN       ETIDREKALEIQNCAINAVNIQVED-KVIKVIGNNFVDIHKF------------------
RPOB_CLOPS       EKISRANAEEIQNRGINSVDVLVED-RVIRIIGNHFVDIHKC------------------
RPOB_CLOTE       EKIDRDKAIEIQNSGINSVDIQLDD-KVLRVIGNNFVDIKSF------------------
RPOB_HUNT2       ETISREKAETIQNAGVNTVILRVDG-KNVKVIGNDMVDIKRY------------------
RPOB_CLOD6       EKISYDLAKAIQNAGINVVNLLMDDDKKVRVIGNNFVDIKSH------------------
RPOB_CALS4       EKITREKAEEIQNCGINEVEILVDG-KVVKVVGNNTVDINKYP-----------------
RPOB_SYNWW       ------------------------------------------------------------
RPOB_ONYPE       ELLTKEKIAILKQNRHFLLQEIFDAKHNLENETDEEILAYKKDPQKNELFTKTNIINSRT
RPOB_COREF       ------------------------------------------------------------
RPOB_CORDI       ------------------------------------------------------------
RPOB_CORJK       ------------------------------------------------------------
RPOB2_NOCFA      ------------------------------------------------------------
RPOB_RHOJR       ------------------------------------------------------------
RPOB_MYCS2       ------------------------------------------------------------
RPOB1_NOCFA      ------------------------------------------------------------
RPOB_SACEN       ------------------------------------------------------------
RPOB_FRAAA       ------------------------------------------------------------
RPOB_STRCO       ------------------------------------------------------------
RPOB_THEFY       ------------------------------------------------------------
RPOB_ACIC1       ------------------------------------------------------------
RPOB_NOCSJ       ------------------------------------------------------------
RPOB_ARTS2       ------------------------------------------------------------
RPOB_LEIXX       ------------------------------------------------------------
RPOB_CUTAK       ------------------------------------------------------------
RPOB_BIFAA       ------------------------------------------------------------
RPOB_TROWT       ------------------------------------------------------------
RPOB_RUBXD       ------------------------------------------------------------
RPOB_DEHMC       ------------------------------------------------------------
RPOB_MYCMS       IKQISEIL----------------------------------------------------
RPOB_MESFL       IKEVSDAL----------------------------------------------------
RPOB_MYCMO       AEKIQDSFKNNIFNL---------------------------------------------
RPOB_MYCPU       AIEIQNAFKEGLIKN---------------------------------------------
RPOB_MYCS5       AKEIQESFEAKAKDNKSNLH----------------------------------------
RPOB_MYCH2       ALEIQEKFNNEEIPL---------------------------------------------
RPOB_CITSI       ------------------------------------------------------------
RPOB_POPTR       ------------------------------------------------------------
RPOB_AETGR       ------------------------------------------------------------
RPOB_OENEH       ------------------------------------------------------------
RPOB_NYMAL       ------------------------------------------------------------
RPOB_PIPCE       ------------------------------------------------------------
RPOB_PHAAO       ------------------------------------------------------------
RPOB_DIOEL       ------------------------------------------------------------
RPOB_PHAVU       ------------------------------------------------------------
RPOB_LOTJA       ------------------------------------------------------------
RPOB_JASNU       ------------------------------------------------------------
RPOB_LACSA       ------------------------------------------------------------
RPOB_SACHY       ------------------------------------------------------------
RPOB_PELHO       ------------------------------------------------------------
RPOB_ANTAG       ------------------------------------------------------------
RPOB_MARPO       ------------------------------------------------------------
RPOB_PHYPA       ------------------------------------------------------------
RPOB_PSINU       ------------------------------------------------------------
RPOB_ANGEV       ------------------------------------------------------------
RPOB_PINTH       ------------------------------------------------------------
RPOB_CYCTA       ------------------------------------------------------------
RPOB_ADICA       ------------------------------------------------------------
RPOB_HUPLU       ------------------------------------------------------------
RPOB_CHAGL       ------------------------------------------------------------
RPOB_CHAVU       ------------------------------------------------------------
RPOB_STAPU       ------------------------------------------------------------
RPOB_ZYGCR       ------------------------------------------------------------
RPOB_NEPOL       ------------------------------------------------------------
RPOB_OSTTA       ------------------------------------------------------------
RPOB_MESVI       ------------------------------------------------------------
RPOB_CHLAT       ------------------------------------------------------------
RPOB_OLTVI       ------------------------------------------------------------
RPOB_BIGNA       ------------------------------------------------------------
RPOB_PHATC       ------------------------------------------------------------
RPOB_THAPS       ------------------------------------------------------------
RPOB_TRIV2       ------------------------------------------------------------
RPOB_TRIEI       ------------------------------------------------------------
RPOB_SYNY3       ------------------------------------------------------------
RPOB_SYNE7       ------------------------------------------------------------
RPOB_THEEB       ------------------------------------------------------------
RPOB_SYNJA       ------------------------------------------------------------
RPOB_GLOVI       ------------------------------------------------------------
RPOB_PROM5       ------------------------------------------------------------
RPOB_GUITH       ------------------------------------------------------------
RPOB_RHDSA       ------------------------------------------------------------
RPOB_PYRYE       ------------------------------------------------------------
RPOB_GRATL       ------------------------------------------------------------
RPOB_CYAPA       ------------------------------------------------------------
RPOB_CYACA       ------------------------------------------------------------
RPOB_EMIHU       ------------------------------------------------------------
RPOB_EUGLO       ------------------------------------------------------------
                                                                             

RPOB_MYCGE       -------------------------------------------------------ISFVN
RPOB_MYCPN       -------------------------------------------------------IDFVQ
RPOB_MYCGA       -------------------------------------------------------LDIIK
RPOB_MYCPE       -------------------------------------------------------LGIVH
RPOB_UREPA       -------------------------------------------------------IKWTK
RPOB_ALKEH       ------------------------------------------------------------
RPOB_HALHL       ------------------------------------------------------------
RPOB_METCA       ------------------------------------------------------------
RPOB_XANC8       ------------------------------------------------------------
RPOB_XYLFT       ------------------------------------------------------------
RPOB_LEGPA       ------------------------------------------------------------
RPOB_COXBU       ------------------------------------------------------------
RPOB_NITOC       ------------------------------------------------------------
RPOB_AROAE       ------------------------------------------------------------
RPOB_AZOSB       ------------------------------------------------------------
RPOB_METFK       ------------------------------------------------------------
RPOB_NITEC       ------------------------------------------------------------
RPOB_NITMU       ------------------------------------------------------------
RPOB_THIDA       ------------------------------------------------------------
RPOB_DECAR       ------------------------------------------------------------
RPOB_PARXL       ------------------------------------------------------------
RPOB_HERAR       ------------------------------------------------------------
RPOB_RALSO       ------------------------------------------------------------
RPOB_BORA1       ------------------------------------------------------------
RPOB_RHOFT       ------------------------------------------------------------
RPOB_POLSJ       ------------------------------------------------------------
RPOB_VEREI       ------------------------------------------------------------
RPOB_METPP       ------------------------------------------------------------
RPOB_NEIG1       ------------------------------------------------------------
RPOB_CHRVO       ------------------------------------------------------------
RPOB_ACIBT       ------------------------------------------------------------
RPOB_PSYCK       ------------------------------------------------------------
RPOB_HAHCH       ------------------------------------------------------------
RPOB_MARHV       ------------------------------------------------------------
RPOB_SACD2       ------------------------------------------------------------
RPOB_PSEU5       ------------------------------------------------------------
RPOB_CHRSD       ------------------------------------------------------------
RPOB_ALCBS       ------------------------------------------------------------
RPOB_SODGM       ------------------------------------------------------------
RPOB_ECOLI       ------------------------------------------------------------
RPOB_BAUCH       ------------------------------------------------------------
RPOB_BLOFL       ------------------------------------------------------------
RPOB_BLOPB       ------------------------------------------------------------
RPOB_BUCAI       ------------------------------------------------------------
RPOB_BUCAP       ------------------------------------------------------------
RPOB_BUCBP       ------------------------------------------------------------
RPOB_WIGBR       ------------------------------------------------------------
RPOB_BUCCC       ------------------------------------------------------------
RPOB_ACTP2       ------------------------------------------------------------
RPOB_MANSM       ------------------------------------------------------------
RPOB_HAEI8       ------------------------------------------------------------
RPOB_ALIF1       ------------------------------------------------------------
RPOB_PHOPR       ------------------------------------------------------------
RPOB_VIBCH       ------------------------------------------------------------
RPOB_AERS4       ------------------------------------------------------------
RPOB_COLP3       ------------------------------------------------------------
RPOB_PSEA6       ------------------------------------------------------------
RPOB_PSEHT       ------------------------------------------------------------
RPOB_SHEAM       ------------------------------------------------------------
RPOB_IDILO       ------------------------------------------------------------
RPOB_PSYIN       ------------------------------------------------------------
RPOB_DICNV       ------------------------------------------------------------
RPOB_HYDCU       ------------------------------------------------------------
RPOB_VESOH       ------------------------------------------------------------
RPOB_FRATO       ------------------------------------------------------------
RPOB_RHIL3       ------------------------------------------------------------
RPOB_RHIME       ------------------------------------------------------------
RPOB_AGRFC       ------------------------------------------------------------
RPOB_RHILO       ------------------------------------------------------------
RPOB_CHESB       ------------------------------------------------------------
RPOB_BRUSU       ------------------------------------------------------------
RPOB_BARBK       ------------------------------------------------------------
RPOB_RHOPB       ------------------------------------------------------------
RPOB_GLUOX       ------------------------------------------------------------
RPOB_GRABC       ------------------------------------------------------------
RPOB_MAGSA       ------------------------------------------------------------
RPOB_RHORT       ------------------------------------------------------------
RPOB_CAUVC       ------------------------------------------------------------
RPOB_MARMM       ------------------------------------------------------------
RPOB_HYPNA       ------------------------------------------------------------
RPOB_RHOS1       ------------------------------------------------------------
RPOB_PARDP       ------------------------------------------------------------
RPOB_ROSDO       ------------------------------------------------------------
RPOB_JANSC       ------------------------------------------------------------
RPOB_NOVAD       ------------------------------------------------------------
RPOB_ERYLH       ------------------------------------------------------------
RPOB_SPHAL       ------------------------------------------------------------
RPOB_ZYMMO       ------------------------------------------------------------
RPOB_PELUB       ------------------------------------------------------------
RPOB_RICBR       ------------------------------------------------------------
RPOB_ORITB       ------------------------------------------------------------
RPOB_ANAMM       ------------------------------------------------------------
RPOB_ANAPZ       ------------------------------------------------------------
RPOB_EHRRW       ------------------------------------------------------------
RPOB_NEOSM       ------------------------------------------------------------
RPOB_MAGMM       ------------------------------------------------------------
RPOB_ANADE       ------------------------------------------------------------
RPOB_MYXXD       ------------------------------------------------------------
RPOB_SYNFM       ------------------------------------------------------------
RPOB_SYNAS       ------------------------------------------------------------
RPOB_GEOSL       ------------------------------------------------------------
RPOB_PELPD       ELNNLVKDPDFYQKELFTGLALSQQTVALTEAIEG--------------------GVFEE
RPOB_PELCD       ------------------------------------------------------------
RPOB_BDEBA       ------------------------------------------------------------
RPOB_DESPS       ------------------------------------------------------------
RPOB_DESVV       ------------------------------------------------------------
RPOB_DESAG       ------------------------------------------------------------
RPOB_LAWIP       ------------------------------------------------------------
RPOB_KORVE       ------------------------------------------------------------
RPOB_SOLUE       ------------------------------------------------------------
RPOB_CAMJJ       ------------------------------------------------------------
RPOB_CAMFF       ------------------------------------------------------------
RPOB_SULDN       ------------------------------------------------------------
RPOB_BACV8       ------------------------------------------------------------
RPOB_PARD8       ------------------------------------------------------------
RPOB_PORGI       ------------------------------------------------------------
RPOB_FLAPJ       ------------------------------------------------------------
RPOB_GRAFK       ------------------------------------------------------------
RPOB_CYTH3       ------------------------------------------------------------
RPOB_SALRD       ------------------------------------------------------------
RPOB_PELLD       ------------------------------------------------------------
RPOB_CHLPD       ------------------------------------------------------------
RPOB_CHLCH       ------------------------------------------------------------
RPOB_CHLTE       ------------------------------------------------------------
RPOB_CHLMU       ------------------------------------------------------------
RPOB_CHLPN       ------------------------------------------------------------
RPOB_PARUW       ------------------------------------------------------------
RPOB_RHOBA       ------------------------------------------------------------
RPOB_TREDE       ------------------------------------------------------------
RPOB_TREPA       ------------------------------------------------------------
RPOB_BORAP       ------------------------------------------------------------
RPOB_LEPBL       ------------------------------------------------------------
RPOB_FUSNN       ------------------------------------------------------------
RPOB_CYAM1       ------------------------------------------------------------
RPOB_AQUAE       ------------------------------------------------------------
RPOB_DEIRA       ------------------------------------------------------------
RPOB_DEIGD       ------------------------------------------------------------
RPOB_THET8       ------------------------------------------------------------
RPOB_THEMA       ------------------------------------------------------------
RPOB_BACCR       -----------------------------------------GGVVE-GDVELQSIKIYAP
RPOB_BACSU       -----------------------------------------GGVVE-DEVTLQSIKIFAP
RPOB_BACHD       -----------------------------------------GGVVEEDEVRLQSVKIYAP
RPOB_GEOTN       -----------------------------------------EGVAD-GQISVQTVKIYAP
RPOB_OCEIH       -----------------------------------------EGVLE-DEITIQSVKIIDP
RPOB_LISIN       -----------------------------------------DGVME-DSVLVQSIKIYAP
RPOB_STAS1       -----------------------------------------EGTVIDEPVEIQSIKVYVP
RPOB_STRS2       -----------------------------------------DNAVLLEPVLLQKFKIVAP
RPOB_LACLA       -----------------------------------------DDAVIPEPITLQSIKVYSP
RPOB_LACGA       -----------------------------------------KEGVLPDPVTVQEIKVYSK
RPOB_LACAC       -----------------------------------------KEGVLPDPITVQEIKVYSK
RPOB_LACDB       -----------------------------------------DEGVIPEPVTVQEIKVFSR
RPOB_LACPL       -----------------------------------------DEAVVTNPMVLQVVKVYSQ
RPOB_LACBA       -----------------------------------------DEAVVTEPLKLQIIKVQSP
RPOB_PEDPA       -----------------------------------------EEAVVTEPMTIQVIKVQDP
RPOB_LACS1       -----------------------------------------EEGVVQEPMTLQIVKVYSP
RPOB_LACSS       -----------------------------------------DEGVLPEPMTLQVIKVYSQ
RPOB_LACP3       -----------------------------------------DQGVVTDPIELQSIKVYSQ
RPOB_ENTFA       -----------------------------------------EDAVVTEPMTIQVIQVLSP
RPOB_LEUMM       -----------------------------------------GDAVLEEPVTLQKIKIESP
RPOB_OENOB       -----------------------------------------EEGVLPDPIKVQTIKIFSQ
RPOB_CARHZ       ------------------------------------------------------------
RPOB_MOOTA       ------------------------------------------------------------
RPOB_SYMTH       ------------------------------------------------------------
RPOB_DESHY       ------------------------------------------------------------
RPOB_CLOAB       ------------------------------------IKFDISDLNIRELVYYPVLKEILE
RPOB_CLONN       ------------------------------------IDFDISDLKIKEHVHYPTLKNILD
RPOB_CLOPS       ------------------------------------VDFDISDLNIRELVHYPTLREILD
RPOB_CLOTE       ------------------------------------VKFDIDDLNIKEYVHYPTLKEILD
RPOB_HUNT2       ------------------------------------VDFDPKEIGINEKVKRDVLMEILE
RPOB_CLOD6       ------------------------------------IDFDIDDLNIKEKVHYPTLKEILD
RPOB_CALS4       ------------------------------------MPYDVSSLNIKELVNVRVLREILD
RPOB_SYNWW       ------------------------------------------------------------
RPOB_ONYPE       GEVLVAKDTLVNDDIINHLRHNIHTLDEKVSKFFLGTKDIYQKEADRQGVFNEILEVYTS
RPOB_COREF       ------------------------------------------------------------
RPOB_CORDI       ------------------------------------------------------------
RPOB_CORJK       ------------------------------------------------------------
RPOB2_NOCFA      ------------------------------------------------------------
RPOB_RHOJR       ------------------------------------------------------------
RPOB_MYCS2       ------------------------------------------------------------
RPOB1_NOCFA      ------------------------------------------------------------
RPOB_SACEN       ------------------------------------------------------------
RPOB_FRAAA       ------------------------------------------------------------
RPOB_STRCO       ------------------------------------------------------------
RPOB_THEFY       ------------------------------------------------------------
RPOB_ACIC1       ------------------------------------------------------------
RPOB_NOCSJ       ------------------------------------------------------------
RPOB_ARTS2       ------------------------------------------------------------
RPOB_LEIXX       ------------------------------------------------------------
RPOB_CUTAK       ------------------------------------------------------------
RPOB_BIFAA       ------------------------------------------------------------
RPOB_TROWT       ------------------------------------------------------------
RPOB_RUBXD       ------------------------------------------------------------
RPOB_DEHMC       ------------------------------------------------------------
RPOB_MYCMS       -----------------------------DQD-VMSIDLN--YLSDIPGTRKVQKIKVYK
RPOB_MESFL       -----------------------------SQDGVMVSSIE--YREDIPGSRQIQKVKVYQ
RPOB_MYCMO       ----------------------IPIPD--VSSDIYAAQLE--TNPKLAERIRVISLNIYP
RPOB_MYCPU       ----------------------IDLKDYGITSDVYGKLLD--TNPKLKNRMNIIGIYIFK
RPOB_MYCS5       ----------------------LEKIPNINPDDVYYKINK--DNKSLNKRINIARIKIWP
RPOB_MYCH2       ------------------------SEIEGVDSTIYARQLEITRNENLWKRFYVAIVKVWP
RPOB_CITSI       ------------------------------------------------------------
RPOB_POPTR       ------------------------------------------------------------
RPOB_AETGR       ------------------------------------------------------------
RPOB_OENEH       ------------------------------------------------------------
RPOB_NYMAL       ------------------------------------------------------------
RPOB_PIPCE       ------------------------------------------------------------
RPOB_PHAAO       ------------------------------------------------------------
RPOB_DIOEL       ------------------------------------------------------------
RPOB_PHAVU       ------------------------------------------------------------
RPOB_LOTJA       ------------------------------------------------------------
RPOB_JASNU       ------------------------------------------------------------
RPOB_LACSA       ------------------------------------------------------------
RPOB_SACHY       ------------------------------------------------------------
RPOB_PELHO       ------------------------------------------------------------
RPOB_ANTAG       ------------------------------------------------------------
RPOB_MARPO       ------------------------------------------------------------
RPOB_PHYPA       ------------------------------------------------------------
RPOB_PSINU       ------------------------------------------------------------
RPOB_ANGEV       ------------------------------------------------------------
RPOB_PINTH       ------------------------------------------------------------
RPOB_CYCTA       ------------------------------------------------------------
RPOB_ADICA       ------------------------------------------------------------
RPOB_HUPLU       ------------------------------------------------------------
RPOB_CHAGL       ------------------------------------------------------------
RPOB_CHAVU       ------------------------------------------------------------
RPOB_STAPU       ------------------------------------------------------------
RPOB_ZYGCR       ------------------------------------------------------------
RPOB_NEPOL       ------------------------------------------------------------
RPOB_OSTTA       ------------------------------------------------------------
RPOB_MESVI       ------------------------------------------------------------
RPOB_CHLAT       ------------------------------------------------------------
RPOB_OLTVI       ------------------------------------------------------------
RPOB_BIGNA       ------------------------------------------------------------
RPOB_PHATC       ------------------------------------------------------------
RPOB_THAPS       ------------------------------------------------------------
RPOB_TRIV2       ------------------------------------------------------------
RPOB_TRIEI       ------------------------------------------------------------
RPOB_SYNY3       ------------------------------------------------------------
RPOB_SYNE7       ------------------------------------------------------------
RPOB_THEEB       ------------------------------------------------------------
RPOB_SYNJA       ------------------------------------------------------------
RPOB_GLOVI       ------------------------------------------------------------
RPOB_PROM5       ------------------------------------------------------------
RPOB_GUITH       ------------------------------------------------------------
RPOB_RHDSA       ------------------------------------------------------------
RPOB_PYRYE       ------------------------------------------------------------
RPOB_GRATL       ------------------------------------------------------------
RPOB_CYAPA       ------------------------------------------------------------
RPOB_CYACA       ------------------------------------------------------------
RPOB_EMIHU       ------------------------------------------------------------
RPOB_EUGLO       ------------------------------------------------------------
                                                                             

RPOB_MYCGE       KMQLTTDGKAVDLAKESLFYETIDVYITNDNLSVSVPVIGIHNENDLNKAMTLSDFIASI
RPOB_MYCPN       KIKLTTDGSAVNLSPESLLYESLDVYVNNDNFDVSVPVVGIHNDNDLNKAITLSDFIASI
RPOB_MYCGA       QIDFINPELNTQFT-DVNTYEEVQIYVNNDLRNETTQIIGIDGSNESIETLTLADLISIV
RPOB_MYCPE       NVNL---DERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLD-KPTLSISDILSIT
RPOB_UREPA       KINLLPTALESEIE-QFLEYESIAVYKDNDLRDETTEIVGLASGCK-LQTLTVADLVATT
RPOB_ALKEH       ----------------------------DDILAVLRELINIRNGD----------GQV--
RPOB_HALHL       -----------GNADKEADDLIEQYGESSDILDVLRELIDIRNGN----------GQV--
RPOB_METCA       ----------------------------DDIIAVLKELINIRNGG----------GTV--
RPOB_XANC8       -----------ERNDEESKRLVAEHADTSDILEVIKVLTEIRNGR----------GVV--
RPOB_XYLFT       -----------DRNDEESRRLVSKLGETSDILDVIKGLCEIRNGR----------GVV--
RPOB_LEGPA       ----------------------------EDILSVIKTLIDIRNGI----------GMV--
RPOB_COXBU       ----------------------------EDIVDVLRVLVDIRDGK----------GDV--
RPOB_NITOC       ----------------------------EDIVDVIKTLVDIRNGY----------GSV--
RPOB_AROAE       ----------------------------EDILAVIGVLVELRNGR----------GEI--
RPOB_AZOSB       ----------------------------EDILAVIGVLVELRNGR----------GEI--
RPOB_METFK       ----------------------------DDILAVIAVLIELRNGR----------GEI--
RPOB_NITEC       ----------------------------EDITDVIKILVGLRNGR----------GEI--
RPOB_NITMU       ----------------------------EDIIAVIRILVELRNGR----------GEI--
RPOB_THIDA       ----------------------------EDIVAVIKILVELRNGR----------GEI--
RPOB_DECAR       ----------------------------RDIVEVIKILVELRNGR----------GEI--
RPOB_PARXL       ----------------------------DDILATIKILVELRNGK----------GEV--
RPOB_HERAR       ----------------------------EDVLAVIKILVELRNGR----------GEV--
RPOB_RALSO       ----------------------------DDILDTIKLLVNLRNGK----------GEV--
RPOB_BORA1       ----------------------------EDILETIKVLVELRNGR----------GQI--
RPOB_RHOFT       ----------------------------EDILAVVKILVDLRNGR----------GDV--
RPOB_POLSJ       ----------------------------EDILAVVKILVDLRNGN----------GEV--
RPOB_VEREI       ----------------------------EDILAVVKILVDLRNGN----------GEV--
RPOB_METPP       ----------------------------DDILDVVKILVELRNGR----------GEV--
RPOB_NEIG1       ----------------------------EDIVASIATLVELRNGH----------GEV--
RPOB_CHRVO       ----------------------------EDIVSVIAILTELRNGR----------GEV--
RPOB_ACIBT       ---------------------VEGILSHEDIIDVLRTLVEIRNGK----------GEV--
RPOB_PSYCK       ---------------------ERSVLTNADIVNVLKELIEIRNGR----------GEV--
RPOB_HAHCH       ----------------------------SDIIDVLRTLIDIRNGK----------GVV--
RPOB_MARHV       ----------------------------DDIIDVLKTLIAIRNGQ----------GQV--
RPOB_SACD2       ----------------------------EDIVDVLKTLIDIRNGK----------GVV--
RPOB_PSEU5       ----------------------------EDIVAVLKTLVDIRNGK----------GIV--
RPOB_CHRSD       ----------------------------QDILDVMRELINIRNGF----------GEV--
RPOB_ALCBS       -----------RSDEEGKQYFEQMGGETSDIIDVLRTLVDIRNGN----------GVV--
RPOB_SODGM       ----------------------------DDIIEVMKKLIDIRNGK----------GEV--
RPOB_ECOLI       ----------------------------DDIIDVMKKLIDIRNGK----------GEV--
RPOB_BAUCH       ----------------------------SDIIEVMKKLIDIRNGK----------GEV--
RPOB_BLOFL       ----------------------------NDIIDVIKKLIDIRNGK----------GDV--
RPOB_BLOPB       ----------------------------DDIVDVIKKLIDIRNGK----------GEV--
RPOB_BUCAI       ----------------------------EDIIDVIKKIIDIRNGK----------GEV--
RPOB_BUCAP       ----------------------------EDIIDVIKKLIDIRNGK----------GEV--
RPOB_BUCBP       ----------------------------SDIISVIKKLIDIRNGH----------GEI--
RPOB_WIGBR       ----------------------------FDIIEVTKKLIDIRNGK----------GDV--
RPOB_BUCCC       ----------------------------EDIIDVIKKLINIKNGK----------GEI--
RPOB_ACTP2       ----------------------------DDITGVMKKLIEIRNGR----------GEV--
RPOB_MANSM       ----------------------------EDIVGVMKKLIDIRNGR----------GEV--
RPOB_HAEI8       ----------------------------EDIIAVMRKLIDIRNGR----------GEV--
RPOB_ALIF1       ----------------------------TDIIEVMRKLIDIRNGIG--------------
RPOB_PHOPR       ----------------------------SDIIEVMKKLIEIRNGR----------GEV--
RPOB_VIBCH       ----------------------------VDIIEVMKKLISIRNGK----------GEV--
RPOB_AERS4       ----------------------------DDIVEVMKRLIDIRNGN----------DEV--
RPOB_COLP3       ----------------------------EDIISVMKTLIGIRDGK----------GEV--
RPOB_PSEA6       ----------------------------DDIVDVMKQLITIRDGK----------DDV--
RPOB_PSEHT       ----------------------------EDIVSVMKVLIAIRNGV----------GDV--
RPOB_SHEAM       ----------------------------DDIVAVMKKIIEIRNGN----------DEV--
RPOB_IDILO       ----------------------------EDIVEVMKKLIEIRNGL----------DEV--
RPOB_PSYIN       ----------------------------DDILSVMKTLIAIRNGD----------GIV--
RPOB_DICNV       ----------------------------EDIIGVVKKLIAIKDGF----------GST--
RPOB_HYDCU       ----------------------------QDVVDVVKELLNIRNGL----------STI--
RPOB_VESOH       ----------------------------DDIIRVIKLLINIKDGN----------DSV--
RPOB_FRATO       ----------------------------SDIVGVIEELINIRDGK----------GKV--
RPOB_RHIL3       ----------------------------DDILAVVRMLVELRDGK----------GEI--
RPOB_RHIME       ----------------------------EDILAVVKMLVELRDGK----------GEI--
RPOB_AGRFC       ----------------------------EDILAVVKMLVELRDGK----------GEI--
RPOB_RHILO       ----------------------------EDILAVVKTLVELRDGK----------GEI--
RPOB_CHESB       ----------------------------EDMVAVVRTLVELRDGK----------GEI--
RPOB_BRUSU       ----------------------------EDILAVVKMLVELRDGR----------GEI--
RPOB_BARBK       ----------------------------EDIIGVVKMLVELRDGR----------GEI--
RPOB_RHOPB       ----------------------------EDILAVIKTLVGLRDGR----------GEI--
RPOB_GLUOX       ----------------------------EDILRTIKIMCELKDGR----------GQI--
RPOB_GRABC       ----------------------------EDILRTVKILCDLKDGR----------GAI--
RPOB_MAGSA       ----------------------------EDILGVIKVLVELKDGK----------GEI--
RPOB_RHORT       ----------------------------EDVLHIIRQLVELKDGK----------GEI--
RPOB_CAUVC       ----------------------------EDVLAVLKVLVGLRDGR----------GEI--
RPOB_MARMM       ----------------------------EDILAVLKTLVGLRDGR----------GEI--
RPOB_HYPNA       ----------------------------EDIIGVMKVILDLKDGK----------GEV--
RPOB_RHOS1       ----------------------------DDIIACIKALTELRDGK----------GEI--
RPOB_PARDP       ----------------------------EDIIACIRGLVELRDGK----------GEI--
RPOB_ROSDO       ----------------------------EDIVACIKALVDLRDGR----------GDI--
RPOB_JANSC       ----------------------------EDIISCIKALVELRDGR----------GDI--
RPOB_NOVAD       ----------------------------DDILAVVKELVNLKDGK----------GEV--
RPOB_ERYLH       ----------------------------EDILAVVKELVGLKDGK----------GDV--
RPOB_SPHAL       ----------------------------EDILAVVKELVNLKDGK----------GEI--
RPOB_ZYMMO       ----------------------------EDILAVVKTLVDLKDGK----------GEV--
RPOB_PELUB       ----------------------------DDIIAIVHKMLDLRDGK----------DEV--
RPOB_RICBR       ----------------------------DDIKNILRVLVELKDRK----------GII--
RPOB_ORITB       ----------------------------EDIKKIIKLLVDIKDGK----------ALV--
RPOB_ANAMM       ----------------------------EDIVQVVKKLVLLRDGE----------GVV--
RPOB_ANAPZ       ----------------------------DDIVHVIKKLVLLPDGE----------GVV--
RPOB_EHRRW       ----------------------------DDIIHVIKKLVLLRDGE----------GFV--
RPOB_NEOSM       ----------------------------EDIFCTVKELALLQREV----------GDV--
RPOB_MAGMM       ----------------------------DDILGVVDILLKLKDGH----------GKV--
RPOB_ANADE       ---------------------------KRDILEVVRFLIDLKNGKP--------NKDV--
RPOB_MYXXD       ---------------------------KRDILEVIRYLIDLKNGK----------GTI--
RPOB_SYNFM       ---------------------------KDDILMAVRQLIRLKDSQ----------GPV--
RPOB_SYNAS       ---------------------------KEDIMAAVKYLIDLKNGVP--------ECSV--
RPOB_GEOSL       ---------------------------KDDVLEVVRYLIDLKNGK----------GTI--
RPOB_PELPD       NRRVIEVLRRNRMIFEDLYAPVVLTSPKNDILEIVRYLIDLKNGR----------GAI--
RPOB_PELCD       ---------------------------KDDILEVVRYLIGLRDGR----------GTI--
RPOB_BDEBA       ---------------------------HKDILSTIKTLIDLKNGR----------GVI--
RPOB_DESPS       ---------------------------RDDIIYGVRYLVRLKDNQ----------GGI--
RPOB_DESVV       ----------------------------DDILRAIRVLLHLKDSH----------GPA--
RPOB_DESAG       ----------------------------EDILTAIRVLNHLKDTH----------GPA--
RPOB_LAWIP       ----------------------------NDILEAIKLLTHLKDSH----------GPA--
RPOB_KORVE       ----------------------------DDFYHTIRYLLKLRRNL----------GAV--
RPOB_SOLUE       ----------------------------DDFKSTIRYLLKLRKGI----------GAV--
RPOB_CAMJJ       ----------------------------EDIIKTAKYLIKVKNGK----------GHI--
RPOB_CAMFF       ----------------------------EDIIKTAKYLIKVKNGQ----------GYI--
RPOB_SULDN       ----------------------------EDIIESVKYVIKVKNGQ----------GHI--
RPOB_BACV8       ----------------------------QDIIEIIKYLIELINS----------KADV--
RPOB_PARD8       ----------------------------EDIIEIIKYLIELINS----------KAIV--
RPOB_PORGI       ----------------------------EDIIEIIKYLIELVNS----------KASV--
RPOB_FLAPJ       ----------------------------EDIITIVKYLIELINA----------KADI--
RPOB_GRAFK       ----------------------------LDIITIVKYLIELINS----------KAEI--
RPOB_CYTH3       ----------------------------EDIINIVKYLIGLINS----------RAVV--
RPOB_SALRD       ----------------------------EDVVGIVRELIRLQNG----------ESTA--
RPOB_PELLD       ----------------------------LDIIAVINYLIKLVNG----------QAEV--
RPOB_CHLPD       ----------------------------YDIIAVIYYLIKLVNG----------QAEV--
RPOB_CHLCH       ----------------------------YDIIAVIYYLIKLVNG----------QAEV--
RPOB_CHLTE       ----------------------------YDIIAVINYLIKLING----------MAEV--
RPOB_CHLMU       ----------------------------EDVIGALKYLIRLRMGDE--------KTSI--
RPOB_CHLPN       ----------------------------EDVIGALKYLIRLKMGDE--------KACV--
RPOB_PARUW       ----------------------------EDVIGALKYLIMLKSGSE--------EASI--
RPOB_RHOBA       ----------------------------DDMIAAIRYLIDLFDADS--------GAEI--
RPOB_TREDE       ------------------------TLIEEDIFKTMKFLIKVYIGEE--------SI----
RPOB_TREPA       ------------------------TLTLDDIVNTMKFLIRMYSGDA--------QE----
RPOB_BORAP       ------------------------VLTMDDIVNTISHLLRIYEGHD--------IL----
RPOB_LEPBL       ------------------------VLRPADIIETVRYILNLFSETE--------NYYP--
RPOB_FUSNN       ------------------------SLTKEDVLGTIKYVIELNNGEQ--------NVHT--
RPOB_CYAM1       ------------------------ILTTSDLLAGLDYLIQLCLDRA--------RV----
RPOB_AQUAE       -----------EIKVKDYTEDEARFILPIDLVNILKYLIDLRHGR----------VKK--
RPOB_DEIRA       ------------------------KFSDAGLVDTIRYLMALQQGLE--------TVPM-V
RPOB_DEIGD       ------------------------RFGDAGLVDTIRYLMALQQGLE--------TVTMGA
RPOB_THET8       ------------------------EFKDEVFLPTLRYLFALTAGVP--------GHEV--
RPOB_THEMA       -------------------KRKTAPYDLRKLVSVFRRNYGVTSDLGV-------FAAIRY
RPOB_BACCR       ES-E--GERVINVIGNANITRDVKHITPGDILASISYFFNLLYKVG--------------
RPOB_BACSU       TDQE--GEQVINVIGNAYIEEEIKNITPADIISSISYFFNLLHGVG--------------
RPOB_BACHD       DDQD--GEHVIRVIGNGLVEKEIKHITPADIIASINYFFNLLHSVG--------------
RPOB_GEOTN       NDPD--NEKVINIIGNGFIAEDVKHITPADIIASISYFFNLLHGVG--------------
RPOB_OCEIH       TDPN--GERELTVIGNGGVTNDVKNITPADILSSISYFFNLLHEVG--------------
RPOB_LISIN       ND----DEKEINIIGNAYIEENVKHITPSDIISSISYFFNLLHGVG--------------
RPOB_STAS1       ND-E--EGRTTTVIGNAFPDSEVKCITPADIIASMSYFFNLLSGIG--------------
RPOB_STRS2       KD----PERVVTVIGNANPAENVRTVTPADILAEMSYFLNLAEGLG--------------
RPOB_LACLA       KD----PERVVTLLSNGNPDAECRVLTPADVISNISYWLGLAEGIG--------------
RPOB_LACGA       VD----PERVIKLMSNGHIADDVKHLTPADVLASINYFFNLQDNIG--------------
RPOB_LACAC       VD----PEREVKLMSNGHIDADVKHLTPADVLASINYFFALQDKIG--------------
RPOB_LACDB       EI----PDREIKLISNGHIAEDVKCITPADIIASVNYFLELQEGVG--------------
RPOB_LACPL       ND----PEKVVNVIGNGNIDLKFKHIVPADIIASINYFFNLQEGLG--------------
RPOB_LACBA       DD----PEQEVPVIGNGNIDIKLKHIRPADIIASMNYFFDLQLGIG--------------
RPOB_PEDPA       ND----PERTLNMIGNGNIDAKLKHITPADIIASMNYFFLLQDGIG--------------
RPOB_LACS1       KD----PEKVVNVIGNANVDIQFKHITPADIVASMNYFFNLQEGMG--------------
RPOB_LACSS       KT----PDKEINLIGNGHIDAKVKHVIPADIIASMNYFFNLQEGLG--------------
RPOB_LACP3       VT----PDKEINLIGNGHIGKKVKHIVPADVLASMNYFLNLQEGLG--------------
RPOB_ENTFA       KD----PERIVNVIGNGYPDDSVKTVRPADIVASMSYFFNLMEDIG--------------
RPOB_LEUMM       EN----PEKTLLLIGNGHIDEDDRTVRPADILAGMNYFLNLQEGVG--------------
RPOB_OENOB       VD----PTKVIKLIGNGHIDESIHHILPADIIAGMNYFFNLQEGVG--------------
RPOB_CARHZ       --------------YVPVKREFIRELTNEDIIYTIRYLLGLMRGQG--------------
RPOB_MOOTA       ------------------REEYIRTLTKEDIIYTIKYLLRLMDGEV--------------
RPOB_SYMTH       -------GGIVRVVANGRPDIRVKTIVRQDIVAVINYMVSLFKGLG--------------
RPOB_DESHY       -----------------SVPTDVHHLTKEDIVASLRQMLTLMSGEG--------------
RPOB_CLOAB       NYTD--EEAIKEQLKKNVHKLVPKHIIKDDMFATVSYELGLAYGIG--------------
RPOB_CLONN       NYTD--EKSIKEEIKKNIHELIPKHIVVDDIYATISYELGLPYEIG--------------
RPOB_CLOPS       NYSD--EETIKEEIKKNMTRLIPKHIIKDDIFATISYQIGLAYNIG--------------
RPOB_CLOTE       NYSD--EEMIKEQIKKNINVLIPKHIIRDDIMSTISYEIGLPYGIG--------------
RPOB_HUNT2       EYKGKGDDAIKKALQERIDDLIPKHITKEDIISSISYIIGLSYGIG--------------
RPOB_CLOD6       GYSD--EEEIKEAIKSRIKELIPKHILLDDIIASISYEFNIFYNIG--------------
RPOB_CALS4       NFSD--EEAVLNEIKNRMDELVPKHITKDDIVATISYQLNLTHGVG--------------
RPOB_SYNWW       --------------------PENRHLTLEDITATIGYLLKLIKGEG--------------
RPOB_ONYPE       KDESGKLYHKVKLIGND-QRETKKHITLSDVIASINYYLNLYENVG--------------
RPOB_COREF       ----------------------LMTLTEEDIATAIEYLVRLHAGERV-------MTSPT-
RPOB_CORDI       ----------------------LMTLTEEDIATTLEYLVRLHAGETT-------MTSPT-
RPOB_CORJK       ----------------------VMTLTEEDILTTIEYLVRLHAGEKS-------MTSPD-
RPOB2_NOCFA      ----------------------GSVLTKEDIVTTIEYLVRLHAGDKT-------MTAPG-
RPOB_RHOJR       ----------------------ASTLTEEDIVATIEYLVRLHAGDTE-------MTAPG-
RPOB_MYCS2       ----------------------SSTLTEEDVVATIEYLVRLHEGQTS-------MTVPG-
RPOB1_NOCFA      ----------------------PRVLTEDDIAATIEYLVRLHAGERT-------MIAPG-
RPOB_SACEN       ----------------------SGVLTEEDIVTTIEYLVRLHAGEAE-------MPDRGQ
RPOB_FRAAA       -----------------------GVLTEDDIVRTIEYVVKLHAGADP-------AE----
RPOB_STRCO       -----------------------GVLTTDDVIATIKYLVKLHAGETE-------TVGESG
RPOB_THEFY       -----------------------GTLTEEDIVATVDYLVRLHAGEKE-------LVRPHG
RPOB_ACIC1       -----------------------NTLTEEDIVATIDYLVRLHAGQTE-------TTR-NG
RPOB_NOCSJ       -----------------------QTLTIDDVVAAIKYIVALHDGREQ-------IEAPQG
RPOB_ARTS2       ----------------------ASVLHVEDIVAMIKFLVALHAGEKT-------LTGKRD
RPOB_LEIXX       -----------------------SVLTVQDIIATIKYLVSLHDGQTS-------FTGLRS
RPOB_CUTAK       -----------------------QVLTVDDIVAAIHFVCALHEGTAI-------LPREGQ
RPOB_BIFAA       ------------------------SLSREDIIATIKYLVTLHAGETK-------FPGKRD
RPOB_TROWT       ------------------------VLTRSDIIATIRYLAALHLGFSE-------VAVLNS
RPOB_RUBXD       ------------------------TLTIEDIEGLLRRLLGIAEEVAE-------EEEFGR
RPOB_DEHMC       ----------------------NRALTREDIVAIIQRIIMVNNGQ---------------
RPOB_MYCMS       DS---ELKTDTTCLIGLTSSSNEEFITVADILSTVSYLLNLKYNIG--------------
RPOB_MESFL       DN---NSKDETFTIVGITPNSKEEHITVVDIVATVSYLLGLEYNIG--------------
RPOB_MYCMO       NKTWMEQNTNPIIVIANDPNSTELHLLASDLVAIVSYYFNLVDRVG--------------
RPOB_MYCPU       SKKAMEKDGEKHFVIGNDPTSVENHLLISDIVAIINYYFNLNENIG--------------
RPOB_MYCS5       TKRAMDANETPSEVIGNDPKATEEHLLLSDIIAAISYYLNLTVGIG--------------
RPOB_MYCH2       NKKSMLQESEPVNVIATDPNLNEKTLVLSDIIAIVSYYFNLLSNLG--------------
RPOB_CITSI       ----------------------------RDVLAAVDHLIGLKF-------GMGTLDD---
RPOB_POPTR       ----------------------------RDILAAADHLIGMKF-------GMGTLDD---
RPOB_AETGR       ----------------------------RDILAAADHLIGMKF-------GMGTLDD---
RPOB_OENEH       ----------------------------RDILAAADHLIGMKF-------GMGTLDD---
RPOB_NYMAL       ----------------------------RDVLAAADHLIGMKF-------GMGTLDD---
RPOB_PIPCE       ----------------------------RDVLAAADHLIGMKF-------GMGTLDD---
RPOB_PHAAO       ----------------------------RDLLAAVDHLIGMKL-------GMGTLDD---
RPOB_DIOEL       ----------------------------RDVLAAADHLIRMKF-------GMGTLDD---
RPOB_PHAVU       ----------------------------RDILTAASHLIGMKF-------GMALLDD---
RPOB_LOTJA       ----------------------------RDILTAADHLIGMKF-------RMGTLDD---
RPOB_JASNU       ----------------------------RDILAAADHLIEQKF-------GMGTLDD---
RPOB_LACSA       ----------------------------RDILAAADRLIRIKF-------GMGTLDD---
RPOB_SACHY       ----------------------------RDVLAATDHLIGMKF-------GTGILDDDD-
RPOB_PELHO       ----------------------------QDILAATNHLIGMKF-------GMGTLDD---
RPOB_ANTAG       ----------------------------QDLLAAVDYLIKIRF-------GIGVPDD---
RPOB_MARPO       ----------------------------QDILAAVDYLIKLKF-------GIGTIDD---
RPOB_PHYPA       ----------------------------QDILAAIDYLIKIKF-------GIGTLDD---
RPOB_PSINU       ----------------------------QDLLAAIDYLIGIKY-------GIGTLDD---
RPOB_ANGEV       ----------------------------QDLLAAVDYLIGVNY-------GIGTLDD---
RPOB_PINTH       ----------------------------QDVLAAVDYLIGVKF-------GMGTLDD---
RPOB_CYCTA       ----------------------------QDVLAAVDYSIRVKF-------GMGTLDD---
RPOB_ADICA       ----------------------------QDILAAADHLVEISY-------GEGKLDD---
RPOB_HUPLU       ----------------------------KDVLAAIDYSIKLRI-------GVGTFDD---
RPOB_CHAGL       ----------------------------EDILATINYLIKLSL-------GIGSLDD---
RPOB_CHAVU       ----------------------------QDLIAAINSLIEKSF-------KIVNLDD---
RPOB_STAPU       ----------------------------QDLIAAAELLVKMSLLHPGPKGGKDSSDD---
RPOB_ZYGCR       ----------------------------QDLIVASDYLVQVS-------NGIGSLDD---
RPOB_NEPOL       ----------------------------VDFLAATDYLIGLEYG-------RGQVDD---
RPOB_OSTTA       ----------------------------QDALAALDYLLRCENGE------TEFLDD---
RPOB_MESVI       ----------------------------QDILAAVDYLINL-EFNIG------TLDD---
RPOB_CHLAT       ----------------------------QDILTAIDYLINL-EFNIG------TLDD---
RPOB_OLTVI       ----------------------------QDLLFITNTLINL-NYGVG------KVDD---
RPOB_BIGNA       ----------------------------KDFILAVHFLLKI-KYKIE------ETDD---
RPOB_PHATC       ----------------------------EDIFAITDKLINL-TISKT------VQDD---
RPOB_THAPS       ----------------------------EDIFAIIDKLITL-STAKQ------ISDD---
RPOB_TRIV2       ----------------------------GDILAAVDYLINL-EYDIG------SIDD---
RPOB_TRIEI       ----------------------------EDILASIDYLINL-EYDIG------QTDD---
RPOB_SYNY3       ----------------------------QDILAAINYLINL-EFDVG------TTDD---
RPOB_SYNE7       ----------------------------EDILAAIDYLINL-ELDLGG----CEVDD---
RPOB_THEEB       ----------------------------EDILAAIDYLINL-EFDLG------TIDD---
RPOB_SYNJA       ----------------------------TDILAVIDYLINL-EYDIG------HVDD---
RPOB_GLOVI       ----------------------------QDILASIDYLINL-EFDIG------SPDD---
RPOB_PROM5       ----------------------------EDVLSTIDYLINL-ELDIGG----ASLDD---
RPOB_GUITH       ----------------------------QDTLAAIDYLINL-KFEIG------ETDD---
RPOB_RHDSA       ----------------------------QDTLSAIDYLINL-KFNIG------ETDD---
RPOB_PYRYE       ----------------------------QDILSSIDYLINIKDKNSG------NLDD---
RPOB_GRATL       ----------------------------EDILVSLDYLLNIKEQNIG------TFDD---
RPOB_CYAPA       ----------------------------QDILEILNYLINL-QFGMG------QIDD---
RPOB_CYACA       ----------------------------QDILSGINYLINL-KFGFG------NIDD---
RPOB_EMIHU       ----------------------------LDLIGIINQLIRFRFMPIV-------SDD---
RPOB_EUGLO       ----------------------------EDFLGIFNYMIKIKNINIK-------------
                                                                             

RPOB_MYCGE       SYVINLPYGIGKYDDIDHLGNKRVKLINELITAKLESGFTRMERFLKEKLTIADGVNR--
RPOB_MYCPN       SYVINIPSAIGKYDDIDHLGNKRVKLINELISSRLESGITRMERFLKEKLTIADGVNR--
RPOB_MYCGA       SYIVNLPFNIGLYDDIDHLGNKRLKLINELLKSKVQTGMMRIEKYIKDKLQTADGNNK--
RPOB_MYCPE       SYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANK--
RPOB_UREPA       SYIYNLNYEIGEFDDIDHLGNKRLKLIHELLRARIATSMARIEKFINEKLAISDGSSNNI
RPOB_ALKEH       -------------DDIDHLGNRRVRCVGEMAENVFRVGLVRVERAVRERLSLAE--SEGL
RPOB_HALHL       -------------DDIDHLGNRRVRSVGEMAENVFRVGLVRVERAVKERLSLAE--SEGL
RPOB_METCA       -------------DDIDHLGNRRVRSVGEMVENQFRLGLVRVERAVKERLSLPD--ADGL
RPOB_XANC8       -------------DDIDHLGNRRVRSVGEMAENVFRVGLVRVERAVKERLSMAE--SEGL
RPOB_XYLFT       -------------DDIDHLGNRRVRSVGEMAENVFRVGLVRVERAVKERLSMAE--SEGL
RPOB_LEGPA       -------------DDIDHLGNRRVRSVGEMTENQFRVGLVRVERAVKERLSLVE--SENL
RPOB_COXBU       -------------DDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKDRLSLAD--VENL
RPOB_NITOC       -------------DDVDHLGNRRVRSVGEMAENQFRVGLVRVERAVRERLSLAE--SEGL
RPOB_AROAE       -------------DDIDHLGNRRVRSVGELAENQFRAGLVRVERAVKERLSQAE--SDNL
RPOB_AZOSB       -------------DDIDHLGNRRVRSVGELAENQFRAGLVRVERAVKERLSQAE--SDNL
RPOB_METFK       -------------DDIDHLGNRRIRSVGELAENQFRAGLVRVERAVKERLSQAE--SDNL
RPOB_NITEC       -------------DDIDHLGNRRVRSVGELAENQFRAGLARVEKAVKERLSQAE--SENL
RPOB_NITMU       -------------DDIDHLGNRRVRSVGELAENQFRSGLVRVERAVKERLSQAE--SENL
RPOB_THIDA       -------------DDIDHLGNRRVRSVGELAENQFRAGLVRVERAVRERLSQAE--SDNL
RPOB_DECAR       -------------DDIDHLGNRRVRSVGELAENQFRAGLVRVERAVKERLSQAE--SDNL
RPOB_PARXL       -------------DDIDHLGNRRVRCVGELAENQFRAGLVRVERAVKERLGQAE--SENL
RPOB_HERAR       -------------DDIDHLGNRRVRCVGELAENQFRAGLVRVERAVKERLGQAE--ADNL
RPOB_RALSO       -------------DDIDHLGNRRVRCVGELAENQFRAGLSRVERAVKERLGQAE--TENL
RPOB_BORA1       -------------DDIDHLGNRRVRCVGELAENQFRAGLVRVERAVKERLGQAE--TENL
RPOB_RHOFT       -------------DDIDHLGNRRVRCVGELAENQYRTGLARIEKAVKERLGQAE--QEPL
RPOB_POLSJ       -------------DDIDHLGNRRVRCVGELAENQYRTGLARIEKAVKERLGQAE--QEPL
RPOB_VEREI       -------------DDIDHLGNRRVRCVGELAENQYRTGLARIEKAVKERLGQAE--QEPL
RPOB_METPP       -------------DDIDHLGNRRVRCVGELAENQYRSGLARIEKAVKERLGQAE--TEAL
RPOB_NEIG1       -------------DDIDHLGNRRVRSVGELTENQFRSGLARVERAVKERLNQAE--SENL
RPOB_CHRVO       -------------DDIDHLGNRRVRSVGELAENQFRAGLVRVERAVKERLNQAE--SDNL
RPOB_ACIBT       -------------DDIDHLGNRRVRSVGEMTENQFRVGLVRVERAVKERLSQAE--TDNL
RPOB_PSYCK       -------------DDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLSSAE--SDNL
RPOB_HAHCH       -------------DDIDHLGNRRVRSVGEMAENQFRVGLVRVERAVKERLSMAE--SEGL
RPOB_MARHV       -------------DDIDNLGNRRVRCVGEMAENQFRVGLVRVERAVRERLSLAE--SEGL
RPOB_SACD2       -------------DDIDHLGNRRVRSVGEMAENQFRVGLVRVERAVKERLSMAE--SEGL
RPOB_PSEU5       -------------DDIDHLGNRRVRCVGEMAENQFRVGLVRVERAVKERLSMAE--SEGL
RPOB_CHRSD       -------------DDIDHLGNRRIRCVGEMAENQFRVGLVRVERAVKERLSMAE--SEGL
RPOB_ALCBS       -------------DDIDHLGNRRVRSVGEMAENQFRVGLVRVERAVKERLSLAE--SEGL
RPOB_SODGM       -------------DDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLSLGD--LDTL
RPOB_ECOLI       -------------DDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLSLGD--LDTL
RPOB_BAUCH       -------------DDIDHLGNRRVRSVGEMAENQFRIGLVRVERAVKERLSLSD--LESL
RPOB_BLOFL       -------------DDIDHLGNRRIRSVGEMAENQFRIGLVRVERAVKERLSLGD--LDVL
RPOB_BLOPB       -------------DDIDHLGNRRIRSVGEMAENQFRIGLVRVERAVKERLSLGD--LDVL
RPOB_BUCAI       -------------DDIDHLGNRRVRSVGEMAENQFRIGLVRVERAVKERLSIGD--LDAL
RPOB_BUCAP       -------------DDIDHLGNRRIRSVGEMAENQFRIGLVRVERAVKERLSVGD--LDTL
RPOB_BUCBP       -------------DDIDHLGNRRVRSVGEMAENQFRIGLIRVERAVKDRLSLGD--LDML
RPOB_WIGBR       -------------DDIDHLGNRRIRSVGEMAENQFRIGLVRVERAVKERLSLGD--LDTI
RPOB_BUCCC       -------------DDIDHLSNRRVRSVGEMVENQFRIGLVRVERAVRERLSLSD--LDTL
RPOB_ACTP2       -------------DDIDHLGNRRIRSVGEMAENQFRIGLVRVERAVRERLSLGD--LDGI
RPOB_MANSM       -------------DDIDHLGNRRIRSVGEMAENQFRIGLVRVERAVKERLSLGD--LDAV
RPOB_HAEI8       -------------DDIDHLGNRRIRSVGEMAENQFRIGLVRVERAVKERLSLGD--LDAI
RPOB_ALIF1       -----------EVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVRERLSLGD--LDAI
RPOB_PHOPR       -------------DDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLSLGD--LDAI
RPOB_VIBCH       -------------DDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLSLGD--LDNV
RPOB_AERS4       -------------DDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLSLGD--LDTL
RPOB_COLP3       -------------DDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVRERLSLGD--LDAI
RPOB_PSEA6       -------------DDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLSLGD--LDAV
RPOB_PSEHT       -------------DDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVRERLSLGD--LDAI
RPOB_SHEAM       -------------DDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVRERLSLGD--LNEL
RPOB_IDILO       -------------DDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLSLGD--LDNT
RPOB_PSYIN       -------------DDIDHLGNRRIRCVGEMAENQFRVGLVRVERAVRERLSLGD--LDAT
RPOB_DICNV       -------------DDIDHLGNRRIRSVGEMAENAFRIGLVRLERTVKERLAQAE--SEGL
RPOB_HYDCU       -------------DDIDTLGNRRIRAVGEMAENAFRVGLVRVERAVKERLNQAE--TDGL
RPOB_VESOH       -------------DDIDTLANRRVRAIGEMIENQFRIGLVRVEKAVREGLNLAE--TDEL
RPOB_FRATO       -------------DDIDHLGNRRVRSVGEMVENQFRIGLYRVEKGIRESMSLVH--KDKL
RPOB_RHIL3       -------------DDIDNLGNRRVRSVGELMENQYRLGLLRMERAIKERMSSIE--IDTV
RPOB_RHIME       -------------DDIDNLGNRRVRSVGELMENQYRLGLLRMERAIKERMSSIE--IDTV
RPOB_AGRFC       -------------DDIDNLGNRRVRSVGELMENQYRLGLLRMERAIKERMSSIE--IDTV
RPOB_RHILO       -------------DDIDNLGNRRVRSVGELMENQYRVGLLRMERAIKERMSSIE--IDTV
RPOB_CHESB       -------------DDIDNLGNRRVRSVGELMENQYRLGLLRMERAIKERMSSIE--IDTV
RPOB_BRUSU       -------------DDIDNLGNRRVRSVGELMENQYRVGLLRMERAIKERMSSIE--IDTV
RPOB_BARBK       -------------DDIDNLGNRRVRSVGELMENQYRVGLLRMERAIKERMSSVE--IDTV
RPOB_RHOPB       -------------DDIDHLGNRRVRSVGELMENQYRIGLLRMERAIKERMSSVD--IDTV
RPOB_GLUOX       -------------DDIDNLGNRRVRSVGELMENQYRVGLLRMERAIRERMGSVD--IDTV
RPOB_GRABC       -------------DDIDNLGNRRVRSVGELMENQYRLGLLRMERAIRERMGSVD--IDTV
RPOB_MAGSA       -------------DDIDHLGNRRVRSVGELMENQYRVGLLRMERAIRERMSSVD--IDSV
RPOB_RHORT       -------------DDIDHLGNRRVRSVGELMENQYRVGLLRMERAIRERMSSVD--IDTV
RPOB_CAUVC       -------------DDIDNLGNRRVRSVGELLENQYRVGLLRMERAIKERMSSVD--IDTV
RPOB_MARMM       -------------DDIDNLGNRRVRSVGELMENQYRIGLLRMERAIKERMSSVD--IETV
RPOB_HYPNA       -------------DDIDNLGNRRVRSVGELMENNYRIGLVRMERAIKERMGAVD--IDTV
RPOB_RHOS1       -------------DDIDHLGNRRVRSVGELMENQYRVGLLRMERAIKERMSSVE--IDTI
RPOB_PARDP       -------------DDIDHLGNRRVRSVGELMENQYRIGLLRMERAIRERMSGVE--IDTV
RPOB_ROSDO       -------------DDIDHLGNRRVRSVGELMENQYRVGLLRMERAIKERMSSVE--IDTV
RPOB_JANSC       -------------DDIDHLGNRRVRSVGELMENQYRVGLLRMERAIKERMSSVE--IDTV
RPOB_NOVAD       -------------DDIDNLGNRRVRSVGELLENQYRVGLLRMERAVKERMSSVD--VSTV
RPOB_ERYLH       -------------DDIDNLGNRRVRSVGELLENQYRVGLLRMERAVKERMSSVD--VSTV
RPOB_SPHAL       -------------DDIDNLGNRRVRSVGELLENQYRVGLLRMERAVKERMSSVD--VSTV
RPOB_ZYMMO       -------------DDIDNLGNRRVRSVGELLENQYRVGLLRMERAVKERMSSVD--VSTV
RPOB_PELUB       -------------DDIDHLGNRRVRSVGELVENQARIGVYRMERAIKEKMTTLD--IESA
RPOB_RICBR       -------------DDIDHLGNRRVRSVGELIENQFRIGLVRMEKSVVERMSAGD--IDTV
RPOB_ORITB       -------------DDIDHLGNRRVRSVGELVENQFRTGLVRIAKFIVERIGSVE--IDAV
RPOB_ANAMM       -------------DDIDHLGNRRVRSVGEFIENQFRIGILRLERMIMDYMSSVN--FDNA
RPOB_ANAPZ       -------------DDIDHLGNRRVRSVGEFIENQFRVGILRLERMIMDYMSSVN--FDNA
RPOB_EHRRW       -------------DDIDHLGNRRVRSVGEFIENQFRIGILRLERMIMDYMSSVN--FDNA
RPOB_NEOSM       -------------DDIDHLGNRRVRSVGEFMDNQFRIGLVRMAKVIVENMATAD--FDTV
RPOB_MAGMM       -------------DDIDHLGNRRVRSVGELLENQVRIGLVRMERAIRERMSSAE--ADQL
RPOB_ANADE       -------------DDIDHLGNRRVRAVGELLENQYRIGLVRMERAIKERMSLQE--IETL
RPOB_MYXXD       -------------DDIDHLGNRRVRAVGELLENQYRIGLVRMERAIKERMSLQE--IETL
RPOB_SYNFM       -------------DDIDNLGNRRVRAVGELLENQYRIGLVRMERAIKERMTLQE--VEAL
RPOB_SYNAS       -------------DDIDHLGNRRVRSVGELIENQYRIGLVRMERAIKEKMSLQD--IETM
RPOB_GEOSL       -------------DDIDHLGNRRVRAVGELLENQYRIGLVRMERAIKERMSLQE--VENL
RPOB_PELPD       -------------DDIDHLGNRRVRAVGELLENQYRIGLVRMERAIKERMSLQE--VENL
RPOB_PELCD       -------------DDIDHLGNRRVRAVGELLENQYRVGLVRMERAIKERMSLQE--VDSL
RPOB_BDEBA       -------------DDIDHLGNRRVRSVGELLENQYRIGLVRMERAIRERMSLQD--VETM
RPOB_DESPS       -------------DDIDHLGNRRVRTVGELVENQYRMGLVRMERAIKERMTLQD--VETL
RPOB_DESVV       -------------DDIDHLGNRRVRPVGELVENQYRIGLVRMERAIKERMSLQE--VSTL
RPOB_DESAG       -------------DDIDHLGNRRVRPVGELVENQYRIGLVRMERAIKERMSLQE--VSTL
RPOB_LAWIP       -------------DDIDHLGNRRVRLVGELVENQYRIGLVRMERAIKERMSIQE--VATL
RPOB_KORVE       -------------DDIDHLGNRRVRAVGELLENQFRIGLVRMERAIKEKMSVYQE-MSTA
RPOB_SOLUE       -------------DDIDHLGNRRVRAVGELLENQFRIGLVRMERAIKEKMSVYQE-MSTA
RPOB_CAMJJ       -------------DDRDHLGNRRIRSIGELLANELHLGLAKMQKAIRDKFTSLNADLDKV
RPOB_CAMFF       -------------DDRDHLGNRRIRSIGELLANELHLGFVKMQKAIRDKFTSLSNNVDEL
RPOB_SULDN       -------------DDRDHLGNRRIRSIGELLGNELHNGLIKMQKAIRDKLSTMSGPMNEL
RPOB_BACV8       -------------DDIDHLSNRRVRTVGEQLSNQFAIGLARMSRTIRERMNVRD--NEVF
RPOB_PARD8       -------------DDIDHLSNRRVRTVGEQLYNQFGIGLARMSRTVRERMNVRD--NEVF
RPOB_PORGI       -------------DDIDHLSNRRVRTVGEQLYNQFGIGLARMARTVRDRMNVRD--NEVF
RPOB_FLAPJ       -------------DDIDHLSNRRVRTVGEQLSQQFGVGLARMARTIRERMNVRD--NEVF
RPOB_GRAFK       -------------DDIDHLSNRRVRTVGEQLSQQFGVGLARMARTIRERMNVRD--NEVF
RPOB_CYTH3       -------------DDIDHLSNRRVRTMGEQLYSQFSVGLARMARTIKERMNVRD--NEDF
RPOB_SALRD       -------------DDIDHLSNRRVKSVGEQLGSQFSLGLARMARTIKERMNLRD--ADKF
RPOB_PELLD       -------------DDVDHLANRRVRSVGEQLAAQFVIGLARMGKNVREKLNSRD--SDKI
RPOB_CHLPD       -------------DDVDHLANRRVRSVGEQLAAQFVIGLARMGKNVREKLNSRD--SDKI
RPOB_CHLCH       -------------DDVDHLANRRVRSVGEQLAAQFVVGLARMGKNVREKLNSRD--SDKI
RPOB_CHLTE       -------------DDVDHLANRRVRSVGEQLAAQFVIGLARMGKNVREKLNSRD--TDKI
RPOB_CHLMU       -------------DDIDHLANRRVRSVGELIQNHCRSGLARMEKIVRERMNLFDFSSDTL
RPOB_CHLPN       -------------DDIDHLANRRVRSVGELIQNQCRSGLARMEKIVRERMNLFDFSSDTL
RPOB_PARUW       -------------DDIDHLGNRRVRSVGELIQNQCRIGLARMEKIIRERMNLFDFSSDTL
RPOB_RHOBA       -------------DDIDHLGNRRLRTIDELASEELRKGFLKLRRTVQERMSVKD--AQDM
RPOB_TREDE       -------------DDIDHLGNRRIRSVGEIMTDVLKKAFSRMERIARDRMSSKE--MDTI
RPOB_TREPA       -------------DDIDHLGNRRIRSVGELMTNTLKTAFLRMERIAKERMSSKE--TETI
RPOB_BORAP       -------------DDIDHLGNRRVRSVGELLTNIYKGAMSRVEKIAKDRMSNKE--VFNL
RPOB_LEPBL       -------------DDIDHLGNRRIRSVGELISNQLKTGFSRVERVIKERMTVQE--IETQ
RPOB_FUSNN       -------------DDIDNLSNRRIRGVGELLLMQIKTGLAKMNKMVREKMTTQD--IETV
RPOB_CYAM1       -------------DDIDHLANRRLKCVGELLQNQVRIGLSRLEKLLREKMTIG----EKL
RPOB_AQUAE       -------------DDIAHLGNRRVRSVGELLENQARLGIAKMEKVFRDRSAVINPEQPDL
RPOB_DEIRA       DEDGVVTDVPVAEDDIDHLGNRRVRTVGELLADQLRVGMGRMARGVRERMLLGN--PDAA
RPOB_DEIGD       DEDGVAIEVPVTEDDIDHLGNRRVRTVGELLADQLRVGMGRMARGVRERMLLGN--PDAA
RPOB_THET8       -------------DDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGS--EDSL
RPOB_THEMA       VSNINKELPSIPFDTKDHLGNKRVRTVGELVQREFERLFARAQKAIQERLTLINS-LSKV
RPOB_BACCR       -----------DTDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQD--TNAI
RPOB_BACSU       -----------DTDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQD--TNTI
RPOB_BACHD       -----------GTDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQD--PNSI
RPOB_GEOTN       -----------DTDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQD--ANTI
RPOB_OCEIH       -----------GTDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQD--TSSV
RPOB_LISIN       -----------DTDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQD--MTTI
RPOB_STAS1       -----------FTDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQD--TDSV
RPOB_STRS2       -----------RVDDIDHLGNRRIRAVGELLANQVRIGLTRMERNLRERMSVQD--NEVL
RPOB_LACLA       -----------KVDDIDHLGNRRIRSVGELLQNQVRIGLSRMERVIRERMSSSE--NENI
RPOB_LACGA       -----------TTDDIDHLGNRRIRRVGELLQNQFRIGLARMERVVRERMSIQD--ISTV
RPOB_LACAC       -----------TTDDIDHLGNRRIRRVGELLQNQFRIGLARMERVVRERMSIQD--PSTV
RPOB_LACDB       -----------NIDDIDHLGNRRIRRVGELLQNQMRIGLARMERVVRERMSIQD--AATV
RPOB_LACPL       -----------STDDIDHLGNRRIRSVGELLQNQFRIGLSRMERVVRERMSIQD--AATV
RPOB_LACBA       -----------NTDDIDHLGNRRIRSVGELLQNQFRIGLSRMERVVRERMSIQD--AATV
RPOB_PEDPA       -----------STDDIDHLGNRRIRSVGELLQNQFRIGLSRMERVVRERMSIQD--AETV
RPOB_LACS1       -----------STDDIDHLGNRRTRSVGELLQNQFRIGLSRMERVVRERMSIQD--TSTV
RPOB_LACSS       -----------STDDIDHLGNRRIRSVGELLQNQFRIGLSRMERVVRERMSIQD--TSTV
RPOB_LACP3       -----------SIDDIDHLGNRRIRSVGELLQNQFRIGLSRMERVVRERMSIQD--TATV
RPOB_ENTFA       -----------NVDDIDHLGNRRIRSVGELLQNQFRIGLARMERVVRERMSIQD--TETL
RPOB_LEUMM       -----------HVDDIDHLGNRRIRSVGELLQNQFRIGLTRMERVVRERMSIQD--ANTV
RPOB_OENOB       -----------ATDDIDHLGNRRIRSVGELLENQFRIGLTRMERVVRERMSIQD--SDTV
RPOB_CARHZ       -----------KVDDIDHLGNRRLRSVGELLQNQFRIGLARMERVVRERMTIQD--ADSL
RPOB_MOOTA       -----------KPDDIDHLGNRRLRSVGELLQNQFRIGLARMERVVRERMTIQD--VDVI
RPOB_SYMTH       -----------SVDDIDHLGNRRVRSVGELLQNQFRIGLARMERVIKERMTIQD--VDII
RPOB_DESHY       -----------HKDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMTIQD--VDVI
RPOB_CLOAB       -----------NVDDIDHLGNRRVRSVGELLQNQFRIGLSRMERVVKERMTIQD--QEVI
RPOB_CLONN       -----------TIDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVKERMTIQD--QEVI
RPOB_CLOPS       -----------YVDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVKERMTIQD--QEAI
RPOB_CLOTE       -----------YTDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVKERMTIQD--QDSI
RPOB_HUNT2       -----------STDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMTIQD--LDVV
RPOB_CLOD6       -----------NIDDIDHLGNRRIRSVGELLQNQVRIGLSRMERVIKERMTVQD--MEAI
RPOB_CALS4       -----------FVDDIDHLGNRRVRSVGELLQNQFRIGLARLERVVKERMTIQD--VNEV
RPOB_SYNWW       -----------KTDVIDHLGNRRLRSIGELLQNQFRTGLVRMERVVRERMSIHD--VETL
RPOB_ONYPE       -----------TVDDIDHLGNRRLRLIGELLKNQFRIGLTRAEKNIKDMISTSK--FSEV
RPOB_COREF       -----GEEIPVETDDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQD--AESI
RPOB_CORDI       -----GEVIPVETDDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQD--AESI
RPOB_CORJK       -----GTEIPIDTDDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQD--AESI
RPOB2_NOCFA      -----GVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--VEAI
RPOB_RHOJR       -----GSAVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--VEAI
RPOB_MYCS2       -----GVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--VEAI
RPOB1_NOCFA      -----GVEVPVEVDDIDHFGNRRVRTVGELIQNQIRVGLSRMERVVRERMTTQD--VEAI
RPOB_SACEN       GG---DATIPVEVDDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQD--VEAI
RPOB_FRAAA       ----------YEVDDIDHFGNRRLRTVGELIQNQVRLGLARMERVVRERMTTQD--VEAI
RPOB_STRCO       RE------IVVETDDIDHFGNRRIRNVGELIQNQVRTGLARMERVVRERMTTQD--VEAI
RPOB_THEFY       T-------FPIEVDDIDHFGNRRLRTVGELIQNQVRLGLARMERVVRERMTTQD--VEAI
RPOB_ACIC1       RT------VIIETDDIDHFGNRRLRTVGELIQNQIRLGLARMERVVRERMTTQD--IVAI
RPOB_NOCSJ       T-------LDISADDIDHFGNRRMRTVGELIQNQLRTGLARMERVVRERMTTQD--VEAI
RPOB_ARTS2       GQ---DHELRVEIDDIDHFGNRRIRAVGELIENQVRTGLSRMERVVRERMTTQD--VEAI
RPOB_LEIXX       GV---ETDIRLDIDDIDHFGNRRIRAVGELIQNQVRTGLSRMERVVRERMTTQD--IEAI
RPOB_CUTAK       DD------IVVEPDDIDHFGNRRLRTVGELIQNQLRTGLSRMERVVRDRMTTQD--IEAI
RPOB_BIFAA       GQ---DVDLRVDVDDIDHFGNRRIRQVGELIQNQLRTGLSRMERVVRERMTTQD--PEAI
RPOB_TROWT       N-----KSVPISTDDIDHLGNRRIRPVGELVQNQLRAGLARMERVVRERMTTQD--IEAI
RPOB_RUBXD       IN---YERIRHKLDEYEHFGNRRLRTVGELVQEAFRIGMYRMERVVRERMTTQD--EESI
RPOB_DEHMC       ----------DTPDDIDHLGNRRIRTVGELVQNQFRIGLVRLERVARERMSIVN--LEMV
RPOB_MYCMS       -----------EIDDIDNLGNRRVRTVGELLQNQFRMGLNRIDKNVKEKLATS---DLYK
RPOB_MESFL       -----------EYDDIDNLANRRVRTVGELLQNQFRMGLTRIDKNVKEKLSTS---DLYK
RPOB_MYCMO       -----------QDDDPDSLINKRIVGVGELLENQFKIGLSKLEKNAKERMSAK---EIEK
RPOB_MYCPU       -----------RDDDPDSLINKRIVSVGELLLNQLNIGLLKMEKNTREKMSSK---EISR
RPOB_MYCS5       -----------QDDDPDSLMNKRIVSVGELLEGELRIALLKLEKATRERMGAK---EPDK
RPOB_MYCH2       -----------KSDDPDSLVNKRIVSVGELLQNQFLIALTKIEKNSKEKISTKS--DLSQ
RPOB_CITSI       ---------------MNHLKNKRIRSVANLLQDQFGLALVRLENVIRGTICGAI--RHKL
RPOB_POPTR       ---------------MNHLKNKRIRSVADLLQDQFGLALIRLENVVRGTICGAI--RHKL
RPOB_AETGR       ---------------MNHLKNKRIRSVADLLQDQFGLALARLENVVKGTICGAI--KHKL
RPOB_OENEH       ---------------TNHLKNKRIRSVADLLQDQFGLALVRLESVVRRTICGAI--RHKL
RPOB_NYMAL       ---------------MNHLKNKRIRSVADLLQDQFGLALVRLENVVRGTICGAI--RHKL
RPOB_PIPCE       ---------------MNHLKNKRIRSVADLLQDQFGLALVRLENVVRGTICGAI--RHKL
RPOB_PHAAO       ---------------MSHLKNKRIRSVADLLQDQFGLALVRLENTVRGTICGAI--RHKL
RPOB_DIOEL       ---------------MNHLKNKRIRSVADLLQDQFGLALVRLENGVRGTICGAI--RHKL
RPOB_PHAVU       ---------------INHLKNKRIRSVADLLQDQFGLALVRLENMVRGTICGAI--RHKL
RPOB_LOTJA       ---------------MNHLKNKRIRSVADLLQDQFGLALVRLENMVRGTICGAI--RYKL
RPOB_JASNU       ---------------MNHLKNKRIRSVADLLQDQLGLALVRLEDEVRETICGPI--RHKW
RPOB_LACSA       ---------------MNHLQNKRIRSVADLLQEQFGLALVRLENMARGNIYAAL--KHNW
RPOB_SACHY       ---------------MNHLKNKRIRSVADLLQDQFGLALGRLQHAVQKTIRRVF--IRQS
RPOB_PELHO       ---------------MNHLKNKRIRSVADLLQDQFGLALNRLEDAVCDTIGRAI--AKDK
RPOB_ANTAG       ---------------IDHLKNRRVRSVTDLLQDQLKLALNRLENSIRQAIRGAN--RREH
RPOB_MARPO       ---------------IDHLKNRRVCSVADLLQDQLKLALNRLENSVLFFFRGAT--KRKR
RPOB_PHYPA       ---------------IDHLKNRRIRSVADLLQDQLKLALIRLENSVRQVMRRTT--KRKR
RPOB_PSINU       ---------------IDHLKNRRVRSVANFLQGQLRLALTHLENSIRQTMHKAI--KRKR
RPOB_ANGEV       ---------------IDDLKNRRVRSVADLLREQLGLALDRLEILIRQTIHTVA--RRKR
RPOB_PINTH       ---------------IDHLRNRRIRSVADLLQNQFRLALGRLEDAVKRTIRRAT--KRR-
RPOB_CYCTA       ---------------MDHLKNRRIRSVADLLQNQFGLALGRLENAVRRTIRRAT--KRKC
RPOB_ADICA       ---------------IDHLKNRRVRSVADLLQEQLKLALNRLENLIRQNLSRAV--RRKR
RPOB_HUPLU       ---------------VDHLKNKRIRSVADFLQNRFKLALERLGDLVHRRINRLT--RRKR
RPOB_CHAGL       ---------------IDHLKNRRVKSISDFLSEQLKNALNKIENTIEQSIKNIS--KRKR
RPOB_CHAVU       ---------------IDHLKNRRVHLIADMLQSQVRIALNRLKRMIAEVMRGIN--KRKN
RPOB_STAPU       ---------------IDHLKNKHVISVAEMLRKQLSLCLIDLQIQVRRAIRRGI--SSKR
RPOB_ZYGCR       ---------------IDDLKHKRVKWVSDLFCVQLNMALKKLNVAVHTNLNKME--ARIS
RPOB_NEPOL       ---------------IDHLKNRRVRCAGELIQSQLRIGLNRLERTMQGRIS-------RP
RPOB_OSTTA       ---------------IDHLKNRRARLAGELIQTQFRLGLNRLERVIYNRISDENILRKTP
RPOB_MESVI       ---------------IDHLKNRRVRSVGELIQNQVRVGLGRLERMIYKRMGESSPDSLT-
RPOB_CHLAT       ---------------IDHLKNRRVRSVGELIENQVRVGLSRLERMTYKRMAESHPDALT-
RPOB_OLTVI       ---------------IDNLKNRRIRTAGELVQNQFGIGLLRLEKIIREKLKQQQ-TKLS-
RPOB_BIGNA       ---------------IDNLKNKRVKIAGELIQSQFGIGILRLQKYVKDKLGNIK-NNLH-
RPOB_PHATC       ---------------IDHLKNRRVRSVGELLQNLFRIGFQRLGRKLRNQTNKID------
RPOB_THAPS       ---------------IDHLKNRRVRSVGELLQNLFRIGFQRLLRKLRSQTNKTY------
RPOB_TRIV2       ---------------IDHLGNRRVRSVGELLQNQVRVGLNRLERIIRERMTVSDAEVLTP
RPOB_TRIEI       ---------------IDHLGNRRVRSVGELLQNQIRVGLNRLERIIRERMTVSESETLTP
RPOB_SYNY3       ---------------IDHLGNRRVRSVGELLQNQIRVGLNRLERIIRERMTVSESDALTP
RPOB_SYNE7       ---------------IDHLGNRRVRSVGELLQNQVRVGLNRLERIIRERMTVSDSDSLSP
RPOB_THEEB       ---------------IDHLGNRRVRSVGELLQNQVRVGLNRLERIIRERMTVSDTDSLTP
RPOB_SYNJA       ---------------IDHLGNRRVRSVGELLQNQVRVGLNRLERIIRERMTVSESENLTP
RPOB_GLOVI       ---------------IDHLGNRRVRSVGELLQNQVRVGLNRLERIIRERMTVSEAETLTP
RPOB_PROM5       ---------------IDHLGNRRVRSVGELLQNQVRVGLNRLERIIKERMTVGETDSLTP
RPOB_GUITH       ---------------IDHLGNRRVRSVGELLQNQVRIGLNRLERIIRERMTICDITSLTP
RPOB_RHDSA       ---------------IDHLGNRRVRSVGELLQNQVRVGLNRLERIIRERMTICDSESLAP
RPOB_PYRYE       ---------------IDHLGNRRVRSVGELLQNQFRVGLNRLERIIRERMMICDIDSLSL
RPOB_GRATL       ---------------IDHLGNRRVRSVGELLQNQVRIGLNRLERIIRERMIICDLDSLSL
RPOB_CYAPA       ---------------IDHLGNRRVKAVGELLQSQLRIGLNRLERLIHDRLSMLTTKSFKK
RPOB_CYACA       ---------------IDHLANRRLKSVGELLQSQISIGLIRLERLIKERMTICEQSSLVP
RPOB_EMIHU       ---------------IDHLGNRRIRSVGELMANQIRIGLNRLERVVRERMAICEHSYLRV
RPOB_EUGLO       ------------SNKIDDLKNKIVLSVGELMQNKFNNIIKDIYTKIIEKINKFEQKKKQE
                                   : ::      :         .                     

RPOB_MYCGE       --------GQQINEEGQ---VIEQGEKKELTIKSLINSKP----IQIVIKDFFNTHQLTQ
RPOB_MYCPN       --------GQQINEEGQ---VIEQAEKKELTIKSLINSKP----IQIVIRDFFNTHQLTQ
RPOB_MYCGA       --------LADQDAENDPDSDLGTKSSNDLTVKSVINPKP----FQIVIKDFFNTHQLTQ
RPOB_MYCPE       --------SQEQSEEQE--------PKKSLTVKSIINTKP----FQISFKEFFNSHQLTQ
RPOB_UREPA       TNVNDKGIDTELDREIEESDMSDEEKKKAISVKSIINTKQ----FQSLVKDFFNSHQLIQ
RPOB_ALKEH       M------------------------------PQELINAKP----VAAAIKEFFGSSQLSQ
RPOB_HALHL       M------------------------------PQELINAKP----VAAAIKEFFGSSQLSQ
RPOB_METCA       M------------------------------PQEIINAKP----VAASIKEFFGSSQLSQ
RPOB_XANC8       T------------------------------PQELINAKP----VAAAIKEFFGSSQLSR
RPOB_XYLFT       T------------------------------PQELINAKP----VAAAIKEFFGSSQLSQ
RPOB_LEGPA       M------------------------------PQDLINAKP----VSAAIKEFFGSSQLSQ
RPOB_COXBU       M------------------------------PQDLVNAKP----VSAAIKEFFGSSQLSQ
RPOB_NITOC       M------------------------------PQELINAKP----VSAAVKEFFGSSQLSQ
RPOB_AROAE       M------------------------------PHDLINAKP----ISAAIKEFFGSSQLSQ
RPOB_AZOSB       M------------------------------PHDLINAKP----ISAAIKEFFGSSQLSQ
RPOB_METFK       M------------------------------PHDLINAKP----VSSAIREFFGSSQPSQ
RPOB_NITEC       M------------------------------PHDFINAKP----VSSAIREFFGSSQLSQ
RPOB_NITMU       M------------------------------PHDLINAKP----VSAAVREFFGSSQLSQ
RPOB_THIDA       M------------------------------PHDLINAKP----VSAAIKEFFGSSQLSQ
RPOB_DECAR       M------------------------------PHDLINAKP----ISAAIKEFFGSSQLSQ
RPOB_PARXL       M------------------------------PHDLINSKP----ISSAIREFFGSSQLSQ
RPOB_HERAR       M------------------------------PHDLINSKP----ISAAIREFFGSSQLSQ
RPOB_RALSO       M------------------------------PHDLINSKP----ISSAIREFFGSSQLSQ
RPOB_BORA1       M------------------------------PHDLINSKP----ISAAIKEFFGSSQLSQ
RPOB_RHOFT       M------------------------------PHDLINSKP----ISAALKEFFGASQLSQ
RPOB_POLSJ       M------------------------------PHDLINSKP----ISAALKEFFGASQLSQ
RPOB_VEREI       M------------------------------PHDLINSKP----ISAALKEFFGASQLSQ
RPOB_METPP       M------------------------------PHDLINSKP----ISAALKEFFGASQLSQ
RPOB_NEIG1       M------------------------------PHDLINAKP----VSAAIKEFFGSSQLSQ
RPOB_CHRVO       M------------------------------PHDLINAKP----VSAAIKEFFGSSQLSQ
RPOB_ACIBT       S------------------------------PQDLINAKP----VAAAIKEFFGSSQLSQ
RPOB_PSYCK       S------------------------------PQDLINSKP----VAAAVKEFFGSSQLSQ
RPOB_HAHCH       M------------------------------PQDLINAKP----VAAAVKEFFGSSQLSQ
RPOB_MARHV       M------------------------------PQDLINAKP----VAAAVKEFFGSSQLSQ
RPOB_SACD2       M------------------------------PQDLINAKP----VAAAVKEFFGSSQLSQ
RPOB_PSEU5       M------------------------------PQDLINAKP----VAAAVKEFFGSSQLSQ
RPOB_CHRSD       M------------------------------PQDLINAKP----VAAAVKEFFGSSQLSQ
RPOB_ALCBS       M------------------------------PQDLINSKP----VAAAVKEFFGSSQLSQ
RPOB_SODGM       M------------------------------PQDMINAKP----ISAAVKEFFGSSQLSQ
RPOB_ECOLI       M------------------------------PQDMINAKP----ISAAVKEFFGSSQLSQ
RPOB_BAUCH       M------------------------------PQDIINAKP----ISAAIKEFFGSSQLSQ
RPOB_BLOFL       T------------------------------PQDLINAKP----ISAAVREFFNSSQLSQ
RPOB_BLOPB       T------------------------------PQDLINAKP----ISAAVREFFTSSQLSQ
RPOB_BUCAI       M------------------------------PQDMINAKP----ISAAVKEFFGSSQLSQ
RPOB_BUCAP       M------------------------------PQDMINAKP----ISAAIKEFFGSSQLSQ
RPOB_BUCBP       M------------------------------PQDMINAKP----ISAAIKEFFGSSQLSQ
RPOB_WIGBR       M------------------------------PQDMINAKP----ISAAVKEFFGSSQLSQ
RPOB_BUCCC       M------------------------------PQDIINAKP----ISSAIKEFFGSSQLSQ
RPOB_ACTP2       T------------------------------PQDLINAKP----ISAAVKEFFGSSQLSQ
RPOB_MANSM       T------------------------------PQDLINAKP----VSAAVKEFFGSSQLSQ
RPOB_HAEI8       T------------------------------PQDLINPKP----ISAAVKEFFGSSQLSQ
RPOB_ALIF1       M------------------------------PQDLINAKP----ISAAVKEFFGSSQLSQ
RPOB_PHOPR       M------------------------------PQDLINAKP----ISAAVKEFFGSSQLSQ
RPOB_VIBCH       M------------------------------PQDLINAKP----ISAAVKEFFGSSQLSQ
RPOB_AERS4       M------------------------------PQDLINAKP----ISAAVKEFFGSSQLSQ
RPOB_COLP3       M------------------------------PQDLINAKP----ISAAVKEFFGSSQLSQ
RPOB_PSEA6       M------------------------------PQDLINAKP----ISAAVKEFFGSSQLSQ
RPOB_PSEHT       M------------------------------PQDLINAKP----ISAAVKEFFGSSQLSQ
RPOB_SHEAM       M------------------------------PQDLINAKP----ISAAVKEFFGSSQLSQ
RPOB_IDILO       M------------------------------PQDLINAKP----ISAAVKEFFGSSQLSQ
RPOB_PSYIN       M------------------------------PQDLINAKP----ISAAVKEFFGSSQLSQ
RPOB_DICNV       T------------------------------PKDLINVKP----VGAAVKEFFSSSQLSQ
RPOB_HYDCU       L------------------------------PQDLINAKP----VSAAIKEFFGSSQLSQ
RPOB_VESOH       T------------------------------PQDLINSKP----VSAAVREFFGSSQLSQ
RPOB_FRATO       M------------------------------PKDIVNSKP----ITAAIKEFFTSGALSQ
RPOB_RHIL3       M------------------------------PQDLINAKP----AAAAVREFFGSSQLSQ
RPOB_RHIME       M------------------------------PQDLINAKP----AAAAVREFFGSSQLSQ
RPOB_AGRFC       M------------------------------PQDLINAKP----AAAAVREFFGSSQLSQ
RPOB_RHILO       M------------------------------PQDLINAKP----AAAAVREFFGSSQLSQ
RPOB_CHESB       M------------------------------PQDLINAKP----AAAAVREFFGSSQLSQ
RPOB_BRUSU       M------------------------------PQDLINAKP----AAAAVREFFGSSQLSQ
RPOB_BARBK       M------------------------------PQDLINAKP----AAAAVREFFGSSQLSQ
RPOB_RHOPB       M------------------------------PQDLINAKP----AAAAVREFFGSSQLSQ
RPOB_GLUOX       M------------------------------PHDLINAKP----AAAAVREFFGSSQLSQ
RPOB_GRABC       M------------------------------PHDLINAKP----AAAAVREFFGSSQLSQ
RPOB_MAGSA       M------------------------------PHDLINAKP----AAAAVREFFGSSQLSQ
RPOB_RHORT       M------------------------------PHDLINAKP----AAAAVREFFGSSQLSQ
RPOB_CAUVC       M------------------------------PHDLINAKP----AAAAVREFFGSSQLSQ
RPOB_MARMM       M------------------------------PHDLVNAKP----AAAAVREFFGSSQLSQ
RPOB_HYPNA       M------------------------------PHDLINAKP----VVAAVREFFGSSQLSQ
RPOB_RHOS1       M------------------------------PQDLINAKP----AAAAVREFFGSSQLSQ
RPOB_PARDP       M------------------------------PQDLINAKP----AAAAVREFFGSSQLSQ
RPOB_ROSDO       M------------------------------PQDLINAKP----AAAAVREFFGSSQLSQ
RPOB_JANSC       M------------------------------PQDLINAKP----AAAAVREFFGSSQLSQ
RPOB_NOVAD       M------------------------------PNDLINAKP----AVAAVREFFGSSQLSQ
RPOB_ERYLH       M------------------------------PNDLINAKP----AVAAVREFFGSSQLSQ
RPOB_SPHAL       M------------------------------PNDLINAKP----AVAAVREFFGSSQLSQ
RPOB_ZYMMO       M------------------------------PNDLINAKP----AVAAVREFFGSSQLSQ
RPOB_PELUB       M------------------------------PQDLINAKP----LTVSLKDFFVSSQLSQ
RPOB_RICBR       M------------------------------PHDLVNSKI----LVSVVKEFFSTSQLSQ
RPOB_ORITB       V------------------------------PNDLVNAKL----LTSVIKEFFGTSQLSQ
RPOB_ANAMM       M------------------------------PCDFVNPKV----LATVLKDFFSSSQLSQ
RPOB_ANAPZ       V------------------------------PCDFVNPKI----LATVLKDFFSSSQLSQ
RPOB_EHRRW       M------------------------------PCDFVNPKV----LATVLKDFFSSSQLSQ
RPOB_NEOSM       M------------------------------PCEMINSKI----LGAVIREFFMSSALSQ
RPOB_MAGMM       V------------------------------PHDVMNSKP----FSAVIREFFGSSQLSQ
RPOB_ANADE       M------------------------------PHDLINAKP----VTAVIKEFFGSSQLSQ
RPOB_MYXXD       M------------------------------PHDLINAKP----VTAVIKEFFGSSQLSQ
RPOB_SYNFM       M------------------------------PHDLINAKP----VSAVVKEFFGTSQLSQ
RPOB_SYNAS       M------------------------------PHDLVNVKP----VSAVVSEFFGSSQLSQ
RPOB_GEOSL       M------------------------------PHDLINSKP----VSAVVKEFFGSSQLSQ
RPOB_PELPD       M------------------------------PHDLINSKP----VSAVVKEFFGSSQLSQ
RPOB_PELCD       M------------------------------PHDLINSKP----VSAVVKEFFGSSQLSQ
RPOB_BDEBA       M------------------------------PHDLVNAKP----VNAVVKEFFGSSQLSQ
RPOB_DESPS       M------------------------------PHDLINPKP----ISAAIKEFFGTSQLSQ
RPOB_DESVV       M------------------------------PHDLINPKP----VAAVLKEFFGTSQLSQ
RPOB_DESAG       M------------------------------PHDLINPKP----VQAVLKEFFGTSQLSQ
RPOB_LAWIP       M------------------------------PHDLINPKP----VAALLKEFFGTSQLSQ
RPOB_KORVE       M------------------------------PHDLVNAKP----VMAAIREFFGSSQLSQ
RPOB_SOLUE       M------------------------------PHDLVNAKP----VMAAIREFFGSSQLSQ
RPOB_CAMJJ       M------------------------------PYDLINPKM----ITTTIIEFFTGGQLSQ
RPOB_CAMFF       M------------------------------PYDLVNPKM----ITTTIMEFFTGGQLSQ
RPOB_SULDN       M------------------------------PHDLINSKM----ITSTIMEFFSGGQLSQ
RPOB_BACV8       T------------------------------PIDLINAKT----ISSVINSFFGTNALSQ
RPOB_PARD8       T------------------------------PIDLINAKT----ISSVVNSFFGTNALSQ
RPOB_PORGI       T------------------------------PIDLVNAKT----ISSVVNSFFGTNALSQ
RPOB_FLAPJ       T------------------------------PIDLINAKT----LSSVINSFFGTNQLSQ
RPOB_GRAFK       T------------------------------PIDLINAKT----LSSVINSFFGTNQLSQ
RPOB_CYTH3       K------------------------------PVDLINART----LSSVINSFFGTNQLSQ
RPOB_SALRD       T------------------------------PKDLVNART----IESVINTFFGTNQLSQ
RPOB_PELLD       A------------------------------PADLINART----VSSVVSSFFATSQLSQ
RPOB_CHLPD       A------------------------------PSDLINART----VSSVVSSFFATSQLSQ
RPOB_CHLCH       A------------------------------PSDLINART----VSSVVSSFFATSQLSQ
RPOB_CHLTE       A------------------------------PADLINART----VSSVVSSFFATSQLSQ
RPOB_CHLMU       T------------------------------PGKIISAKG----LVSVLKDFFSRSQLSQ
RPOB_CHLPN       T------------------------------PGKVVSAKG----LASVLKDFFGRSQLSQ
RPOB_PARUW       T------------------------------PGKIVSAKG----LSGVLKDFFGRSQLSQ
RPOB_RHOBA       T------------------------------PRSLINPKS----VSAAIDFFFGRGELSQ
RPOB_TREDE       K------------------------------PKDLISIKP----IVAAIKEFFGASQLSQ
RPOB_TREPA       K------------------------------PQDLISIKP----IMAAIKEFFGASQLSQ
RPOB_BORAP       K------------------------------PQELISVKP----IVSAVKEFFATSQLSQ
RPOB_LEPBL       T------------------------------PQLLISIKP----ITAVINEFFGSSQLSQ
RPOB_FUSNN       T------------------------------PQSLLNTRP----LNALIQDFFGSGQLSQ
RPOB_CYAM1       Q------------------------------PSSLLNPKP----LTSAIREFFASSQLSQ
RPOB_AQUAE       K------------------------------PQDFINPRY----VTTAITDFLKTGQLSQ
RPOB_DEIRA       T------------------------------PTKLVNNRP----IVAAMREFFGRSQLSQ
RPOB_DEIGD       T------------------------------PTKLVNNRP----IVAAMREFFGRSQLSQ
RPOB_THET8       T------------------------------PAKLVNSRP----LEAAIREFFSRSQLSQ
RPOB_THEMA       S------------------------------IQSLINIKS----IISTVNQFFAMNQLSQ
RPOB_BACCR       T------------------------------PQALINIRP----VIASIKEFFGSSQLSQ
RPOB_BACSU       T------------------------------PQQLINIRP----VIASIKEFFGSSQLSQ
RPOB_BACHD       T------------------------------PQALINIRP----VIASIKEFFGSSQLSQ
RPOB_GEOTN       T------------------------------PQQLINIRP----VIAAIKEFFGSSQLSQ
RPOB_OCEIH       T------------------------------PQQLINIRP----VIASIKEFFGSSQLSQ
RPOB_LISIN       T------------------------------PQQLINIRP----VVASIKEFFGSSQLSQ
RPOB_STAS1       T------------------------------PQQLINIRP----VIASIKEFFGSSQLSQ
RPOB_STRS2       T------------------------------PQQIINIRP----VTAAIKEFFGSSQLSQ
RPOB_LACLA       T------------------------------PQGLINIRP----VTASIKEFFGSSQLSQ
RPOB_LACGA       T------------------------------PQQLINIRP----VVASVKEFFGSSQLSQ
RPOB_LACAC       T------------------------------PQQLINIRP----IVASIKEFFGSSQLSQ
RPOB_LACDB       T------------------------------PQQLINIRP----IVGSIKEFFGSSQLSQ
RPOB_LACPL       T------------------------------PQQLINIRP----VVASIKEFFGSSQLSQ
RPOB_LACBA       T------------------------------PQQLINIRP----VVASIKEFFGSSQLSQ
RPOB_PEDPA       T------------------------------PQQLINIRP----VVAATKEFFGSSQLSQ
RPOB_LACS1       T------------------------------PQQLINIRP----VVASIKEFFGSSQLSQ
RPOB_LACSS       T------------------------------PQQLINIRP----VVASIKEFFGSSQLSQ
RPOB_LACP3       T------------------------------PQQLINIRP----VVASIKEFFGSSQLSQ
RPOB_ENTFA       T------------------------------PQQLINIRP----VVASIKEFFGSSQLSQ
RPOB_LEUMM       T------------------------------PQQLINIRP----VVAAVKEFFGSSQLSQ
RPOB_OENOB       T------------------------------PQQLINIRP----VVAVVKEFFGSSQLSQ
RPOB_CARHZ       T------------------------------PQVLINTRP----IVAAIKEFFGSSQLSQ
RPOB_MOOTA       T------------------------------PQVLINIRP----VVAAIKEFFGSSQLSQ
RPOB_SYMTH       T------------------------------PQALINIRP----VVAAVKEFFGSSQLSQ
RPOB_DESHY       T------------------------------PQVLINIRP----VVAAIKEFFGSSQLSQ
RPOB_CLOAB       T------------------------------PQALINIRP----VAASIKEFFGSSQLSQ
RPOB_CLONN       T------------------------------PQALINIRP----VAAAIKEFFGSSQLSQ
RPOB_CLOPS       T------------------------------PQQLINIRP----VAAAIKEFFGSSQLSQ
RPOB_CLOTE       T------------------------------PQALINIRP----VTASIKEFFGSSQLSQ
RPOB_HUNT2       T------------------------------PQALINIRP----VAAAIKEFFGSSQLSQ
RPOB_CLOD6       T------------------------------PQALVNIRP----VSAAIKEFFGSSQLSQ
RPOB_CALS4       T------------------------------PQNLINIRP----VVAAIREFFGSSQLSQ
RPOB_SYNWW       T------------------------------PQVLINIRP----ITAAVKEFFGSSQLSQ
RPOB_ONYPE       NG-----------------------------PGDLVNFTF----LMSVIKTFFTSSRLSQ
RPOB_COREF       T------------------------------PTSLINVRP----VSAAIREFFGTSQLSQ
RPOB_CORDI       T------------------------------PTSLINVRP----VSAAIREFFGTSQLSQ
RPOB_CORJK       T------------------------------PTSLINVRP----VSAAIREFFGTSQLSQ
RPOB2_NOCFA      T------------------------------PQTLINIRP----VVAAIKEFFGTSQLSQ
RPOB_RHOJR       T------------------------------PQTLINIRP----VVAAIKEFFGTSQLSQ
RPOB_MYCS2       T------------------------------PQTLINIRP----VVAAIKEFFGTSQLSQ
RPOB1_NOCFA      T------------------------------PQSLMNIRP----VVAAMKEFFGTSQLSQ
RPOB_SACEN       T------------------------------PQTLINIRP----VVAAIKEFFGTSQLSQ
RPOB_FRAAA       T------------------------------PQTLINIRP----VVASIKEFFGTSQLSQ
RPOB_STRCO       T------------------------------PQTLINIRP----VVASIKEFFGTSQLSQ
RPOB_THEFY       T------------------------------PQTLINIRP----VVASIREFFGTSQLSQ
RPOB_ACIC1       T------------------------------PQTLINIRP----VVASIKEFFGTSQLSQ
RPOB_NOCSJ       T------------------------------PQSLINIRP----VVAALKEFFGTSQLSQ
RPOB_ARTS2       T------------------------------PQTLINIRP----VVAAIKEFFGTSQLSQ
RPOB_LEIXX       T------------------------------PQTLINVRP----VVAAIKEFFGTSQLSQ
RPOB_CUTAK       T------------------------------PQTLINIRP----VTAAIKEFFGTSQLSQ
RPOB_BIFAA       T------------------------------PQSLINIRP----VNATIKEFFGTSQLSQ
RPOB_TROWT       I------------------------------PQTLINVMP----IVAALKEFYGTSQLSQ
RPOB_RUBXD       T------------------------------PQTVVNTKP----VASAIKEFFGSSQLSQ
RPOB_DEHMC       T------------------------------PSALVNIRP----VVSAVKEFFGGSQLSQ
RPOB_MYCMS       VK-----------------------------TSTIINAKP----LTAIIGEFFNLSQLSQ
RPOB_MESFL       VK-----------------------------VSTIINAKP----LTAVIGEFFNLSQLSQ
RPOB_MYCMO       IT-----------------------------PKNITNSKP----VYNQFKTFFNSSKLSQ
RPOB_MYCPU       IT-----------------------------PKNITNNKM----IQNQIKTFFNSSKLSQ
RPOB_MYCS5       IT-----------------------------AKNVTNNKL----ITNQMKTFFNTSKLAQ
RPOB_MYCH2       LT-----------------------------VKSIINNKP----IYNQFKNFFNSSKLSQ
RPOB_CITSI       MPTP----------------------------QNLVTSTP----LTTTYDSFFGLHPLSQ
RPOB_POPTR       IPTP----------------------------QNLVTSTP----LTTTYESFFGLHPLSQ
RPOB_AETGR       IPTP----------------------------QNLVTATP----LTTTYESFFGLHPLSQ
RPOB_OENEH       IPTP----------------------------HNLVTSTP----LTTTYESFFGLHPLSQ
RPOB_NYMAL       IPTP----------------------------RNLVTSTP----LTTTYESFFGLHPLSQ
RPOB_PIPCE       IPTP----------------------------QNLVTSTP----LTTTYESFFGLHPLSQ
RPOB_PHAAO       IPTP----------------------------QNLVTSTS----LTTTYESFFGLHPLSQ
RPOB_DIOEL       IPNP----------------------------KNLVTSTS----FTTTYESFFGLHPLSQ
RPOB_PHAVU       IPTP----------------------------QNLVTSTP----LTTTYESFFGLHPLSQ
RPOB_LOTJA       IPTP----------------------------QNLVTSTP----LTTTYESFFGLHPLSQ
RPOB_JASNU       RTTPH--------------------------PQNLVTSTP----LTTTYESFFGSHPLSQ
RPOB_LACSA       TPTP----------------------------QNLVNSTP----LTDTYKVFFRLHPLSQ
RPOB_SACHY       KPTP----------------------------QTLVTPTSTSILLITTYETFFGTYPLAQ
RPOB_PELHO       IPTL----------------------------RHLATSTP----LTTTYESFFKLHPLSH
RPOB_ANTAG       LPTP----------------------------KSLVTSTP----LITTFKEFFGSHPLSQ
RPOB_MARPO       LPTP----------------------------KSLVTSTP----LIMTFKEFFGSHPLSQ
RPOB_PHYPA       LLSP----------------------------KNLITQTP----LIATFKEFFGSHPLSQ
RPOB_PSINU       SLTP----------------------------KGLVISTP----LLTTFKEFFGSHPLSQ
RPOB_ANGEV       LVTP----------------------------KGLITSAP----LTTIFQDFFGSHSLSQ
RPOB_PINTH       -STP----------------------------QNLVTSTL----LKNTFQDFFGSHPLSQ
RPOB_CYCTA       LPTP----------------------------NNLVTSTP----LTTTFQDFFGSHPLSQ
RPOB_ADICA       AITP----------------------------RGLVTPVP----VIAAFKEFFGSHPLSQ
RPOB_HUPLU       VPTI----------------------------GSLVTSDP----LLKTFKEFFGSYPLSQ
RPOB_CHAGL       ILTP----------------------------KSLINSGI----LLAFFKDFFGSHPLSQ
RPOB_CHAVU       LPNP----------------------------QSLVTPKP----LVATFQEFFGSHPLCQ
RPOB_STAPU       ILSP----------------------------RSMMISRP----LTQMFNQFFGSHELIQ
RPOB_ZYGCR       RMSL----------------------------KSVVSSNA----IATTFFRFVASYQLSQ
RPOB_NEPOL       GELPG--------------------------MSSLMNPKP----VMAALREFFGSNPLSQ
RPOB_OSTTA       GALGS--------------------------LNSLIRTQV----LASVFQEFFGSNQLSQ
RPOB_MESVI       ---L----------------------------TSLVNPKP----LVGAIREFFGSSQLSQ
RPOB_CHLAT       ---P----------------------------ASLINPKP----LVGVLREFFGSSQLSQ
RPOB_OLTVI       ---I----------------------------GSLINTKP----INGALREFFGSSPLSQ
RPOB_BIGNA       ---L----------------------------TNIFSSTP----INTTLAEFFGVNPLSQ
RPOB_PHATC       ---S----------------------------GQLLSFNI----VNASIREFFGSSQLSQ
RPOB_THAPS       ---S----------------------------SQLSSFNI----VGATIKEFFGASQLSQ
RPOB_TRIV2       --------------------------------ASLVNPKP----LVAAIKEFFGSSQLSQ
RPOB_TRIEI       --------------------------------TSLVNPKP----LVAAIKEFFGSSQLSQ
RPOB_SYNY3       --------------------------------ASLVNPKP----LVAAIKEFFGSSQLSQ
RPOB_SYNE7       --------------------------------ASLVNPKP----LVAAIKEFFGSSQLSQ
RPOB_THEEB       --------------------------------TSLVNPKP----LVAAIKEFFGSSQLSQ
RPOB_SYNJA       --------------------------------ASLVNPKP----LVAAIKEFFGSSQLSQ
RPOB_GLOVI       --------------------------------ASLVNPKP----LVAAIKEFFGSSQLSQ
RPOB_PROM5       --------------------------------AQLVNPKP----LVAAIKEFFGSSQLSQ
RPOB_GUITH       --------------------------------NTLVNPKP----IIASIREFFGSSQLSQ
RPOB_RHDSA       --------------------------------NTLVNPKP----IIAAIREFFGSSQLSQ
RPOB_PYRYE       --------------------------------SNLINPKP----LIASVREFFGSSQLSQ
RPOB_GRATL       --------------------------------SNLVNPKP----LMASVREFFSSSQLSQ
RPOB_CYAPA       RKKL----------------------------TTLINAKP----INECLKEFFGSSQLSQ
RPOB_CYACA       --------------------------------SALINPKP----IFAAIKEFFNSSQLSQ
RPOB_EMIHU       --------------------------------NTLVNPKP----LAASIREFFGSNPLSQ
RPOB_EUGLO       EKYNKEK----------------KEEKIKINKTYFINSKN----LTDNIKKFITTNPLSQ
                                                   .                *       :

RPOB_MYCGE       FLDHQNPLSELSNKRRISAMGPGGISREDPNLDIRDVHYSQYGRICPIETPEGMNIGLIM
RPOB_MYCPN       FLDHQNPLSELSNKRRISAMGPGGISREDPNLDIRDVHYSQYGRICPIETPEGMNIGLIM
RPOB_MYCGA       FLDQQNPLSELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGRICPIETPEGMNIGLIM
RPOB_MYCPE       FLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIM
RPOB_UREPA       FIDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHHSHSSRICPIETPEGMNIGLIM
RPOB_ALKEH       FMDQNNPLSEVTHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_HALHL       FMDQNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_METCA       FMDQNNPLSEVTHKRRVSALGPGGLARERAGFEVRDVHTTHYGRVCPIETPEGPNIGLIN
RPOB_XANC8       FMDQNNPLSEVTHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCTIETPEGPNIGLIN
RPOB_XYLFT       FMDQNNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHLSHYGCLCTIETPEGPNIGLIN
RPOB_LEGPA       FMDQVNPLSGVTHKRRVSALGPGGLTRERAGFEVRDVHTTHYGRVCPIETPEGPNIGLIN
RPOB_COXBU       FMDQNNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHVTHYGRVCPIETPEGPNIGLIN
RPOB_NITOC       FMDQNNPLSEVTHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_AROAE       FMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_AZOSB       FMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_METFK       FMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHSTHYGRVCPIETPEGPNIGLIN
RPOB_NITEC       FMDQTNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_NITMU       FMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_THIDA       FMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_DECAR       FMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_PARXL       FMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_HERAR       FMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_RALSO       FMDQTNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_BORA1       FMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_RHOFT       FMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHVTHYGRVCPIETPEGPNIGLIN
RPOB_POLSJ       FMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHVTHYGRVCPIETPEGPNIGLIN
RPOB_VEREI       FMDQTNPLAEITHKRRVSALGPGGLTRERAGFEVRDVHVTHYGRVCPIETPEGPNIGLIN
RPOB_METPP       FMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_NEIG1       FMDQTNPLSEVTHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_CHRVO       FMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_ACIBT       FMDQNNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHQTHYGRVCPIETPEGPNIGLIN
RPOB_PSYCK       FMDQNNPLSEVTHKRRVSALGPGGLTRERAGFEVRDVHDTHYGRVCPIETPEGPNIGLIN
RPOB_HAHCH       FMDQNNPLSEVTHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_MARHV       FMDQNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_SACD2       FMDQNNPLSEVTHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_PSEU5       FMDQNNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_CHRSD       FMDQNNPLSEVTHKRRVSALGPGGLTRERAGFEVRDVHATHYGRLCPIETLEGPNIGLIN
RPOB_ALCBS       FMDQNNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_SODGM       FMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_ECOLI       FMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_BAUCH       FMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_BLOFL       FMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_BLOPB       FMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_BUCAI       FMDQNNPLSEITHKRRISALGLGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_BUCAP       FMDQNNPLSEITHKRRISALGLGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_BUCBP       FMDQNNPLSEITHKRRISALGLGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_WIGBR       FMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_BUCCC       FMDQNNPLAEITHKRRISALGIGGLTRERAGFEVRDVHPTHYGRVCPVETPEGPNIGLIN
RPOB_ACTP2       FMDQNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHTTHYGRLCPIETPEGPNIGLIN
RPOB_MANSM       FMDQNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_HAEI8       FMDQNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHNTHYGRLCPIETPEGPNIGLIN
RPOB_ALIF1       FMDQNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHATHYGRLCPIETPEGPNIGLIN
RPOB_PHOPR       FMDQNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHATHYGRLCPIETPEGPNIGLIN
RPOB_VIBCH       FMDQNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHVTHYGRLCPIETPEGPNIGLIN
RPOB_AERS4       FMDQNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRLCPIETPEGPNIGLIN
RPOB_COLP3       FMDQNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_PSEA6       FMDQNNPLSEVTDKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_PSEHT       FMDQNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHVTHYGRVCPIETPEGPNIGLIN
RPOB_SHEAM       FMDQNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRLCPIETPEGPNIGLIN
RPOB_IDILO       FMDQNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRLCPIETPEGPNIGLIN
RPOB_PSYIN       FMDQNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRLCPIETPEGPNIGLIN
RPOB_DICNV       FMDQNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRLCPIETPEGPNIGLIN
RPOB_HYDCU       FMDQVNPLSEVTHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
RPOB_VESOH       FMDQVNPLSGVTHKRRISALGPGGLTRERAGFEVRDVHPSHYGRLCPIETPEGPNIGLIN
RPOB_FRATO       FMDQDNPLSEVTHKRRISALGPGGLSRDRAGFEVRDVHATHYGRLCPIETPEGPNIGLIN
RPOB_RHIL3       FMDQVNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_RHIME       FMDQVNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_AGRFC       FMDQVNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_RHILO       FMDQTNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_CHESB       FMDQTNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_BRUSU       FMDQTNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_BARBK       FMDQTNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_RHOPB       FMDQTNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_GLUOX       FMDQTNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETAGRPNIGLIN
RPOB_GRABC       FMDQTNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_MAGSA       FMDQTNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_RHORT       FMDQTNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_CAUVC       FMDQTNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_MARMM       FMDQTNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_HYPNA       FMDQTNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_RHOS1       FMDQTNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRMCPIETPEGQNIGLIN
RPOB_PARDP       FMDQTNPLSEVTDKRRLSALGPGGLTRERAGFEVRDVHPTHYGRMCPIETPEGQNIGLIN
RPOB_ROSDO       FMDQTNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRMCPIETPEGPNIGLIN
RPOB_JANSC       FMDQTNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRMCPIETPEGPNIGLIN
RPOB_NOVAD       FMDQTNPLSEVTHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_ERYLH       FMDQTNPLSEVTHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_SPHAL       FMDQTNPLSEVTHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_ZYMMO       FMDQTNPLSEVTHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_PELUB       FMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_RICBR       FMDQTNPLSEITHKRRLSALGPGGLSRDRAGFEVRDVHPTHYGRICPIETPEGQNIGLIN
RPOB_ORITB       FMDQTNALSQITHIRRLSALGPGGLNRDRAALEVRDVHPTHYGRICPIETPEGQNIGLIN
RPOB_ANAMM       FMDQTNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGQNIGLIS
RPOB_ANAPZ       FMDQTNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGQNIGLIS
RPOB_EHRRW       FMDQTNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGQNIGLIS
RPOB_NEOSM       FMDQTNPLSEITHKRRISALGPGGLNRGRAGFEVRDVHTTHYGRICATETPEGATIGLIN
RPOB_MAGMM       FMDQTNPLSEITHKRRLSALGPGGMTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIN
RPOB_ANADE       FMDQTNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHSTHYGRICPIETPEGPNIGLIA
RPOB_MYXXD       FMDQTNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIA
RPOB_SYNFM       FMDQTNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIV
RPOB_SYNAS       FMDQTNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPVETPEGPNIGLIV
RPOB_GEOSL       FMDQTNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIA
RPOB_PELPD       FMDQTNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIA
RPOB_PELCD       FMDQTNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIA
RPOB_BDEBA       FMDQTNPLSEITHKRRLSALGPGGLTRDRAGFEVRDVHPTHYGRICPIETPEGPNIGLIA
RPOB_DESPS       FMDQTNALSEVTHKRRLSALGPGGLSRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIV
RPOB_DESVV       FMDQTNALSEVTHKRRLSALGPGGLTRERAGFEVRDVHTSHYGRICPIETPEGPNIGLIV
RPOB_DESAG       FMDQTNALSEVTHKRRLSALGPGGLTRERAGFEVRDVHTSHYGRICPIETPEGPNIGLIV
RPOB_LAWIP       FMDQTNSLSEVTHKRRLSALGPGGLTRERAGFEVRDVHVSHYGRICPIETPEGPNIGLIV
RPOB_KORVE       FMDQTNPLSEITHKRRLSALGPGGLSRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIS
RPOB_SOLUE       FMDQTNPLSEITHKRRLSALGPGGLSRERAGFEVRDVHPTHYGRICPIETPEGPNIGLIS
RPOB_CAMJJ       FMDQTNPLSEVTHKRRLSALGEGGLVKERAGFEVRDVHATHYGRICPVETPEGQNIGLIN
RPOB_CAMFF       FMDQTNPLSEVTHKRRLSALGEGGLVKERAGFEVRDVHPTHYGRICPVETPEGQNIGLIN
RPOB_SULDN       FMDQTNPLSEVTHKRRLSALGEGGLVKERAGFEVRDVHPTHYGRICPIETPEGQNIGLIN
RPOB_BACV8       FMDQTNPLAEITHKRRLSALGPGGLSRERAGFEVRDVHYTHYGRLCPIETPEGPNIGLIS
RPOB_PARD8       FMDQTNPLAEITHKRRLSALGPGGLSRERAGFEVRDVHYTHYGRLCPIETPEGPNIGLIS
RPOB_PORGI       FMDQTNPLAEITHKRRLSALGPGGLSRERAGFEVRDVHYTHYGRLCPIETPEGPNIGLIS
RPOB_FLAPJ       FMDQTNPLAEITHKRRLSALGPGGLSRERAGFEVRDVHYTHYGRLCPIETPEGPNIGLIS
RPOB_GRAFK       FMDQTNPLAEITHKRRLSALGPGGLSRERAGFEVRDVHYTHYGRLCPIETPEGPNIGLIS
RPOB_CYTH3       FMDQTNPLAEITHKRRMSALGPGGLSRERAGFEVRDVHYTHYGRLCTIETPEGPNIGLIS
RPOB_SALRD       FMDQTNALAEMTHKRRMSALGPGGLTRERAGFEVRDVHHTHYGRLCPIETPEGPNIGLML
RPOB_PELLD       FMDQTNPLAEMTNKRRVSALGPGGLTRERAGFEVRDVHYTHYGRLCPIETPEGPNIGLIS
RPOB_CHLPD       FMDQTNPLAEMTNKRRVSALGPGGLTRERAGFEVRDVHYTHYGRLCPIETPEGPNIGLIS
RPOB_CHLCH       FMDQTNPLAEMTNKRRVSALGPGGLTRERAGFEVRDVHYTHYGRLCPIETPEGPNIGLIS
RPOB_CHLTE       FMDQTNPLAEMTNKRRVSALGPGGLTRERAGFEVRDVHYTHYGRLCPIETPEGPNIGLIS
RPOB_CHLMU       FMDQTNPVAELTHKRRLSALGPGGLNRERAGFEVRDVHSSHYGRICPIETPEGPNIGLIT
RPOB_CHLPN       FMDQTNPVAELTHKRRLSALGPGGLNRERAGFEVRDVHASHYGRICPIETPEGPNIGLIT
RPOB_PARUW       FMDQTNPIAELTHKRRLSSLGPGGLNRDRAGFEVRDVHTSHYGRICPIETPEGPNIGLIS
RPOB_RHOBA       VVDQTNPLSQLAHERRLSALGPGGLNRKRAGFEVRDVHISHYGRICPIETPEGTNIGLIS
RPOB_TREDE       FMDQVNPLAELTHKRRLNALGPGGLSRDRAGFEVREVHYTHYGRMCPIETPEGPNIGLIV
RPOB_TREPA       FMDQVNPLAELTHKRRLNALGPGGLSRERAGFEVRDVHYTHYGRMCPIETPEGPNIGLIV
RPOB_BORAP       FMDQVNPLAELTHKRRLNALGPGGLSRDRAGFEVRDVHYTHYGRMCPIETPEGPNIGLIV
RPOB_LEPBL       FMDQTNPLAELTHKRRLNALGPGGLSRDRAGMEVRDVHYSHYGRMCPIETPEGPNIGLIL
RPOB_FUSNN       FMDQSNPLAELTHKRRISALGPGGLSRERAGFEVRDVHDSHYGRICPIETPEGPNIGLIG
RPOB_CYAM1       FMDQINPLAELTHKRRISALGAGGLTRERAGFAVRDIHPSHYGRICPIETPEGPNAGLIG
RPOB_AQUAE       YLDNTNPLSELTHKRRLSALGPGGLTRESAKFEIRDVHPSHYGRICPIETPEGQNIGLVT
RPOB_DEIRA       FKDQTNPLSDLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPIETPEGANIGLIS
RPOB_DEIGD       FKDQTNPLSDLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPIETPEGANIGLIS
RPOB_THET8       FKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLIT
RPOB_THEMA       FMDQVNPLSELTHKRRVSAVGPGGLRRESKVFEARNVHYSQYGRLCPIETPEGANIGFIT
RPOB_BACCR       FMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMCPIETPEGPNIGLIN
RPOB_BACSU       FMDQTNPLAELTHKRRLSALGPGGLTRERAGMEVRDVHYSHYGRMCPIETPEGPNIGLIN
RPOB_BACHD       FMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMCPIETPEGPNIGLIN
RPOB_GEOTN       FMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMCPIETPEGPNIGLIN
RPOB_OCEIH       FMDQTNPLGELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMCPIETPEGPNIGLIN
RPOB_LISIN       FMDQTNPLGELTHKRRLSALGPGGLTRERAGYEVRDVHYSHYGRMCPIETPEGPNIGLIN
RPOB_STAS1       FMDQANPLAELTHKRRLSALGPGGLTRERAQMEVRDVHYSHYGRMCPIETPEGPNIGLIN
RPOB_STRS2       FMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLIN
RPOB_LACLA       FMDQHNPLSELSHKRRFSALGPGGISRDRASYEVRDVHYTHYGRMCPIETPEGPNIGLIN
RPOB_LACGA       FMDQNNPLGELTHKRRMSALGPGGLSRDRAGYEVRDVHYTHYGRLCPIETPEGPNIGLIN
RPOB_LACAC       FMDQHNPLGELTHKRRMSALGPGGLTRDRAGYEVRDVHYTHYGRLCPIETPEGPNIGLIN
RPOB_LACDB       FMDQNNPLGELTHKRRMSALGPGGLSRDRAGYEVRDVHYTHYGRLCPIETPEGPNIGLIN
RPOB_LACPL       FMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLIN
RPOB_LACBA       FMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLIN
RPOB_PEDPA       FMDQTNPLGELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLIN
RPOB_LACS1       FMDQTNPLGELSHKRRFSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLIN
RPOB_LACSS       FMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLIN
RPOB_LACP3       FMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLIN
RPOB_ENTFA       FMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYSHYGRMCPIETPEGPNIGLIN
RPOB_LEUMM       FMDQTNPLGEMNHKRRLSALGPGGLTRDRAGVEVRDVHYTHYGRIDPIETPEGPNIGLIN
RPOB_OENOB       FMDQTNPLGELNHKRRLSALGPGGLTRDRAGYEVRDVHYSHYGRIDPIETPEGPNIGLIT
RPOB_CARHZ       FMDQTNPLAELTHKRRLSALGPGGLSRERAGFEVRDVHHSHYGRMCPIETPEGPNIGLIG
RPOB_MOOTA       FMDQTNPLAELTHKRRLSALGPGGLSRERAGFEVRDVHTSHYGRMCPIETPEGPNIGLIG
RPOB_SYMTH       FMDQTNPLAELTNKRRLSALGPGGLSRERAGYEVRDVHTSHYGRMCPIETPEGPNIGLIG
RPOB_DESHY       FMDQTNPLAELTHKRRLSALGPGGLSRERAGFEVRDVHHSHYGRMCPIETPEGPNIGLIG
RPOB_CLOAB       FMDQINPLSELTHKRRLSALGPGGLSRERAGFEVRDVHHSHYGRMCPIETPEGPNIGLIN
RPOB_CLONN       FMDQTNPLSELTHKRRLSALGPGGLSRERAGFEVRDVHHSHYGRMCPIETPEGPNIGLIN
RPOB_CLOPS       FMDQTNPLSELTHKRRLSALGPGGLSRERAGFEVRDVHHSHYGRMCPIETPEGPNIGLIN
RPOB_CLOTE       FMDQTNPLSELTHKRRLSALGPGGLSRERAGFEVRDVHHSHYGRMCPIETPEGPNIGLIN
RPOB_HUNT2       FMDQTNPLAELTHKRRLSALGPGGLSRERAGFEVRDVHHSHYGRMCPIETPEGPNIGLIG
RPOB_CLOD6       FMDQTNPLSELTHKRRLSALGPGGLSRERAGFEVRDVHHSHYGRMCPIETPEGPNIGLIN
RPOB_CALS4       FMDQTNPLSELTHKRRVSALGPGGLSRERAGFEVRDVHYSHYGRICPIETPEGPNIGLIT
RPOB_SYNWW       FMDQTNPLAELTHKRRLSALGPGGLTRERAGFQVRDVHHSHYGRICPIETPEGPNIGLIG
RPOB_ONYPE       FMDQINPLAELTQKRRVSALGIGGINRDRAGIEVRDVHNSHYGRLCPIETPEGPSIGLIT
RPOB_COREF       FMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPIETPEGPNIGLIG
RPOB_CORDI       FMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHASHYGRMCPIETPEGPNIGLIG
RPOB_CORJK       FLDQNNSLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIG
RPOB2_NOCFA      FMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIG
RPOB_RHOJR       FMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIG
RPOB_MYCS2       FMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIG
RPOB1_NOCFA      FMDQRNPLASLTNKRRLSALGPGGLSRERAGLEVRDVHYSHYGRMCPIETPEGPNIGLMG
RPOB_SACEN       FMDQTNPIAGLTHKRRLSALGPGGLSRERAGMEVRDVHPSHYGRMCPIETPEGPNIGLIG
RPOB_FRAAA       FMDQTNPLAGLTHKRRLSALGPGGLSRERAGFEVRDVHPSHYGRMCPIETPEGPNIGLIG
RPOB_STRCO       FMDQNNPLSGLTHKRRLNALGPGGLSRERAGFEVRDVHPSHYGRMCPIETPEGPNIGLIG
RPOB_THEFY       FMDQTNPLAGLTHKRRLSALGPGGLSRERAGFEVRDVHPSHYGRMCPIETPEGPNIGLIG
RPOB_ACIC1       FMDQTNPLAGLTHKRRLNALGPGGLSRERAGFEVRDVHPSHYGRMCPIETPEGPNIGLIG
RPOB_NOCSJ       FMDQTNPIAGLTHKRRLSALGPGGLSRDRAGMEVRDVHPSHYGRMCPIETPEGPNIGLIG
RPOB_ARTS2       FMDQNNPLSGLTHKRRLSALGPGGLSRDRAGMEVRDVHPSHYGRMCPIETPEGPNIGLIG
RPOB_LEIXX       FMDQNNPLAGLTHKRRLSALGPGGLSRERAGVEVRDVHPSHYGRMCPIETPEGPNIGLIG
RPOB_CUTAK       FMDQNNPLAEMTHKRRLSALGPGGLSRDRAGMEVRDVHPSHYGRMCPIETPEGPNIGLIG
RPOB_BIFAA       FMDQNNPLAGVTNKRRLSALGPGGLSRDRASMEVRDVHPSHFGRMCPIESPEGPNIGLIG
RPOB_TROWT       FMDQNNPLAGLTHKRRLSALGPGGLSRERAGVEVRDVNPSHYGRMCPIETPEGPNIGLIG
RPOB_RUBXD       FMDQTNTLAGLSHRRRLNAMGAGGLSRERAPIEVRDVHPTHYGRMCPIETPEGPNIGLIG
RPOB_DEHMC       FMDQTNPLAEITNKRRLSAMGPGGLSRERAGFDVRDVHYSHYGRICPIETPEGPNIGLIG
RPOB_MYCMS       FMDQINPLSELTNKRRLTALGSGGLSRDRAGLEVRDVHPSHYGRICPIETPEGPNIGLIN
RPOB_MESFL       FMDQINPLAELTNKRRLTALGPGGLSRDRASLEVRDVHPSHYGRICPIETPEGPNIGLIN
RPOB_MYCMO       FMDQVNPLAEISNKRRVTSLGPGGLNRETAQFEVRDVHSTHYGRICPIETPEGPNIGLIL
RPOB_MYCPU       FMDQTNPLSEISTKRKITSLGPGGLNRDTAQFEVRDVHATHYGRICPIETPEGPNIGLIL
RPOB_MYCS5       FMDQINPLAEISNKRRVTSLGPGGLNRDTAQFEVRDVHSTHYGRICPIETPEGPNIGLIL
RPOB_MYCH2       FMDQINPLGEMASKRKVTSLGPGGLNRDTAQFEVRDVHTTHYGRICPVETPEGQNIGLIL
RPOB_CITSI       VLDRTNPLTQIVHGRKLSYLGPGGLTGRTASFRVRDIHPSHYGRICPIDTSEGINVGLIG
RPOB_POPTR       VLDRTNPLTQIVHGRKSSYLGPGGLTGRTASFRIRDIHPSHYGRICPIDTSEGINVGLIG
RPOB_AETGR       VLDRTNPLTQIVHGRKLSYLGPGGLTGRTANFRIRDIHPSHYGRICPIDTSEGINVGLIG
RPOB_OENEH       VLDRTNPLTQIVHGRKLSYLGPGGLTARTASFRMRDIHPSYYGRICPIDTSEGINVGLIG
RPOB_NYMAL       VLDRTNPLTQIVHGRKSSYLGPGGLTGRTASFRIRDIHPSHYGRICPIDTSEGINVGLIG
RPOB_PIPCE       VLDRTNPLTQIVHGRKSSYLGPGGLTGRTASFRIRDIHTSHYGRICPIDTSEGINVGLIG
RPOB_PHAAO       VLDRTNPLTQIVHGRKWSYLGPGGLTGRTASFRIRDIHPSHYGRICPIDTSEGINVGLMG
RPOB_DIOEL       VLDRTNPLTQIAHGRRLSYLGPGGLTGRTASFRIRDIHPSHYGRICPIDTSEGINVGLIG
RPOB_PHAVU       VLDQTNPLTEIVHGRKLSYLGPGGLTGRTASFRIRDIHPSHYGRICPIDTSEGINVGLIG
RPOB_LOTJA       VLDRTNPLTQIVHGRKLSYLGPGGLTGRTASFRIRDIHSSHYGRICPIDTSEGINVGLIG
RPOB_JASNU       VLDQTNPLTQIVHGRKWSYLDPGGLTGRTASFRIRDIHPSHYGRICPIDTSEGINVGLIG
RPOB_LACSA       VLDRTNPLTQIVHGRKLSYLGPGGLTARTATFPIRDIHPSHYGRICPIDTSEGINVGLIG
RPOB_SACHY       VFDQTNPLTQTVHGRKVSCLGPGGLTGRTASFRSRDIHPSHYGRICPIDTSEGINVGLTG
RPOB_PELHO       VFDETNPLTHIVHGRKWSFLGPGGLTERTARFRVRDIHPSNYGRICPIDTSEGIKVGLIG
RPOB_ANTAG       FLDQTNPLTEVVHKRRLSSLGPGGLTRRTASFQVRDIHPSHYGRICPIETSEGMNAGLVA
RPOB_MARPO       FLDQTNPLTEIVHKRRLSSLGPGGLTRRTASFQVRDIHASHYGRICPIETSEGMNAGLIA
RPOB_PHYPA       FLDQTNSLAEIVHKRRLSSLGPGGVTRRTAGFQVRDIHFSHYTRICPIETSEGMNAGLIA
RPOB_PSINU       FLDQTNPLAEMIHKRRLSTLGPGGLTRRTASFQVRDIHPSYYGRICPIETSEGINAGLIT
RPOB_ANGEV       FLDQTNPLAELTHKRRLSSLGPGGLTRRTASFQVRDINPSHYGRICPIETSEGMNAGLIA
RPOB_PINTH       FLDQTNPLTEIAHGRKLSHLGPGGLTGRTASFRTRDIHPSYYGRICPIDTSEGMNAGLVA
RPOB_CYCTA       FLDQTNPLTEIVHRRKLSYLGPGGLTGRTASSRIRDIHPSHYGRICPIETSEGMNAGLVA
RPOB_ADICA       FLDQTNPLSEMVHKRRLSSVGPGGLTRRTASFQARDIHFSHYGRICPIETSEGMNAGLIS
RPOB_HUPLU       FLDQTNPLTQVIHKRRFSSLGPGGLTKRIASIKARDIHPSIYGRICPIETSEGMNAGLIS
RPOB_CHAGL       FLDQTNSLTELVHKRRISSLGPGGLTRRTASFHVRDIHPSHYGRICPIETSEGMNAGLVA
RPOB_CHAVU       FMDQTNPLAEITHKRRISSLGPGGLTQKTATFNVRDIHPSHYGKICPIETPEGQNAGLVS
RPOB_STAPU       FLDQTNPLAEMAHKRKLSLLGPGGLTRRTASFRTRDIHPSHYGRICTIETSEGMNAGVIP
RPOB_ZYGCR       FLDQTNPLSEIVHKRKLSLLGPGGLTPRTARFRVRDIHPSQYGRICPVQTAEGQNAGVVN
RPOB_NEPOL       FMDQTNPLAELTHKRRLSSLGPGGLSQDRAGMAVREIHPSQYGRICPIETPEGPNAGLIG
RPOB_OSTTA       FMDQTNPLAEITHKRRLSSLGPGGLNRDRAGLIVRGIHPSYYGRICPIETPEGKNAGLVG
RPOB_MESVI       FMDQTNPLSEITHKRRLSCLGPGGLSRERAGLAVRDIHPSHYGRICPIETPEGPNAGLIG
RPOB_CHLAT       FMDQTNPLSEMTHKRRISCLGPGGLSKERAGLAVRDIHPSHYGRICPIETPEGPNAGLIG
RPOB_OLTVI       FMDQTNPLAEITHKRRLSSLGPGGVNRETAGMAIRGIHPTHYGRICPIETPEGQNAGLVN
RPOB_BIGNA       FMDEVNPLATLTHKRRLSSLGIGGVNRDTATLTIRSIHPTLYGRICPIETPEGKNAGLVN
RPOB_PHATC       YLDQTNPLSSLTHRRRVSGLGPGGFDRDRISFAVRDIHPSHYGRICPIETPEGQNVGLIA
RPOB_THAPS       YMDQTNPLSSLTHRRRISGLGPGGFDRDRISFAVRDIHPSHYGRICPIETPEGQNVGLIA
RPOB_TRIV2       FMDQTNPLAELTHKRRLSALGPGGLTRERAGFAVRDIHPSHYGRICPIETPEGPNAGLIG
RPOB_TRIEI       FMDQTNPLAELTHKRRISALGPGGLTRERAGFAVRDIHPSHYGRICPIETPEGPNAGLIG
RPOB_SYNY3       FMDQTNPLAELTHKRRISALGPGGLTRERAGFAVRDIHPSHHGRICPVETPEGPNAGLIG
RPOB_SYNE7       FMDQTNPLAELTHKRRLSALGPGGLTRERAGFAVRDIHPSHYGRICPIETPEGPNAGLIG
RPOB_THEEB       FMDQTNPLAELTHKRRLSALGPGGLTRERAGFAVRDIHPSHYGRICPIETPEGPNAGLIG
RPOB_SYNJA       FMDQTNPLAELTHKRRLSALGPGGLSRERAGFAVRDIHPSHYGRICPIETPEGPNAGLIG
RPOB_GLOVI       FMDQTNPLAELTHKRRLSALGPGGLTRERAGFAVRDIHPSHYGRICPIETPEGPNAGLIG
RPOB_PROM5       FMDQTNPLAELTHKRRISALGPGGLTRERAGFAVRDIHPSHYGRLCPIETPEGPNAGLIN
RPOB_GUITH       FMDQTNPLAELTHKRRISALGPGGLNRDRAGFGVRDIHPSHYGRICPIETPEGPNAGLIG
RPOB_RHDSA       FMDQTNPLAELTHKRRISALGPGGLNRDRAGFAVRDIHPSHYGRICPIETPEGPNAGLIG
RPOB_PYRYE       FMDQTNPVAELTHKRRISALGPGGFNKDRAGFAVRDLHPSHYGRICPIETPEGPNAGLIG
RPOB_GRATL       FMDQTNPLSELTHKRRISALGPGGLNKDRAGFAVRDLHPSHYGRICPIETPEGPNAGLIG
RPOB_CYAPA       FMDQTNPLAELIHKRRLTILGPGGLSRDRAGCAVRDIHPSHYGRICPIETPEGQNAGLVG
RPOB_CYACA       FMDQVNPLAELTHKRRVSSLGPGGLSKERAGFAVRDIHPSHYGRICPIETPEGPNAGLIG
RPOB_EMIHU       FMDQTNPLAELTHKRRISVLGPGGIARDRAGFVVRDIHPSQYGRICPVETPEGPNAGLIG
RPOB_EUGLO       LLNDLNPLSELTHKRKISTLGIGGIEKNKASTKIREIHNSHYGRICPIETSEGKNAGLVL
                   :  *.:      *: . :. **.         * :: :    : . ::    . *.  

RPOB_MYCGE       SLASFAKIDEN-GFLMAPYRKIKAGV----------------------------------
RPOB_MYCPN       SLASFAKIDEN-GFLMAPYRKIKNGV----------------------------------
RPOB_MYCGA       SLAFYATIDKN-GFLMTPYLKVENGK----------------------------------
RPOB_MYCPE       SLATYASTDEN-GFLITPYRIVKNGV----------------------------------
RPOB_UREPA       SLASLAKVDEN-GFIVAPYYVVEDGV----------------------------------
RPOB_ALKEH       SLATYARTNRY-GFLETPYRRVENGV----------------------------------
RPOB_HALHL       SLAVYARANRY-GFLETAYRKVVDGQ----------------------------------
RPOB_METCA       SLAVYSRTNEY-GFLETPYRKVIDGR----------------------------------
RPOB_XANC8       SLAVFARTNQY-GFLETPYRKVLDGK----------------------------------
RPOB_XYLFT       SLAVFARTNQY-GFLETPYRKVVEGR----------------------------------
RPOB_LEGPA       SLSVYARTNEY-GFIETPCRKVVNGR----------------------------------
RPOB_COXBU       SLAVFARANEY-GFLETPYRKVVDRV----------------------------------
RPOB_NITOC       SLAVYARINQY-GFIETPYRKVVDGK----------------------------------
RPOB_AROAE       SLAVYAQTNRH-GFLETPYRKVVDSK----------------------------------
RPOB_AZOSB       SLAVYARTNRH-GFLETPYRKVTDGK----------------------------------
RPOB_METFK       SLALYSRTNQY-GFLETPYRRVADNK----------------------------------
RPOB_NITEC       SLALYARTNEY-GFIETPYRMVKNSR----------------------------------
RPOB_NITMU       SLALYAQTNEY-GFMETPYRKVTDGL----------------------------------
RPOB_THIDA       SLALFARTNWY-GFIETPYRKVVDNK----------------------------------
RPOB_DECAR       SLALFAQVNSY-GFIETAYRKVNNGQ----------------------------------
RPOB_PARXL       SLALYAHLNEY-GFLETPYRKVVDSK----------------------------------
RPOB_HERAR       SLALYARLNEY-GFLETPYRKVEGSK----------------------------------
RPOB_RALSO       SLALYAQLNDY-GFLETPYRKVENSK----------------------------------
RPOB_BORA1       SMALYARLNEY-GFLETPYRKIIDGR----------------------------------
RPOB_RHOFT       SLALYARLNDY-GFIETPYRRVVDGK----------------------------------
RPOB_POLSJ       SLALYARLNEY-GFIETPYRRVVDSK----------------------------------
RPOB_VEREI       SLALYARLNEY-GFIETPYRRVVGGM----------------------------------
RPOB_METPP       SLALYAQLNEY-GFLETPYRRVIDSK----------------------------------
RPOB_NEIG1       SLSVYARTNDY-GFLETPYRRVIDGK----------------------------------
RPOB_CHRVO       SLSVYARTNEF-GFLETPYRKVVDGK----------------------------------
RPOB_ACIBT       SLSVYAKANDF-GFLETPYRKVIDGR----------------------------------
RPOB_PSYCK       SLATFAKTNSF-GFLETPYRRVVDGK----------------------------------
RPOB_HAHCH       SLATYARTNTY-GFLESPYRKVVDGL----------------------------------
RPOB_MARHV       SLATYARSNSY-GFLESPYRKVVDGV----------------------------------
RPOB_SACD2       SLATYARTNSY-GFLESPHRKVVDGK----------------------------------
RPOB_PSEU5       SLAAYARTNQY-GFLESPYRVVKDGE----------------------------------
RPOB_CHRSD       SLATYSHTNSY-GFLETPYRKVVDRQ----------------------------------
RPOB_ALCBS       SLATYARANEY-GFLESPYLKVIDGK----------------------------------
RPOB_SODGM       SLSVYAQTNEY-GFLETPYRRVQDGV----------------------------------
RPOB_ECOLI       SLSVYAQTNEY-GFLETPYRKVTDGV----------------------------------
RPOB_BAUCH       SLSVYAKTNEY-GFLETPYRLVHNSV----------------------------------
RPOB_BLOFL       SLSVYARTNKY-GFLETPYRRVCDGK----------------------------------
RPOB_BLOPB       SLSVYARANKY-GFLETPYRKVQNGV----------------------------------
RPOB_BUCAI       SLSVYAQTNSH-GFLETPYRKVCNGL----------------------------------
RPOB_BUCAP       SLSVYARTNSY-GFLETPYRKVHNRL----------------------------------
RPOB_BUCBP       SLSVYAQTNSY-GFLETPYRKIHNGK----------------------------------
RPOB_WIGBR       SLSVYARTNEY-GFLETPYRCVLNGI----------------------------------
RPOB_BUCCC       SLSIYARTNQY-GFLETPYRKVKNGT----------------------------------
RPOB_ACTP2       SLSVYARTNNY-GFLETPFRKVVNGQ----------------------------------
RPOB_MANSM       SLSVYARTNNY-GFLETPYRKVVDGQ----------------------------------
RPOB_HAEI8       SLSAFARTNDY-GFLETPYRKVVDGQ----------------------------------
RPOB_ALIF1       SLSAFAQCNEY-GFLETPYRRVVDGQ----------------------------------
RPOB_PHOPR       SLSVYARCNSY-GFLETPYRKVVDSK----------------------------------
RPOB_VIBCH       SLSAFARCNEY-GFLETPYRRVVNGV----------------------------------
RPOB_AERS4       SLSVYSRTNEY-GFLETPYRKVIDGV----------------------------------
RPOB_COLP3       SLSCYARTNDF-GFLETPYRKVIDGL----------------------------------
RPOB_PSEA6       SLASFARTNDF-GFLETPYRKIVDGV----------------------------------
RPOB_PSEHT       SLSTYARTNDY-GFLETPYRKVVDGV----------------------------------
RPOB_SHEAM       SLATFARTNSY-GFLETPYRKVVDGV----------------------------------
RPOB_IDILO       SLSTFSRTNEY-GFLETPYRRIENGS----------------------------------
RPOB_PSYIN       SLATFSRTNSY-GFLETPYRKVENGK----------------------------------
RPOB_DICNV       SLAVYARTNEY-GFLETPYRKVIDGK----------------------------------
RPOB_HYDCU       TLAIYAKTNKY-GFLETPYRKVIDGQ----------------------------------
RPOB_VESOH       TLAVYAKTNSY-GFLETPYQIVKNGK----------------------------------
RPOB_FRATO       SLASYARVNDY-GFLEAPYRKVVDGK----------------------------------
RPOB_RHIL3       SLATFARVNKY-GFIESPYRRIVDGK----------------------------------
RPOB_RHIME       SLATFARVNKY-GFIESPYRKIVDGK----------------------------------
RPOB_AGRFC       SLATFARVNKY-GFIESPYRKIIDGK----------------------------------
RPOB_RHILO       SLATFARVNKY-GFIESPYRKIVDGK----------------------------------
RPOB_CHESB       SLATFARVNKY-GFIETPYRKIVDGK----------------------------------
RPOB_BRUSU       SLATFARVNKY-GFIESPYRKVVDGK----------------------------------
RPOB_BARBK       SLATFARVNKY-GFIESPYRKITDGK----------------------------------
RPOB_RHOPB       SLATFARVNKY-GFVETPYRRCKDGR----------------------------------
RPOB_GLUOX       SLSTYAKVNKY-GFIETPYRLVEEGV----------------------------------
RPOB_GRABC       SLATYAKVNKY-GFIETPYRMVEDGK----------------------------------
RPOB_MAGSA       SLATYARVNQY-GFIEAPYRKVFDGR----------------------------------
RPOB_RHORT       SLATFARVNQY-GFIESPYRKVVEGT----------------------------------
RPOB_CAUVC       SLATHARVNKY-GFIESPYRRVKDGK----------------------------------
RPOB_MARMM       SLSTFARVNKY-GFIESPYRKVENGK----------------------------------
RPOB_HYPNA       SLATHARVNKY-GFIESPYRRVKDAK----------------------------------
RPOB_RHOS1       SLATFARVNKY-GFIETPYRKVVEGA----------------------------------
RPOB_PARDP       SLATFARVNKY-GFIETPYRKVVEGK----------------------------------
RPOB_ROSDO       SLATFARVNKY-GFIETPYRKVENRM----------------------------------
RPOB_JANSC       SLATYARVNKY-GFIETPYRRVNDAV----------------------------------
RPOB_NOVAD       SLSTFARVNKY-GFIETPYRKVVDGK----------------------------------
RPOB_ERYLH       SLSTFARVNKY-GFIETPYRVVKDGK----------------------------------
RPOB_SPHAL       SLATFARVNKY-GFIETPYRRVVDGK----------------------------------
RPOB_ZYMMO       SLATFSRINKY-GFIETPYRKVVDHK----------------------------------
RPOB_PELUB       SLSTYAKINKY-GFIESPYKKVLNGI----------------------------------
RPOB_RICBR       SMATYARINKH-GFIESPYRKVKDGH----------------------------------
RPOB_ORITB       SLAIFAKINRY-GFIESPYRRVINRR----------------------------------
RPOB_ANAMM       SLAIYAKINKY-GFIESPYRKVENRV----------------------------------
RPOB_ANAPZ       SLAIYAKINKY-GFIESPYRKVIDGV----------------------------------
RPOB_EHRRW       SLAIYARINKH-GFIESPYRKVDNGV----------------------------------
RPOB_NEOSM       SLAIYAKINKY-GFIETPYRYVRDGR----------------------------------
RPOB_MAGMM       SLSTYARINEF-GFIESPYRQVKEGT----------------------------------
RPOB_ANADE       SLSTYARVNEY-GFVETPYRKVEKGR----------------------------------
RPOB_MYXXD       SLSTYARVNEF-GFVETPYRKVEAGV----------------------------------
RPOB_SYNFM       SLSTYARVNPY-GFIETPYRKVDGSS----------------------------------
RPOB_SYNAS       SLSTYARVNEF-GFIETPYRIVKEGR----------------------------------
RPOB_GEOSL       SLSTYARINEH-GFVETPYRIVQDGK----------------------------------
RPOB_PELPD       SLSTYARINDH-GFVETPYRIVLDGK----------------------------------
RPOB_PELCD       SLSTYARINEH-GFVETPYRIVEQGK----------------------------------
RPOB_BDEBA       SLATYARINNY-GFIETPYRKVEAGQ----------------------------------
RPOB_DESPS       SLATYARVNPY-GFIETPYRKVENRV----------------------------------
RPOB_DESVV       SLTTYAKVNDF-GFIETPYRIIREGA----------------------------------
RPOB_DESAG       SLTTYAKVNDF-GFIETPYRVVRDGQ----------------------------------
RPOB_LAWIP       SLTTYAKVNDY-GFIETPYRVVRNGY----------------------------------
RPOB_KORVE       SLSCYARINDY-GFIESPYRRVKGGR----------------------------------
RPOB_SOLUE       SLSCFARINEY-GFIESPYRKVIKGA----------------------------------
RPOB_CAMJJ       TLSTYAKVNEL-GFVEAPYRKVVNGK----------------------------------
RPOB_CAMFF       TLSTYAKVNDL-GFVESPYRRVIDGK----------------------------------
RPOB_SULDN       TLATYSKVNEH-GFIEAPYKVMKEGK----------------------------------
RPOB_BACV8       SLCVYAKINEL-GFISTPYRKVADGK----------------------------------
RPOB_PARD8       SLCVYAKINDL-GFISTPYRKVADGK----------------------------------
RPOB_PORGI       SLCVYAKISDL-GFITTPYREVKNGK----------------------------------
RPOB_FLAPJ       SLGVYAKVNGM-GFIETPYRKVTNGV----------------------------------
RPOB_GRAFK       SLSVYAKVNGM-GFIETPYRSVTDGK----------------------------------
RPOB_CYTH3       SLCVHAKVNSM-GFIETPYRKVIDGI----------------------------------
RPOB_SALRD       SLCVHSTINDF-GFLETPYRVVEDGR----------------------------------
RPOB_PELLD       SLSVYAEINDK-GFIQTPYRVVEKGH----------------------------------
RPOB_CHLPD       SLSVYAEINDK-GFIQTPYRVVTNGV----------------------------------
RPOB_CHLCH       SLSVYAEINDK-GFIQTPYRLVDNGQ----------------------------------
RPOB_CHLTE       SLSVYAEINDK-GFIQTPYRVVENGQ----------------------------------
RPOB_CHLMU       SLSSFAKINEF-GFIETPYRVVRDGI----------------------------------
RPOB_CHLPN       SLSSFAKINEF-GFIETPYRIVRDGI----------------------------------
RPOB_PARUW       SLSSFAKINEF-GFIETPYRIVREGV----------------------------------
RPOB_RHOBA       SLAIYAGVDDY-GFLCTPFRKVIDGK----------------------------------
RPOB_TREDE       SMANYARVNEY-GFLEAPYVKVVNGV----------------------------------
RPOB_TREPA       SMANYARVNGY-GFLEVPYVRVRDGV----------------------------------
RPOB_BORAP       SLATYSRVNDY-GFLETPYRKVVNGE----------------------------------
RPOB_LEPBL       SMSSYARVNDY-GFLETPYRTVKNGK----------------------------------
RPOB_FUSNN       SLATYAKINKY-GFIETPYVKVENGVA---------------------------------
RPOB_CYAM1       SLAIFARVNRY-GFIETPYYPVKKGQ----------------------------------
RPOB_AQUAE       SPTVYARVNEY-GFLITPYRKVENGK----------------------------------
RPOB_DEIRA       SLSSYAKVNDL-GFIMAPYRKVEDGK----------------------------------
RPOB_DEIGD       SLSSYAKVNDL-GFIEAPYRRVVDGR----------------------------------
RPOB_THET8       SLAAYARVDEL-GFIRTPYRRVVGGV----------------------------------
RPOB_THEMA       SLAIYAKIDEY-GFLMTPYRKVVNGK----------------------------------
RPOB_BACCR       SLSSFAKVNEF-GFIETPYRRVDPET----------------------------------
RPOB_BACSU       SLSSYAKVNRF-GFIETPYRRVDPET----------------------------------
RPOB_BACHD       SLSTYAKVNEF-GFMETPYRRVDPET----------------------------------
RPOB_GEOTN       SLSTYAKVNKF-GFIETPYRRVDPET----------------------------------
RPOB_OCEIH       SLSSYAKVNKF-GFIESPYRRVDPET----------------------------------
RPOB_LISIN       SLSSFAKVNKF-GFIETPYRRVDPET----------------------------------
RPOB_STAS1       SLSSYARVNEF-GFIETPYRKVDLET----------------------------------
RPOB_STRS2       NLSSYGHLNKY-GFIQTPYRKIDRAT----------------------------------
RPOB_LACLA       NLSSYAKVNEY-GFIMSPYRRVDRVN----------------------------------
RPOB_LACGA       SLATYAIVNKY-GFIETPYRRVSWDT----------------------------------
RPOB_LACAC       SLASYAIINKY-GFIETPYRRVSWDT----------------------------------
RPOB_LACDB       SMATYAIINKY-GFLETPYRRVSWAT----------------------------------
RPOB_LACPL       SLSSYAKVNRS-GFIETPYRRVDWTT----------------------------------
RPOB_LACBA       SLSSYARVNKY-GFIETPYRRVSWDT----------------------------------
RPOB_PEDPA       NLASYGKINRY-GFIETPYRRVSWED----------------------------------
RPOB_LACS1       SLSSYARINKY-GFVETPYRRVSWET----------------------------------
RPOB_LACSS       SLASYAVVNRY-GFIETPYRRVSWDT----------------------------------
RPOB_LACP3       SLASYAVVNPY-GFIETPYRRVSWDT----------------------------------
RPOB_ENTFA       SLSSYAKVNKF-GFIETPYRRVDRAT----------------------------------
RPOB_LEUMM       SLATYGRINKY-GFVETPYRRVDWTT----------------------------------
RPOB_OENOB       SLAVYGRINEY-GFIETPYRRVDWDT----------------------------------
RPOB_CARHZ       NLTTYARVNEF-GFIETPYRKVDKER----------------------------------
RPOB_MOOTA       SLSTYARINEF-GFIETPYRRVDKEK----------------------------------
RPOB_SYMTH       ALATFARINEY-GFIETPYRKVDQES----------------------------------
RPOB_DESHY       SLSTYGRINPY-GFIEAPYRKVNN------------------------------------
RPOB_CLOAB       SLATYAKVNEY-GFVETPYRTVDKEQ----------------------------------
RPOB_CLONN       SLACYAKVNEY-GFIETPYRLVDKKE----------------------------------
RPOB_CLOPS       SLATYAKVNEY-GFIETPYRVVDKSE----------------------------------
RPOB_CLOTE       SLATYAKVNEY-GFIETPYRKVDKAT----------------------------------
RPOB_HUNT2       SLSTYARVNEY-GFIETPYRKVSKEEP---------------------------------
RPOB_CLOD6       SLGTYAKINEF-GFIESPYRKFDKET----------------------------------
RPOB_CALS4       SLTTYARVNEY-GFIETPYRKVDKAT----------------------------------
RPOB_SYNWW       YLATFGQVNDF-GFIETPYRKVDKKL----------------------------------
RPOB_ONYPE       SLSTYAKVNKY-GFIQTPFFKVLHQDGK--------------------------------
RPOB_COREF       SLASYARVNPF-GFIETPYRRVIDGK----------------------------------
RPOB_CORDI       SLASYARVNAF-GFIETPYRKVENGV----------------------------------
RPOB_CORJK       SLSSYARVNPF-GFIETPYRKVVDGQ----------------------------------
RPOB2_NOCFA      SLSVYARVNPF-GFIETPYRKVVDGR----------------------------------
RPOB_RHOJR       SLSVYARVNPF-GFIETPYRKVENGQ----------------------------------
RPOB_MYCS2       SLSVYARVNPF-GFIETPYRKVENGV----------------------------------
RPOB1_NOCFA      YLSVYARVNPF-GFVETPYRRVVDGR----------------------------------
RPOB_SACEN       SLATFARVNPF-GFIETPYRKVVDGR----------------------------------
RPOB_FRAAA       SLSTFARVNPF-GFVETPYRKVVNGR----------------------------------
RPOB_STRCO       SLASYGRINPF-GFIETPYRKVVEGQ----------------------------------
RPOB_THEFY       SLAAYARVNSF-GFIETPYRKVVDGR----------------------------------
RPOB_ACIC1       SLATHGRVNAF-GFVETPYRKVINGR----------------------------------
RPOB_NOCSJ       SLASYGRINPF-GFVETPYRKVTKGK----------------------------------
RPOB_ARTS2       SLASYGRINPF-GFIETPYRLVSEGV----------------------------------
RPOB_LEIXX       SLASFARINSF-GFIETPYRKVVDGL----------------------------------
RPOB_CUTAK       SLASFARVNAF-GFIETPYRKVVDGH----------------------------------
RPOB_BIFAA       SLATFGRINPF-GFIETPYRKVVNGH----------------------------------
RPOB_TROWT       SLACYSRVNSF-GFIETPYRRVVNGK----------------------------------
RPOB_RUBXD       QLSTFARVNEY-GFVQTPYRKVEDGR----------------------------------
RPOB_DEHMC       SLATYSRINRY-GFVETPYRKVYSKLKNNDKKLVGLKLKIEISEKGKVLAAAGSTISEDS
RPOB_MYCMS       NLSTYARVNEY-GFITTPYRKVINGI----------------------------------
RPOB_MESFL       NLSTYAIVDEL-GFIRTPYLKVIDGV----------------------------------
RPOB_MYCMO       NFATYAKVNDF-GFIQSPYFKVNDGI----------------------------------
RPOB_MYCPU       NLATYAKVDEY-GFLQTPYFKVTNGI----------------------------------
RPOB_MYCS5       NYAIYSTVNEL-GFLQTPYYKVNDGV----------------------------------
RPOB_MYCH2       NFSVFSRINQY-GFIITPYYQVKNRI----------------------------------
RPOB_CITSI       SLAIHARIGYW-GSLESPFYEIFEKSK---------------------------------
RPOB_POPTR       SLTIHAKIGHL-GSLESPFYEISARSK---------------------------------
RPOB_AETGR       SLAIHARIGDW-GSLESPFYELFEKSKKA-------------------------------
RPOB_OENEH       SLAIHARIGRG-GSLESPFYEISERSN---------------------------------
RPOB_NYMAL       SLAIHARVGDW-GSIETPFYEISERSK---------------------------------
RPOB_PIPCE       SLAIHARVGPW-GSIKTPFYEISERSK---------------------------------
RPOB_PHAAO       SLAIHVKVGYW-GSIESPFYGLSERSK---------------------------------
RPOB_DIOEL       SLAIHVRIGHW-GSIESPFYEISERSK---------------------------------
RPOB_PHAVU       SLAIHARIGIW-GAIESPFFEISERSK---------------------------------
RPOB_LOTJA       SLAIHARIGRW-GSIESPFFEISERSK---------------------------------
RPOB_JASNU       SLAIHAKIGHW-GSLESPFYEISERST---------------------------------
RPOB_LACSA       SLAIHARIGRW-GSLESPFYKISERSK---------------------------------
RPOB_SACHY       SLAIHARIDHWWGSIESPFYEISEKAKEKK------------------------------
RPOB_PELHO       YLATHARIGDC-GSLESPFYEMSEKSK---------------------------------
RPOB_ANTAG       SLAIHAKVDNW-GSLESPFYKISGVSE---------------------------------
RPOB_MARPO       SLAIHAKISIL-GCLESPFYKISKLSN---------------------------------
RPOB_PHYPA       SLAIHANVNNW-GFLESPFYKISKNVK---------------------------------
RPOB_PSINU       SLALHARVNDY-GYLHSSFYNISDD-----------------------------------
RPOB_ANGEV       SLAIHAKVNDR-GSLLSPFYKISKTLG---------------------------------
RPOB_PINTH       SLSIHAKIGDC-GSLQSPFYKISERSR---------------------------------
RPOB_CYCTA       SLAIRARIGHC-GSLQSPFHKISERSE---------------------------------
RPOB_ADICA       SLAIQAGVNTS-GSLGSPYLEMSDSS---G------------------------------
RPOB_HUPLU       SMAIYASIDHW-GFLQSTLHKEYDEVL-FE------------------------------
RPOB_CHAGL       SLASNATINTM-GFIESPFYQLNDSSL---------------------------------
RPOB_CHAVU       SLAILANINQN-GFIESPFLKLHKNEY-KQ------------------------------
RPOB_STAPU       SLSICARVDSE-GVIENPLHKIGGNIK---------------------------------
RPOB_ZYGCR       SFTICAHIGDN-GAIKTSLYKVCTNSM---------------------------------
RPOB_NEPOL       SMATYARLNQY-GGLECPFYQVVEGKVLYE------------------------------
RPOB_OSTTA       SIATFTQINKN-GFLESPYYKLISESNTPD------------------------------
RPOB_MESVI       SLATHSRVNEY-GFLESPFYITKNRKVIK-------------------------------
RPOB_CHLAT       SLATHARVNPY-GFLESPFYPTKNRKVFK-------------------------------
RPOB_OLTVI       SLTIYSRVNPY-GFIETPFYKVVKGQVQN-------------------------------
RPOB_BIGNA       SFALFAEINSE-GLIETPFFRVCNGRILY-------------------------------
RPOB_PHATC       SLTTCARVNKS-GFLETPFWRVINGKVVK-------------------------------
RPOB_THAPS       SLTTCARVNES-GFLETPFWRVINGKVIK-------------------------------
RPOB_TRIV2       SLATHARVNQY-GFLETPFRPVENGRVRF-------------------------------
RPOB_TRIEI       SLANHAKVNSY-GFIETPYYPVENGRVLR-------------------------------
RPOB_SYNY3       SLATCARVNDY-GFIETPYFRVESGRVRK-------------------------------
RPOB_SYNE7       SLATHARVNDY-GFIETPFWRVEEGRVRK-------------------------------
RPOB_THEEB       SLATHARVNEY-GFIETPFYPVKDGRVLK-------------------------------
RPOB_SYNJA       SLATHARVNQY-GFIESPYYRVENGVVRK-------------------------------
RPOB_GLOVI       SLATHARVNSY-GFIETPYKVVKDGRLSG-------------------------------
RPOB_PROM5       SLATHARVNEY-GFIETPFWEVEKGRVIK-------------------------------
RPOB_GUITH       VLATHARINTY-GFIEAPFFKVQDGQVYN-------------------------------
RPOB_RHDSA       VLATHARINSY-GFIETPFYQVINGKVVS-------------------------------
RPOB_PYRYE       SLATCARVNVF-GFIETPFYPVNQGQVIY-------------------------------
RPOB_GRATL       SLSIYAKVNRY-GFIETPCYKVTDGQVLK-------------------------------
RPOB_CYAPA       SLTTHAHLNQY-GFIETPFYKVEKGYIQK-------------------------------
RPOB_CYACA       SLAIYARINPD-GFIEAPFYKVNQGQVLK-------------------------------
RPOB_EMIHU       SLSTYGKINAY-GFIETPFYKVKQGKVLK-------------------------------
RPOB_EUGLO       SLAKDIRINKH-GFIESPFYKVIKGNIK--------------------------------
                         .   * :  .                                          

RPOB_MYCGE       -------------------ITDEVE-----------------------------------
RPOB_MYCPN       -------------------ITDEVE-----------------------------------
RPOB_MYCGA       -------------------ITDKVE-----------------------------------
RPOB_MYCPE       -------------------ITDEIR-----------------------------------
RPOB_UREPA       -------------------VKEDYK-----------------------------------
RPOB_ALKEH       -------------------VTDKVD-----------------------------------
RPOB_HALHL       -------------------VTDQVE-----------------------------------
RPOB_METCA       -------------------VTDQIE-----------------------------------
RPOB_XANC8       -------------------VSDDVE-----------------------------------
RPOB_XYLFT       -------------------VTDEVE-----------------------------------
RPOB_LEGPA       -------------------VTDEVE-----------------------------------
RPOB_COXBU       -------------------VTDETE-----------------------------------
RPOB_NITOC       -------------------VAGEVD-----------------------------------
RPOB_AROAE       -------------------VTDQID-----------------------------------
RPOB_AZOSB       -------------------VTDQID-----------------------------------
RPOB_METFK       -------------------VSDQID-----------------------------------
RPOB_NITEC       -------------------VTEEVV-----------------------------------
RPOB_NITMU       -------------------VTDEIH-----------------------------------
RPOB_THIDA       -------------------VTDEIE-----------------------------------
RPOB_DECAR       -------------------VTSDIE-----------------------------------
RPOB_PARXL       -------------------VTDQID-----------------------------------
RPOB_HERAR       -------------------VTDQID-----------------------------------
RPOB_RALSO       -------------------LTDQVD-----------------------------------
RPOB_BORA1       -------------------VSDQID-----------------------------------
RPOB_RHOFT       -------------------VTMEID-----------------------------------
RPOB_POLSJ       -------------------ITDQID-----------------------------------
RPOB_VEREI       -------------------VTNDID-----------------------------------
RPOB_METPP       -------------------VTDQID-----------------------------------
RPOB_NEIG1       -------------------VTEEID-----------------------------------
RPOB_CHRVO       -------------------VTNEID-----------------------------------
RPOB_ACIBT       -------------------VTDDVE-----------------------------------
RPOB_PSYCK       -------------------VTDVIE-----------------------------------
RPOB_HAHCH       -------------------VTDDIE-----------------------------------
RPOB_MARHV       -------------------VTDEVV-----------------------------------
RPOB_SACD2       -------------------VTDEIE-----------------------------------
RPOB_PSEU5       -------------------VTDEIV-----------------------------------
RPOB_CHRSD       -------------------VTDEVV-----------------------------------
RPOB_ALCBS       -------------------VSEEIE-----------------------------------
RPOB_SODGM       -------------------VTDEIH-----------------------------------
RPOB_ECOLI       -------------------VTDEIH-----------------------------------
RPOB_BAUCH       -------------------VTEEIH-----------------------------------
RPOB_BLOFL       -------------------VSNDIH-----------------------------------
RPOB_BLOPB       -------------------VSNDIH-----------------------------------
RPOB_BUCAI       -------------------VSEEIH-----------------------------------
RPOB_BUCAP       -------------------VTDEIH-----------------------------------
RPOB_BUCBP       -------------------VTNEIK-----------------------------------
RPOB_WIGBR       -------------------VTNNIH-----------------------------------
RPOB_BUCCC       -------------------VTTKIK-----------------------------------
RPOB_ACTP2       -------------------VTEDIE-----------------------------------
RPOB_MANSM       -------------------VTEEIE-----------------------------------
RPOB_HAEI8       -------------------VTEEIE-----------------------------------
RPOB_ALIF1       -------------------VTDQVD-----------------------------------
RPOB_PHOPR       -------------------VTDQID-----------------------------------
RPOB_VIBCH       -------------------VTDEVD-----------------------------------
RPOB_AERS4       -------------------ITDEVD-----------------------------------
RPOB_COLP3       -------------------VTDEID-----------------------------------
RPOB_PSEA6       -------------------VTDEID-----------------------------------
RPOB_PSEHT       -------------------VTDEVD-----------------------------------
RPOB_SHEAM       -------------------VTDDVE-----------------------------------
RPOB_IDILO       -------------------VTDDVD-----------------------------------
RPOB_PSYIN       -------------------PTDQVE-----------------------------------
RPOB_DICNV       -------------------VTDEIE-----------------------------------
RPOB_HYDCU       -------------------VTEEVE-----------------------------------
RPOB_VESOH       -------------------VTKEVI-----------------------------------
RPOB_FRATO       -------------------VTDEIE-----------------------------------
RPOB_RHIL3       -------------------VTSDVL-----------------------------------
RPOB_RHIME       -------------------VTNDVV-----------------------------------
RPOB_AGRFC       -------------------VTTDVI-----------------------------------
RPOB_RHILO       -------------------LTNDVV-----------------------------------
RPOB_CHESB       -------------------VTEEVV-----------------------------------
RPOB_BRUSU       -------------------VTNDVV-----------------------------------
RPOB_BARBK       -------------------VTTEVV-----------------------------------
RPOB_RHOPB       -------------------VTDEVV-----------------------------------
RPOB_GLUOX       -------------------LQDGWK-----------------------------------
RPOB_GRABC       -------------------VSDQWR-----------------------------------
RPOB_MAGSA       -------------------VTSDVV-----------------------------------
RPOB_RHORT       -------------------VTDEVT-----------------------------------
RPOB_CAUVC       -------------------PQDEVV-----------------------------------
RPOB_MARMM       -------------------LTDQVD-----------------------------------
RPOB_HYPNA       -------------------LTEEVV-----------------------------------
RPOB_RHOS1       -------------------VTDDVV-----------------------------------
RPOB_PARDP       -------------------VTDEVV-----------------------------------
RPOB_ROSDO       -------------------VTDEVQ-----------------------------------
RPOB_JANSC       -------------------VSDDVV-----------------------------------
RPOB_NOVAD       -------------------VTKDVI-----------------------------------
RPOB_ERYLH       -------------------VTSEVI-----------------------------------
RPOB_SPHAL       -------------------VTNEVV-----------------------------------
RPOB_ZYMMO       -------------------VTNEVI-----------------------------------
RPOB_PELUB       -------------------VQDKVE-----------------------------------
RPOB_RICBR       -------------------VTDEVV-----------------------------------
RPOB_ORITB       -------------------VTDEVV-----------------------------------
RPOB_ANAMM       -------------------VTDKVE-----------------------------------
RPOB_ANAPZ       -------------------VTDSVE-----------------------------------
RPOB_EHRRW       -------------------VTDKVE-----------------------------------
RPOB_NEOSM       -------------------VTDEVT-----------------------------------
RPOB_MAGMM       -------------------PIDQVD-----------------------------------
RPOB_ANADE       -------------------VTDEVT-----------------------------------
RPOB_MYXXD       -------------------VTNDVA-----------------------------------
RPOB_SYNFM       -------------------ARKDVS-----------------------------------
RPOB_SYNAS       -------------------VLPEVK-----------------------------------
RPOB_GEOSL       -------------------VTSDVK-----------------------------------
RPOB_PELPD       -------------------LTNEVR-----------------------------------
RPOB_PELCD       -------------------VTNEIR-----------------------------------
RPOB_BDEBA       -------------------VSKDIN-----------------------------------
RPOB_DESPS       -------------------ILDDIR-----------------------------------
RPOB_DESVV       -------------------LTDDIK-----------------------------------
RPOB_DESAG       -------------------VTDEVK-----------------------------------
RPOB_LAWIP       -------------------VTDEII-----------------------------------
RPOB_KORVE       -------------------VIDYVQVTHAGDSDYRVGDKMEKSEAQKANEELRGRKKRGI
RPOB_SOLUE       -------------------VVDEVKVLNPGDTDYKVGDIVRRGDMDEANRKLGG-KKQAA
RPOB_CAMJJ       -------------------VTNEVV-----------------------------------
RPOB_CAMFF       -------------------VTNEIV-----------------------------------
RPOB_SULDN       -------------------VTDEIV-----------------------------------
RPOB_BACV8       -------------------VDISDEG----------------------------------
RPOB_PARD8       -------------------VDFSEEG----------------------------------
RPOB_PORGI       -------------------VDFSDNG----------------------------------
RPOB_FLAPJ       -------------------VDLTSV-----------------------------------
RPOB_GRAFK       -------------------INTSEE-----------------------------------
RPOB_CYTH3       -------------------VDVKNQ-----------------------------------
RPOB_SALRD       -------------------VTDRVE-----------------------------------
RPOB_PELLD       -------------------VTDTVV-----------------------------------
RPOB_CHLPD       -------------------VTDTVL-----------------------------------
RPOB_CHLCH       -------------------VTDTVV-----------------------------------
RPOB_CHLTE       -------------------VTDKVV-----------------------------------
RPOB_CHLMU       -------------------VTDEIE-----------------------------------
RPOB_CHLPN       -------------------VTDEIE-----------------------------------
RPOB_PARUW       -------------------VTDEIE-----------------------------------
RPOB_RHOBA       -------------------ISDETV-----------------------------------
RPOB_TREDE       -------------------ATREIE-----------------------------------
RPOB_TREPA       -------------------VTKEIE-----------------------------------
RPOB_BORAP       -------------------VTNELE-----------------------------------
RPOB_LEPBL       -------------------VTGQIE-----------------------------------
RPOB_FUSNN       -------------------LVDDVR-----------------------------------
RPOB_CYAM1       -------------------VQKSIV-----------------------------------
RPOB_AQUAE       -------------------VTDKIE-----------------------------------
RPOB_DEIRA       -------------------VTNQVE-----------------------------------
RPOB_DEIGD       -------------------VTDDVV-----------------------------------
RPOB_THET8       -------------------VTDEVV-----------------------------------
RPOB_THEMA       -------------------VTDEVV-----------------------------------
RPOB_BACCR       ---------------G--LVTGHVD-----------------------------------
RPOB_BACSU       ---------------G--KVTGRID-----------------------------------
RPOB_BACHD       ---------------G--KVTAQID-----------------------------------
RPOB_GEOTN       ---------------G--KVTDQID-----------------------------------
RPOB_OCEIH       ---------------G--KVTNKID-----------------------------------
RPOB_LISIN       ---------------N--RVTDKID-----------------------------------
RPOB_STAS1       ---------------N--SITDQID-----------------------------------
RPOB_STRS2       ---------------G--TVTNEIV-----------------------------------
RPOB_LACLA       ---------------G--VVTDEVE-----------------------------------
RPOB_LACGA       ---------------H--KVTDKID-----------------------------------
RPOB_LACAC       ---------------H--KVTDKID-----------------------------------
RPOB_LACDB       ---------------H--KVTDKID-----------------------------------
RPOB_LACPL       ---------------H--KVTDKID-----------------------------------
RPOB_LACBA       ---------------H--KVTDKID-----------------------------------
RPOB_PEDPA       ---------------H--KVTDRID-----------------------------------
RPOB_LACS1       ---------------H--KVTDKID-----------------------------------
RPOB_LACSS       ---------------H--DVTDKID-----------------------------------
RPOB_LACP3       ---------------H--KVTDKID-----------------------------------
RPOB_ENTFA       ---------------G--RVTDQVD-----------------------------------
RPOB_LEUMM       ---------------H--KVTDKID-----------------------------------
RPOB_OENOB       ---------------H--KVTDKID-----------------------------------
RPOB_CARHZ       ---------------G--VVTNEIV-----------------------------------
RPOB_MOOTA       ---------------G--IVTNQVD-----------------------------------
RPOB_SYMTH       ---------------G--RVTDEIV-----------------------------------
RPOB_DESHY       ---------------G--QVTDQID-----------------------------------
RPOB_CLOAB       ---------------G--RVTDEIH-----------------------------------
RPOB_CLONN       ---------------A--RVTDEIV-----------------------------------
RPOB_CLOPS       ---------------G--RVTGEIR-----------------------------------
RPOB_CLOTE       ---------------G--VVTHDII-----------------------------------
RPOB_HUNT2       ---------------G--KVTNEIV-----------------------------------
RPOB_CLOD6       ---------------S--TVTDEIH-----------------------------------
RPOB_CALS4       ---------------G--TVTDEIV-----------------------------------
RPOB_SYNWW       ---------------G--RVLNEIV-----------------------------------
RPOB_ONYPE       ---------------T--TLSRHID-----------------------------------
RPOB_COREF       -------------------LTDQID-----------------------------------
RPOB_CORDI       -------------------LTDQID-----------------------------------
RPOB_CORJK       -------------------ITDEVY-----------------------------------
RPOB2_NOCFA      -------------------VTDEVV-----------------------------------
RPOB_RHOJR       -------------------VTDQVD-----------------------------------
RPOB_MYCS2       -------------------VTDQID-----------------------------------
RPOB1_NOCFA      -------------------VTDEVD-----------------------------------
RPOB_SACEN       -------------------VTDQID-----------------------------------
RPOB_FRAAA       -------------------VTDQID-----------------------------------
RPOB_STRCO       -------------------VTDDVD-----------------------------------
RPOB_THEFY       -------------------ITDEVV-----------------------------------
RPOB_ACIC1       -------------------VTDQVD-----------------------------------
RPOB_NOCSJ       -------------------VTDQID-----------------------------------
RPOB_ARTS2       -------------------VSDEVQ-----------------------------------
RPOB_LEIXX       -------------------VTDQID-----------------------------------
RPOB_CUTAK       -------------------VTDEVV-----------------------------------
RPOB_BIFAA       -------------------VTDEVE-----------------------------------
RPOB_TROWT       -------------------VTDDIE-----------------------------------
RPOB_RUBXD       -------------------VTDEVE-----------------------------------
RPOB_DEHMC       FKLISKLPECDISVMP--FVSAEVK-----------------------------------
RPOB_MYCMS       -------------------IQNDQ------------------------------------
RPOB_MESFL       -------------------IQNE-------------------------------------
RPOB_MYCMO       -------------------IDYEK------------------------------------
RPOB_MYCPU       -------------------VDFSQ------------------------------------
RPOB_MYCS5       -------------------VDYND------------------------------------
RPOB_MYCH2       -------------------VDYSK------------------------------------
RPOB_CITSI       -------------KVRML------------------------------------------
RPOB_POPTR       -------------KVRML------------------------------------------
RPOB_AETGR       -------------RIRML------------------------------------------
RPOB_OENEH       -------------KGRML------------------------------------------
RPOB_NYMAL       -------------EEQMV------------------------------------------
RPOB_PIPCE       -------------RLQLV------------------------------------------
RPOB_PHAAO       -------------EAQMV------------------------------------------
RPOB_DIOEL       -------------KAQMI------------------------------------------
RPOB_PHAVU       -------------RIRML------------------------------------------
RPOB_LOTJA       -------------RIHML------------------------------------------
RPOB_JASNU       -------------GVQML------------------------------------------
RPOB_LACSA       -------------GARML------------------------------------------
RPOB_SACHY       -------------ERQVV------------------------------------------
RPOB_PELHO       -------------RVRML------------------------------------------
RPOB_ANTAG       -------------EEDMT------------------------------------------
RPOB_MARPO       -------------LEEII------------------------------------------
RPOB_PHYPA       -------------EEKII------------------------------------------
RPOB_PSINU       -------------EEHIV------------------------------------------
RPOB_ANGEV       -------------EEHIV------------------------------------------
RPOB_PINTH       -------------EEHMV------------------------------------------
RPOB_CYCTA       -------------EEHMV------------------------------------------
RPOB_ADICA       -------------EEQLV------------------------------------------
RPOB_HUPLU       -------------EQNQD------------------------------------------
RPOB_CHAGL       -------------FDKPI------------------------------------------
RPOB_CHAVU       -------------LTGSE------------------------------------------
RPOB_STAPU       -------------EQYTV------------------------------------------
RPOB_ZYGCR       -------------QGHVI------------------------------------------
RPOB_NEPOL       -------------FGPIF------------------------------------------
RPOB_OSTTA       -------------RNGFF------------------------------------------
RPOB_MESVI       -------------SELPI------------------------------------------
RPOB_CHLAT       -------------KTLPI------------------------------------------
RPOB_OLTVI       -------------STRPI------------------------------------------
RPOB_BIGNA       -------------EMGIN------------------------------------------
RPOB_PHATC       -------------TGQPV------------------------------------------
RPOB_THAPS       -------------NRNPI------------------------------------------
RPOB_TRIV2       -------------DQPAV------------------------------------------
RPOB_TRIEI       -------------DRTPI------------------------------------------
RPOB_SYNY3       -------------DLDPV------------------------------------------
RPOB_SYNE7       -------------DLAPV------------------------------------------
RPOB_THEEB       -------------DQPPI------------------------------------------
RPOB_SYNJA       -------------DLGMV------------------------------------------
RPOB_GLOVI       -------------EIK--------------------------------------------
RPOB_PROM5       -------------EGKPV------------------------------------------
RPOB_GUITH       -------------HSQPI------------------------------------------
RPOB_RHDSA       -------------DGNPV------------------------------------------
RPOB_PYRYE       -------------HNSPV------------------------------------------
RPOB_GRATL       -------------KDKLY------------------------------------------
RPOB_CYAPA       -------------ELGII------------------------------------------
RPOB_CYACA       -------------NKGII------------------------------------------
RPOB_EMIHU       -------------DLPPI------------------------------------------
RPOB_EUGLO       --------------------KNKG------------------------------------
                                                                             

RPOB_MYCGE       -------YLTALRE--DEHIIAEISSLVNISNDNKILDK--------------EIIGRYR
RPOB_MYCPN       -------YLTALRE--DEHIIAEISSLVNIDENNKILDK--------------EIIGRYR
RPOB_MYCGA       -------HLTALRE--DEYIIAEASSYMDVAKDGTINNE--------------KIIARYR
RPOB_MYCPE       -------WLTALSE--DEYIIA--CSNLNVEK-NKFKED--------------KVLCRYR
RPOB_UREPA       -------YLTAHED--DNYIIAE--SSVQLDENKRILDE--------------QVVARYR
RPOB_ALKEH       -------YLSAIEE--ARYVIAQANARVGEDGR-LMDEL------------ISIRH--G-
RPOB_HALHL       -------YLSAIEE--SRYVIAQANARVDESGY-LADDL------------ISCRH--Q-
RPOB_METCA       -------YLSAIEE--GQYYIAQASASVDENGM-LKDEL------------VSCRH--K-
RPOB_XANC8       -------YLSAIEE--NEYVIAQANALTDAKNM-LTEQF------------VPCRF--Q-
RPOB_XYLFT       -------YLSAIEE--NQYVIAQANTLTDDNGQ-LTESF------------VPCRF--Q-
RPOB_LEGPA       -------YLSAIEE--VDQYIAQSNVELDAQGN-ILADL------------VPCRH--Q-
RPOB_COXBU       -------YLSAIEE--GDYYIAQANTNVDEKGR-LVDDL------------ISCRY--K-
RPOB_NITOC       -------YLSAIEE--GQYVIAQANAAADEEGR-LIDML------------VSCRH--K-
RPOB_AROAE       -------FLSAIEE--GQYVIAQANAEIDADGM-LEGDL------------VSCRH--K-
RPOB_AZOSB       -------FLSAIEE--GQYVIAQANAEIGGDGA-LEGDL------------VSCRH--K-
RPOB_METFK       -------YLSAIEE--SQYMIAQANSELDQDGR-FKEDL------------VSARY--H-
RPOB_NITEC       -------YLSAIEE--SQYVIAQANANFDQTGV-FTDEV------------VSCRH--K-
RPOB_NITMU       -------FLSAIEE--GQYVIAQANAELDGDGR-FTNDI------------VSCRH--K-
RPOB_THIDA       -------YLSAIEE--SKYVIAQANAELDAKGK-FKDDL------------VSCRF--K-
RPOB_DECAR       -------YLSAIEE--GNYVVAQANASLDANGR-LSDDL------------VTCRE--K-
RPOB_PARXL       -------YLSAIEE--GRYVIAQANAAVAEDGS-LTDEL------------VSSRE--A-
RPOB_HERAR       -------YLSAIEE--GRYIIAQANATIDKAGM-LSDEL------------VSARE--A-
RPOB_RALSO       -------YLSAIEE--GKYVVAQANATVDKDGN-LVDEL------------VSAREGSE-
RPOB_BORA1       -------YLSAIEE--SHYVIAQANAALDAEGR-FVDDL------------VACRE--A-
RPOB_RHOFT       -------YLSAIEE--GKFVIAQANAVLDKDGK-LTGEM------------ISARE--A-
RPOB_POLSJ       -------YLSAIEE--GKYVIAQANALLDDSGT-LTGDL------------VSARE--N-
RPOB_VEREI       -------YLSAIEE--GKYVIAQANAVLDKEGR-LTGDL------------VSARE--K-
RPOB_METPP       -------YLSAIEE--GKYVIAQANAGLDKDGK-LIDEL------------VSARE--S-
RPOB_NEIG1       -------YLSAIEE--GRYVIAQANADLDSDGN-LIGDL------------VTCRE--K-
RPOB_CHRVO       -------YLSAIEE--GRYVIAQANAELDGEGA-LIDEL------------VTCRE--K-
RPOB_ACIBT       -------YLSAIEE--VGTVIAQADSAVDKDGN-LTEEF------------VSVR--HQ-
RPOB_PSYCK       -------YLSAIEE--VGTVIAQADSPVTADGA-LSDEM------------VSVR--SY-
RPOB_HAHCH       -------YLSAIEE--SDYVIAQASAAVDENGR-LIDEL------------VTVR--HK-
RPOB_MARHV       -------YLSAIEE--SNYVIAQASAATDEGKR-LTDEL------------VTVR--HQ-
RPOB_SACD2       -------YLSAINE--AKFVIAQASAAQNENGE-LTEEL------------VSVR--FQ-
RPOB_PSEU5       -------FLSAIEE--ADHVIAQASAKLD-GRK-LVDEL------------VAVR--HL-
RPOB_CHRSD       -------HLSAIEE--GDFIIAQASATVDESNK-LTDDL------------VQVR--HK-
RPOB_ALCBS       -------YLSAIEE--AECVIAQVDAKMTEEGG-FEEDF------------VTVR--HR-
RPOB_SODGM       -------YLSAIEE--GNFVIAQANTNLGDDGS-FVDDL------------VTCR--SK-
RPOB_ECOLI       -------YLSAIEE--GNYVIAQANSNLDEEGH-FVEDL------------VTCR--SK-
RPOB_BAUCH       -------YLSAIEE--GNFIIAQANTNLDDKGN-FVEEL------------VTCR--HK-
RPOB_BLOFL       -------YLSAIEE--GDFIIAQANTNLNKDGQ-FIDDL------------ITCR--NK-
RPOB_BLOPB       -------YLSAIEE--GDFVIAQANTNLNSIGE-FIDDL------------VTCR--NK-
RPOB_BUCAI       -------YLSAIEE--GNYIIAQANTNIDKTGF-FTDDL------------VTCR--HK-
RPOB_BUCAP       -------YLSAIEE--GNYVIAQANTNIDKNNY-FIDDL------------VTCR--HK-
RPOB_BUCBP       -------YLSAIEE--GNFIIAQANTNLDETGA-FVEDL------------ITCR--YK-
RPOB_WIGBR       -------YLSAIEE--GKFIIAQANTNLDKNGY-FINEF------------VTCR--NK-
RPOB_BUCCC       -------YLSAIEE--GNYIIAQANTKINKFGK-FYKKF------------VTCR--YN-
RPOB_ACTP2       -------YLSAIEE--GNYVIAQANSNLDENFR-FTDTY------------VTCRG-EH-
RPOB_MANSM       -------YLSAIEE--GNYVIAQANASLDEDFR-FTDAF------------VTCRG-EH-
RPOB_HAEI8       -------YLSVIDE--ANYIIAQANSNLDENNR-FTDAF------------VTARG-ER-
RPOB_ALIF1       -------YLSAIEEG--TFVIAQANAVLTEEGT-FADEL------------IIARQ---K
RPOB_PHOPR       -------YLSAIEE--GQYVIAQANAALETDGS-FSDEL------------ITAR--QK-
RPOB_VIBCH       -------YLSAIEE--GQFVIAQANAKLTEEGG-FADEL------------VTAR--QK-
RPOB_AERS4       -------YLSAIEE--GKYVIAQANAATTEDGR-LKDEL------------IPCR--HK-
RPOB_COLP3       -------YLSAIEE--GNFVIAQANAERNDSNK-LVQDL------------VNCR--HR-
RPOB_PSEA6       -------YLSAIEE--GQFSIAQANVVLDETGR-LADDL------------IPCR--HR-
RPOB_PSEHT       -------YLSAIEE--GQFVIAQANSNLTETNE-FVDEL------------IPCR--HK-
RPOB_SHEAM       -------YLSAIEE--GRYVIAQANIELDGEGR-ILEEQ------------VACR--HK-
RPOB_IDILO       -------YLSAIEE--GNYVIAQANVGLNDKGE-LTEDL------------VPCR--HK-
RPOB_PSYIN       -------YLSAIEE--GSFVIAQASASIDENGL-LDEEL------------IPCR--HK-
RPOB_DICNV       -------YLSAIDE--SKYVIAQANAHLDEHGA-FMDGL------------ISTRF--E-
RPOB_HYDCU       -------YVSAIDE--AQFVIAQASAAMDSDNK-LLDEL------------VTARH--K-
RPOB_VESOH       -------YVSAIDE--ITHTIAQANALVDDRGK-LMDDL------------ISCRH--K-
RPOB_FRATO       -------YLSAIDE--DNYVIAQASTKLDENNH-FVEDI------------IQCRS--G-
RPOB_RHIL3       -------YLSAMEE--AKYYVAQANAEMNADGS-FVDEF------------VVCRHAG--
RPOB_RHIME       -------YLSAMEE--AKYHVAQANSVLDDDGS-FSEEF------------VVCRHAG--
RPOB_AGRFC       -------YLSAMEE--AKYYVAQANAELDGEGA-FTEEF------------VVCRHSG--
RPOB_RHILO       -------YLSAMEE--AKHHVAQANAELDKNGG-FVDEF------------VICRSAG--
RPOB_CHESB       -------YLSAMEE--AKHYVAQANATIDENGG-FADEF------------VVCRHAG--
RPOB_BRUSU       -------YLSAMEE--AKHSVAQANVELDEQGG-FVDEF------------VICRHAG--
RPOB_BARBK       -------YLSAMEE--AKHYVAQANSSLDSEGR-FTEEF------------VVCRHAG--
RPOB_RHOPB       -------YLSAMEE--GRYSVAQANVQLDPKGR-FVEDL------------IVCRDGGT-
RPOB_GLUOX       -------YLSAMEE--EKLVVAQADAKQDDQGR-LTDEL------------VSVRRSG--
RPOB_GRABC       -------YLSAMEE--DRLVVAQADAPRDSTGK-LTEEL------------ISVRRQG--
RPOB_MAGSA       -------YLSAMEE--GRYTVAQANSILDADGR-FTEDL------------VSCRRAG--
RPOB_RHORT       -------YMSAMEE--GKYVIAQANAALTEDGH-FADDL------------ISCRKAS--
RPOB_CAUVC       -------YMSAMEE--SKHVIAQSNIKVAE-GE-IVEDL------------VPGRING--
RPOB_MARMM       -------YLSAMQE--SRYSIAQANAHVTESGE-LDNEF------------VNCRVAG--
RPOB_HYPNA       -------YLSAMEE--SIYSIAQANATVNDKGE-LVNEF------------VNARVAG--
RPOB_RHOS1       -------YMSATEE--MRHTVAQANAQLDEEGR-FVSDL------------ISSRKAG--
RPOB_PARDP       -------YMSATEE--MRHTIAQANATLDESGK-FVDEL------------VSTRQAG--
RPOB_ROSDO       -------YMSATEE--MRHTVAQANAQLDEDGR-FKNDL------------VSTRQSG--
RPOB_JANSC       -------YMSATEE--MRHTVAQANANLDDDGK-FVNDM------------VNTRMSG--
RPOB_NOVAD       -------YLSAMEE--QKHTVAQASAELTADGS-FVEEL------------VSARQNG--
RPOB_ERYLH       -------YLSAMEE--QKHTVAQASAELTEDGT-FVEEL------------ISARQNG--
RPOB_SPHAL       -------YLSAMEE--SKHTVAQANADLNPDGS-FIDEL------------ISAREAG--
RPOB_ZYMMO       -------YLSAMEE--SRYTVAQANAELDAEGH-FVEEL------------VSAREAG--
RPOB_PELUB       -------YLSAMEE--TKYTIAQANAKIDKSGK-ILEEL------------VPCRENL--
RPOB_RICBR       -------YLSAIEE--GKYKIGQANSKVDKDGI-LQGEF------------INCRVEGG-
RPOB_ORITB       -------YLSALEE--GRYKIAQADTSLCTNDC-LIDGL------------VSCRYDG--
RPOB_ANAMM       -------YLLAMQE--GDYYIADAGAAIDENNR-FVDDM------------LYCRHGG--
RPOB_ANAPZ       -------YLLATQE--SDYYIADAGAALDENNR-FVDDM------------LYCRHGG--
RPOB_EHRRW       -------YLLAMQE--SNYYIADASATLDENNR-FVDDM------------LYCRHDG--
RPOB_NEOSM       -------YLSAIDE--IKANICQASVRVDEEGY-IVDDL------------VYCRRNY--
RPOB_MAGMM       -------FLSAIDE--ENYIIAQANAKLGDEAS-EEDAL------------IQCRHKL--
RPOB_ANADE       -------FYSALEE--EKHIIAQANAPVDKKGN-FTEAK------------VWCRK--E-
RPOB_MYXXD       -------FYSALEE--EKHTIAQANAETDKKGK-FANAL------------VSSRR--G-
RPOB_SYNFM       -------YLTAMDE--KEYPIAQANAPLDEKGR-FLLDL------------VSARV--A-
RPOB_SYNAS       -------FLTAIEE--ENQVIAPADQPVNHDGS-FKGDL------------ISARK--G-
RPOB_GEOSL       -------FFSALEE--EGHAIAQANAEMDADGR-FVNEY------------VSARK--S-
RPOB_PELPD       -------FFSALEE--EGHAIAQANAEVDAEGR-FVNDY------------VSARK--S-
RPOB_PELCD       -------YFSALEE--GGHAIAQANAPLDDDGR-FLNEL------------VNARQ--N-
RPOB_BDEBA       -------YLSALEE--AGHHIAPAARD-EAGNKAIQTAT------------TITRR--D-
RPOB_DESPS       -------YLSALEE--QKQIIAPALVALEADHQSISEGN------------LIARE--E-
RPOB_DESVV       -------FLDASRE--QGEVVAQANAAVDADGK-LADEY------------VTARV--R-
RPOB_DESAG       -------YLDASSE--HGEVVAQANARLDGDHR-FVDEF------------VTTRV--R-
RPOB_LAWIP       -------HLDASCE--FSEVIAQANASIDSEGR-LIDDY------------VTTRA--R-
RPOB_KORVE       ELEPYSFYLSAWEE--DKWTIAQANAELDEKGK-ITSEL------------VNARK--A-
RPOB_SOLUE       EFEAHCEYLSAWEE--DKWTIAQANVELDEKGR-IVPDL------------SNARQ--A-
RPOB_CAMJJ       -------YLTATQE--EGLFIAPASTKVDAKGN-IVEEF------------VEARQ--D-
RPOB_CAMFF       -------YLTATQE--EGHIIAPASTVLDANDI-IKEDL------------IEVRR--D-
RPOB_SULDN       -------YLTATQE--EGKKIAAASNKLDKDGQ-FIDKM------------VVTRV--D-
RPOB_BACV8       -----IEYLTAEEE--EDKIIAQGNAPLDDEGK-FVREK------------VKARR--D-
RPOB_PARD8       -----LQYYTAEEE--EELTIAQGNAPLDDNGK-FIRDK------------VKARF--E-
RPOB_PORGI       -----LKYYTAEEE--EEKTVAQGNAPLDENGR-FVRER------------VKARY--E-
RPOB_FLAPJ       -----PKYLSAEEE--EGMLIAQANIQMDENGK-ITADN------------VIARQ--E-
RPOB_GRAFK       -----PIYLSAEEE--EGKKIAQANIPLKDDGT-IDTDR------------VIARM--E-
RPOB_CYTH3       -----PVFLTAEEE--DGAHIAQANAMYDDNGN-FISDR------------IKARY--E-
RPOB_SALRD       -------YLSAEEE--DQATVAQANAPIGDDGH-FERDE------------VRCRH--Q-
RPOB_PELLD       -------MLSAEDE--ENKITVPVSIPIDANNN-IAVES------------VQART--K-
RPOB_CHLPD       -------MLSAEDE--ENKITVPVSIPLDENMK-IAIES------------VQART--K-
RPOB_CHLCH       -------MLSAEDE--ENKITVPVSIPLDENNR-IAVET------------VQART--K-
RPOB_CHLTE       -------MLSAEDE--ENKITVPVSIELDENNR-IAAES------------VQART--K-
RPOB_CHLMU       -------YMTADVE--EDCVIAQASAELDEYNM-FKDSV------------CWARY--K-
RPOB_CHLPN       -------YMTADVE--EECVIAQASASLDEYNM-FTEPV------------CWVRY--A-
RPOB_PARUW       -------YMTADQE--EQCVIAQASAPLDEYHM-FAEPI------------CWARY--K-
RPOB_RHOBA       -------WLRADEE--GESYVAPADTEVKDGAL-VPGPN------------MIARF--R-
RPOB_TREDE       -------YLSAMDE--DKYFIGQVSSAIGKDGK-INTDQ------------VSCRK--L-
RPOB_TREPA       -------YLDAMDE--DRYYIGQDSTAVGPDGV-IRVDH------------VSCRH--R-
RPOB_BORAP       -------YLSAIDE--EKKCIAQANAAFNSDGK-YLEDL------------VSVRI--S-
RPOB_LEPBL       -------HLTADKE--EYHYIAQASGVIDEKGE-LKNKL------------ISTRH--R-
RPOB_FUSNN       -------YLAADEE--DGLFIAQADTKLDKNN--KLQGL------------VVCRY--G-
RPOB_CYAM1       -------YLTADVE--DNYRLAPADVKYDREGQ-ICSPI------------VAVRY--R-
RPOB_AQUAE       -------WLAAYEE--ENYVIAQ-STPTDEEGR-LKAEF------------ILARH--K-
RPOB_DEIRA       -------YMTADIE--DRYTIAQANSPLNEDNTFADERV------------LARRK----
RPOB_DEIGD       -------YMTADIE--DRYVIAQANSPLNPDGTFAEERV------------LARKK----
RPOB_THET8       -------YMTATEE--DRYTIAQANTPLE-GNRIAAERV------------VARRK----
RPOB_THEMA       -------YLRANEE--EEYKIIPATTPVDEEGN-IIPER------------VVARM--G-
RPOB_BACCR       -------YLTADEE--DNYVVAQANMKLS-DEGEFLSED------------IVARF-RG-
RPOB_BACSU       -------YLTADEE--DNYVVAQANARLD-DEGAFIDDS------------IVARF-RG-
RPOB_BACHD       -------YLTADEE--DNYVVAQANMKLA-EDGSFIDEN------------IIARF-RG-
RPOB_GEOTN       -------YLTADEE--DNYVVAQANVPLA-EDGTFLEEN------------VIARF-RG-
RPOB_OCEIH       -------YLTADEQ--DNYIVAQANSPLD-EDSRFQNEE------------VISRF-QE-
RPOB_LISIN       -------YLTADEE--DNYVVAQANSKLD-EQGTFTEEE------------VMARF-RS-
RPOB_STAS1       -------YLTADEE--DSYVVAQANSTLD-ENGRFIADE------------VVCRF-RG-
RPOB_STRS2       -------WLTADEE--DAYIVAQSTSPLD-ENNRFVDKI------------VMGRH-QG-
RPOB_LACLA       -------YLTADEE--DNYTVAQANSPLT-EDSRFANET------------VMARH-TG-
RPOB_LACGA       -------YLTADVE--DNYIIAGANAPLN-EDGSFKDKI------------VLARH-KE-
RPOB_LACAC       -------YLTADEE--DNYIIAGANTPLN-DDGSFKEDI------------ILARQ-KE-
RPOB_LACDB       -------YLTADEE--DNYIIAGANTPLN-EDGSFVDDV------------ILCRH-RE-
RPOB_LACPL       -------YLAADEE--DQFVIAQANSPLN-DDGSFVEDT------------VLARN-KE-
RPOB_LACBA       -------YLTADEE--DNYVVAQANTPLN-DDGSFNTDT------------IMARA-QS-
RPOB_PEDPA       -------YLTADEE--DQFVIAQANSPLN-DDGSFADDV------------VMARH-ES-
RPOB_LACS1       -------YLTADEE--DNYVIAQANSPLN-DDGSFVDDV------------VMARK-KD-
RPOB_LACSS       -------YLTADEE--DNYVIAQANSPLN-DDGSFVDNT------------VLARY-KD-
RPOB_LACP3       -------YLTADEE--DNYIVAQANSPLN-DDGSFVDET------------VLARH-KD-
RPOB_ENTFA       -------YLTADIE--DHYIVAQANSLLN-EDGTFANDV------------VMARL-QS-
RPOB_LEUMM       -------YLTADEE--DNYIVAQANSPLN-EDGSFVHNT------------VMARF-GE-
RPOB_OENOB       -------YLTADVE--DNYTIAQANSPLN-DDGSFTNPT------------VTARH-GD-
RPOB_CARHZ       -------YLTADEE--EKYIIAQANVRLS-PEGKFLDEM------------VNARH-GS-
RPOB_MOOTA       -------YLTADEE--DKYFIAQANAPLD-EEGHFLEKR------------VNARH-GG-
RPOB_SYMTH       -------YLTADEE--DENIIAQANEPLN-PDGTFARDR------------VTCRY-RD-
RPOB_DESHY       -------YLTADEE--EKFVVAQANAPLT-DDGHFIEEK------------IDGRH-GP-
RPOB_CLOAB       -------YITADEE--DRCLIARANEALD-ENGYFIDKK------------ITVRA-PD-
RPOB_CLONN       -------YLTADEE--DHYLVAQAKEPLD-ENGCFIDEK------------ITVRD-LE-
RPOB_CLOPS       -------YFTADEE--DQYLVAQANEPLD-ENGCFIDKK------------VTVRD-KG-
RPOB_CLOTE       -------YMTADEE--DHYLIAKANEILN-DDGTFIDDK------------ITVRD-QE-
RPOB_HUNT2       -------YLTADEE--DEYIIAQANEPLD-EEGRFISNK------------VVCRY-KE-
RPOB_CLOD6       -------YLTADEE--DLFVRAQANEPLT-EDGKFVNHR------------VVCRTVNG-
RPOB_CALS4       -------YMTADEE--DEYIIAQANEPLD-ENNRFINDR------------VVCRL-RE-
RPOB_SYNWW       -------YLSADEE--DEYYVAQANAPLD-ENGYFIEEK------------VEARY-FE-
RPOB_ONYPE       -------YLTADQE--KEEIIASAGFVLD-ANNAFKDKK------------IIARS-NG-
RPOB_COREF       -------YLTADEE--DRFVVAQANTHYD-EDGVITDES------------VTVRLKDG-
RPOB_CORDI       -------YLTADEE--DRFVVAQANVEHD-ADGKITADS------------VTVRVKNG-
RPOB_CORJK       -------YFTADEE--DRHVIAQANTPFD-ENHRFTEER------------IEVRLRGG-
RPOB2_NOCFA      -------YLTADEE--DRHVRAQANSPVG-PDGRFLEDR------------VLCRRGNE-
RPOB_RHOJR       -------YLTADEE--DRHVVAQANSALD-ANGHFTDDR------------ILVRRKGG-
RPOB_MYCS2       -------YLTADEE--DRHVVAQANSPTD-ENGRFTEDR------------VMVRKKGG-
RPOB1_NOCFA      -------YLTADEE--DRHVVAQANEPLD-AEGRFLAAR------------IPVRRKNS-
RPOB_SACEN       -------YLTADEE--DRFVKAQANTPID-DEGNFLADR------------VLGRRKGG-
RPOB_FRAAA       -------YLTADEE--DRHVKAQANTPLS-PDGTFAEDR------------VLVRRKGG-
RPOB_STRCO       -------YLTADEE--DRFVIAQANAALG-DDMRFAEAR------------VLVRRRGG-
RPOB_THEFY       -------YLTADEE--DRYVIAQANTPVN-PDGTFAESQ------------VLARRKGG-
RPOB_ACIC1       -------YLTADEE--DRHVIAQANAPLN-EDGSFAEER------------VLVRRRGG-
RPOB_NOCSJ       -------YLTADDE--DRYVIAQANAALD-DKSRFVEER------------VLVRQRDG-
RPOB_ARTS2       -------YLTADDE--AEVLIAQANAPLD-ENKKFAEET------------VLVRARGGG
RPOB_LEIXX       -------YLTASEE--DDFVVAQANAPLD-ARGHFVEER------------VLARQKGG-
RPOB_CUTAK       -------YLTADEE--DRHVIAQANAKLD-DDGHFANDR------------VLVRQRHG-
RPOB_BIFAA       -------YMTADRD--AEHVIAQANQELD-ENGNFVKKQ------------ALARVGEE-
RPOB_TROWT       -------YMTATQE--DEHAIAQASTPLR-PDNSFVDER------------VLVRRKGG-
RPOB_RUBXD       -------YLSADEE--EEYTIAQANTPVDLETGRITAET------------VLARSRGG-
RPOB_DEHMC       -------YMPADEE--DRYIIAQANTRLD-EKGYFLDDR------------IEARSAER-
RPOB_MYCMS       -----VEYLTADQE--KNFIIAQSNVNQDENGK-ILDEI------------IVSRF---N
RPOB_MESFL       -----HEYLSADEE--KEYIISQSNVTKDENGK-ILDET------------VVSHY---K
RPOB_MYCMO       -----PIFLTAAEE--IDKKFAQSTVSVDKDGK-ITTQN------------ITVRQ---N
RPOB_MYCPU       -----PVYLTAHEE--INRTFAQSSISIDENGK-ITDEQ------------VIVKS---N
RPOB_MYCS5       -----VRYLTSYEE--IGYAFAQSSVHVNDKNE-IIDEQ------------ITIKK---D
RPOB_MYCH2       -----VHWLAASEE--FDKSFAQSGVEIDQNNR-IIPDK------------LTVRK---N
RPOB_CITSI       -------YLSPSRD--EYYMVAAGNSLALNQGSPE----------------EQVVPTRYR
RPOB_POPTR       -------YLSPNRD--EYYMIAAGNCLALNRGARE----------------EQVVPARYR
RPOB_AETGR       -------FLSPSQD--EYYMIAAGNSLALNRGIQE----------------EQAVPARYR
RPOB_OENEH       -------YFSPSRD--EYYMVAAGNSLALNRGIQE----------------EQVVPARYR
RPOB_NYMAL       -------YLSPSRD--EYYMVAAGNSLALTRGIQE----------------EEVGPARYR
RPOB_PIPCE       -------YLSPSVD--EYHMVAAGNSLALNRGIQE----------------EQAVPARYR
RPOB_PHAAO       -------YLSPNRD--EYYMVAAGNSLALNRDIQE----------------QQVVPARYR
RPOB_DIOEL       -------YLSPSRD--EYYMVAAGNSLALNRGIQE----------------EQVVPARYR
RPOB_PHAVU       -------YLSPSID--EYYMVATGNSLALTRDIQE----------------EQIVPARYR
RPOB_LOTJA       -------YLSPSRD--EYYMIATGNYLALNQGNQE----------------EQIVPARYR
RPOB_JASNU       -------YLSPGRD--EYYTVAAGNSLALNQDIQE----------------EEVVPARYR
RPOB_LACSA       -------YLSPGRD--EYYMVAAGNSLALNQGIQE----------------EQVVPARYR
RPOB_SACHY       -------YLSPNRD--EYYMIAAGNSLSLNQGIQE----------------EQVVPARYR
RPOB_PELHO       -------SLSSRKE--EYYMIGTGNSLALNQGIQE----------------EQIIPARYR
RPOB_ANTAG       -------FLSAGED--ENYHIATGNCLALNQTNQE----------------EQVTPARYR
RPOB_MARPO       -------NLSAAED--EYYRIATGNCLALDQNSQE----------------EQITPARYR
RPOB_PHYPA       -------NLSAGED--EYYRIATGNCLALDQGTQK----------------IQITPARYR
RPOB_PSINU       -------YLSPAED--EYYRIATGNQLASNWGTQE----------------KQVTLARYR
RPOB_ANGEV       -------YLSSEED--EYYRIATGNTLSLDREIRE----------------ERATPARYR
RPOB_PINTH       -------YLLPGEDEDEYYRIATGNSLALNQGIQE----------------EQITPARYR
RPOB_CYCTA       -------YLSSGED--EYYRIATGNYLALNQGIRE----------------EQVTPARYR
RPOB_ADICA       -------NLSPAED--DYYRVASENLLLSEWRGSE---------------KEIIPV-RYQ
RPOB_HUPLU       -------MADVSAE--EYFRIATEACLAVSPEEDEN--------------KEIFTVAQLQ
RPOB_CHAGL       -------FLSARED--ENFRIALGNRLAIDQEIQE----------------KQITPARYK
RPOB_CHAVU       -------HLCSEQE--EYYRITTGEHSRETAEKKG-----------------KPTPIRYR
RPOB_STAPU       -------YVRAGRD--ERLKIGTNNCLAIGQKG-Q----------------ERSTSTQYQ
RPOB_ZYGCR       -------DMLPGED--EYSTIATESCLVVANSSNQ----------------FQSIPAQHR
RPOB_NEPOL       -------LTAEQED--QVTVVAGDILDQRKLMVAVAEGRDPLDPAVRPTLPDRPLILRSR
RPOB_OSTTA       -------LLSAFYE--EDTVVAQGDVDLSNFRIPTR----------------------NK
RPOB_MESVI       -------YLAPDQE--DQFKVAPGDLLLSCYSSIE----------------NNYVPVRYK
RPOB_CHLAT       -------YLSPDQE--DELRVSPGDLLLSSSGKLE----------------GKTVPIRYK
RPOB_OLTVI       -------FFSAYQE--EKKLLAPGDIYANKLKYLP----------------KSELPIRKL
RPOB_BIGNA       -------YLSANQE--DKSNIVPFDIKKSRIGFLS----------------KNKIAARIK
RPOB_PHATC       -------YLTADIE--DFYKIAPADIATNKDNYLT----------------KNVIPVRYK
RPOB_THAPS       -------YLTADIE--DFYKIAPADISTNQENYLT----------------KNLIPVRYK
RPOB_TRIV2       -------YMTADEE--DDLRVAPGDIPVDENGHII----------------GPQVPVRYR
RPOB_TRIEI       -------YMTADAE--DDLRVAPGDIMTDAEGKIL----------------GDVVPVRYR
RPOB_SYNY3       -------YLTADEE--DDMRVAPGDIPTDEEGNII----------------GESVPIRYR
RPOB_SYNE7       -------YMTADQE--DDLRVAPGDVATDDAGYIL----------------GTTIPVRYR
RPOB_THEEB       -------YMTADEE--DDKRVAPGDVPTDENGYIL----------------GDVVPVRYR
RPOB_SYNJA       -------YLTADEE--DEYRVAPGDVPVDAEGRIT----------------ADLVPVRYR
RPOB_GLOVI       -------YLTADEE--DEFRVAAGDVAVDEGGNIL----------------ANPVTIRYR
RPOB_PROM5       -------YLSADLE--DECRVAPGDVATDKSGNIL----------------ANLIPVRYR
RPOB_GUITH       -------YLTADQE--DKYRIAPGDITLDETNRIA----------------TKIVPIKYR
RPOB_RHDSA       -------YLTADQE--DNFRIAPGDIAIDENNAIN----------------NDIVPVRYR
RPOB_PYRYE       -------YLTADEE--DDFRVAPGDVKVSKQHYIE----------------GDIIPVRYR
RPOB_GRATL       -------YITADQE--DYLRIAPADISLDVNDFIQ----------------DKIIAVRYK
RPOB_CYAPA       -------YLTADEE--DQYRIAAADVLINETNKII----------------GEDISVRYR
RPOB_CYACA       -------YLDAEQE--DEFKIAPGDIRINETNFIK----------------EINVPVRYR
RPOB_EMIHU       -------YLDAIAE--EQYKLAAGDVATDEHGVLK----------------QPDVPVRYQ
RPOB_EUGLO       -----IFFISSENE--KNIKIAPCDILKNFKLNKNYGVK-------------------NK
                              :                                              

RPOB_MYCGE       SMQGLYDPLKIDYIDVAPHQVVSIGSSLIPFLENDDSARALMGTNMQRQAYPLIKPYAPA
RPOB_MYCPN       SMQGLYDPSKIDYIDVAPHQVVSIGSSLIPFLENDDSARALMGTNMQRQAYPLIKPYAPV
RPOB_MYCGA       SSQDLYDPKQVDYIDVSPKQVVSVAASLIPFLENDDSSRALMGANMQRQATPLLKPYSPL
RPOB_MYCPE       SSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPI
RPOB_UREPA       GSTGLFSPNEVDFIDIVPKQVVSIAASAIPFIENDDGARALMGSNMQRQATPLIKPYAPI
RPOB_ALKEH       NEFGMATPDKVQYMDVSPKQIVSVAASLVPFLEHDDANRALMGSNMQRQAVPTLRADKPL
RPOB_HALHL       NEFTMATADRVQYMDVSPRQIVSVAASLVPFLEHDDANRALMGANMQRQAVPTLRADKPL
RPOB_METCA       DEFTLASRENINYMDVSSKQIVSVAASLIPFLEHDDANRALMGSNMQRQAVPTLRTEKPL
RPOB_XANC8       GESLLKPPAEVHFMDVSPMQTVSVAAALVPFLEHDDANRALMGANMQRQAVPTLRSQKPL
RPOB_XYLFT       GESLLKPPSYVHYMDVSPMQTVSVAAALVPFLEHDDANRALMGANMQRQAVPTLRAQKPL
RPOB_LEGPA       NEFSLTTPDKINYMDVSPKQIVSVAASLIPFLEHDDANRALMGSNMQRQAVPTLRSEKPL
RPOB_COXBU       GEFTLTTPDKINYMDVSPRQIVSVAAALIPFLEHDDANRALMGSNMQRQAVPTIRPETPL
RPOB_NITOC       NEFTLLPPEKVQYIDVSPKQIVSVAASLIPFLEHDDANRALMGSNMQRQAVPTLRAETPL
RPOB_AROAE       GEFALSTADQVQYMDVAPGQIVSVAASLIPFLEHDDANRALMGANMQRQAVPCLRPEKPL
RPOB_AZOSB       GEFMLATADQVQYMDVAPGQIVSVAASLIPFLEHDDANRALMGANMQRQAVPCLRPEKPL
RPOB_METFK       NEFTMAQPDRVQYMDVAPGQIVSVAASLIPFLEHDDANRALMGANMQRQAVPCLRAEKAL
RPOB_NITEC       NEFTLASRDQIEYVDIAPAQIVSVAASLIPFLEHDDANRALMGSNMQRQAVPCLRAEKPL
RPOB_NITMU       NEFTLATPDRIEYMDVAPAQIVSVAASLIPFLEHDDANRALMGSNMQRQAVPCLRAEKPL
RPOB_THIDA       NEFTLSAPDRIEYMDVAPAQIVSVAASLIPFLEHDDANRALMGSNMQRQAVPCLRPEKPF
RPOB_DECAR       GETILAEPGRVQYMDVAPGQIVSVAASLIPFLEHDDANRALMGANMQRQAVPCLRPEKPL
RPOB_PARXL       GETLMVTPDRIQYMDVAPSQIVSVAASLIPFLEHDDANRALMGSNMQRQAVPCLRPEKAV
RPOB_HERAR       GETILVSPERVQYMDVAPGQVVSVAASLIPFLEHDDANRALMGANMQRQAVPCLRPEKAL
RPOB_RALSO       RETRMVTPDRVQYIDVAPSQIVSAAASLVPFLEHDDANRALMGANMQRQAVPCLRADKPL
RPOB_BORA1       GETMLTSPVNVHYMDVAPSQIVSVAASLIPFLEHDDANRALMGANMQRQAVPCLRPEKPL
RPOB_RHOFT       GETIFAGPERVQYMDVSPAQIVSVAASLVPFLEHDDANRALMGANMSRQAVPILRPEKPM
RPOB_POLSJ       GESVLVGAERIQYMDVSPAQIVSVAASLVPFLEHDDANRALMGANMQRQAVPVLRPEKAF
RPOB_VEREI       GESILCAADRVRYMDVSPAQIVSVAASLVPFLEHDDANRALMGANMSRQAVPVLRPEKPL
RPOB_METPP       GESVLTSPERIQYMDVAPTQIVSVAASLVPFLEHDDANRALMGANMQRQAVPVLRPEKAF
RPOB_NEIG1       GETIMATPDRVQYMDVATGQVVSVAASLIPFLEHDDANRALMGANMQRQAVPCLRPEKPM
RPOB_CHRVO       GETILATPDRVQYMDVATGQVVSVAASLIPFLEHDDANRALMGANMQRQAVPCLRPEKAF
RPOB_ACIBT       GEFVRMPPEKVTHMDVSAQQVVSVAASLIPFLEHDDANRALMGSNMQRQAVPTLRADKPL
RPOB_PSYCK       GEFVRMPPEKVTHMDVSPSQVVSVAAGLIPFLEHDDANRALMGSNMQRQAVPTLRADKPL
RPOB_HAHCH       NEFTVMPPEKVTLMDVSPRQVVSVAASLIPFLEHDDANRALMGSNMQRQAVPTLKAEKPL
RPOB_MARHV       NEFTVAPPEAVNFMDVSPRQVVSVAASLIPFLEHDDANRALMGANMQRQAVPTLKSQVPL
RPOB_SACD2       NEFTLKGPSEVQYMDVSPRQVVSVAASLIPFLEHDDANRALMGSNMQRQAVPTLKAQKPL
RPOB_PSEU5       NEFTVKAPEDVTLMDVSPKQVVSVAASLIPFLEHDDANRALMGSNMQRQAVPTLRSDKPL
RPOB_CHRSD       GETTFMAPDKVTLMDVSPRQVVSVAAALIPFLEHDDANRALMGSNMQRQAVPTLKAEKPL
RPOB_ALCBS       YEFTVMERDTITHMDVSPRQVVSVAASLIPFLEHDDANRALMGSNMQRQAVPTLRADKPL
RPOB_SODGM       GESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQRQAVPTLCTDKPL
RPOB_ECOLI       GESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPL
RPOB_BAUCH       GESGFFSREKVHYMDVSTQQIVSVGASLIPFLEHDDANRALMGANMQRQAVPTLRTDKPL
RPOB_BLOFL       GESGLFRKDQIDYMDVSTQQIVSVAASLIPFLEHDDANRALMGANMQRQAVPVIRSEKPL
RPOB_BLOPB       GESGLFKKDQVDYMDVSTQQIVSVAASLIPFLEHDDANRALMGANMQRQAVPVLCSEKPL
RPOB_BUCAI       GESSLFNRNQVNYMDVSTQQIVSVGASLIPFPEHDDANRALMGANMQRQAVPTLKTDKPL
RPOB_BUCAP       GESSLFNCNQVDYMDVSTQQIVSVGASLIPFLEHDDANRALMGANMQRQAVPTLKTDKPL
RPOB_BUCBP       GESSLFNKNQINYMDVSTQQIVSVGASLIPFLEHDDANRALMGANMQRQAVPTLRSEKPL
RPOB_WIGBR       GESSLFNRNQVNYMDVSTQQIVSVGASLIPFLEHDDANRALMGANMQRQAVPTLMTEKPL
RPOB_BUCCC       GEFGLFKNKKVNYMDISTQQIVSVGASLIPFLEHDDANRALMGANMQRQAVPTIKSEKPL
RPOB_ACTP2       GESGLYKPEDIHYMDISTQQVVSVAAALIPFLEHDDANRALMGANMQRQAVPTLRADKPL
RPOB_MANSM       GESGLYRPEEIQYMDVSPQQVVSVAAALIPFLEHDDANRALMGANMQRQAVPTLRADKPL
RPOB_HAEI8       GESGLYKPEDIHYMDVSTQQVVSVAAALIPFLEHDDANRALMGANMQRQAVPTLRADKPL
RPOB_ALIF1       GESGLHPREHIQYMDVATNQVVSVAASLIPFLEHDDANRALMGANMQRQAVPTLKADKPL
RPOB_PHOPR       GDSGLHPRDHVQYMDVATNQVVSVAASLIPFLEHDDANRALMGANMQRQAVPTLRADKPL
RPOB_VIBCH       GESGLHPREHVDYMDVATNQVVSIAASLIPFLEHDDANRALMGANMQRQAVPTLRSEKPL
RPOB_AERS4       GESTFMNADQIQYMDVSPQQIVSVAAALIPFLEHDDANRALMGSNMQRQAVPTLRADKPL
RPOB_COLP3       NEFILKASAEVQYMDVSPQQIISVAASLIPFLEHDDANRALMGSNMQRQAVPTLRVDKPL
RPOB_PSEA6       GETTLKESSEITYMDVSPQQIVSIAASIIPFLEHDDANRALMGANMQRQAVPTLIADKPL
RPOB_PSEHT       GESTFMGRMDQQYMDVSPQQVISVAAALIPFLEHDDANRALMGSNMQRQAVPTLKADKPL
RPOB_SHEAM       GESTFMRASDIQYMDVSPQQIISVAASLIPFLEHDDANRALMGANMQRQAVPTLRSEKPL
RPOB_IDILO       NEFTLMSKEQVQYMDVAPQQIVSIAASMIPFLEHDDANRALMGSNMQRQAVPTLRADKPL
RPOB_PSYIN       GESTFLSPADIDYMDVSPQQIISVAASLIPFLEHDDANRALMGSNMQRQAVPTLRADKPL
RPOB_DICNV       NEFTLMPSSRVQYMDVSPRQIVSVAASLIPFLEHDDANRALMGSNMQRQAVPTLRADKPL
RPOB_HYDCU       NETILASSQDIDYMDVSPKQIVSVAASLIPFLEHDDANRALMGSNMQRQAVPTLRADKPL
RPOB_VESOH       NEFVLVDSSEVTLIDIDSKQISSVAASLIPFLEHDDANRALMGSNMQRQAVPVLKAEKPL
RPOB_FRATO       GEAIFTESSRVQYMDVSAKQMVSAAAALIPFLEHDDANRVLMGANMQRQAVPTLKSEKPL
RPOB_RHIL3       -EVMLAPRDSMNLMDVSPKQVVSVAAALIPFLENDDANRALMGSNMQRQAVPLLRAEAPF
RPOB_RHIME       -EVMLAPRDNINLMDVSPKQLVSVAAALIPFLENDDANRALMGSNMQRQAVPLLRAEAPF
RPOB_AGRFC       -EVMLAPRDNINLMDVSPKQLVSVAAALIPFLENDDANRALMGSNMQRQAVPLLRAEAPF
RPOB_RHILO       -EVMMAPRENVDLMDVSPKQMVSVAAALIPFLENDDANRALMGSNMQRQAVPLVRAEAPF
RPOB_CHESB       -EVIMAPRENVDLMDVSPKQLVSVAAALIPFLENDDANRALMGSNMQRQAVPLVRAEAPF
RPOB_BRUSU       -EVMMAPRENVDLMDVSPKQLVSVAAALIPFLENDDANRALMGSNMQRQAVPLVRAEAPF
RPOB_BARBK       -EVLMVPRDHIDLMDVSPKQLVSVAASLIPFLENDDANRALMGSNMQRQAVPLIRSEAPF
RPOB_RHOPB       RDVVLIPADKVDFMDVSPKQLVSVAAALIPFLENDDANRALMGSNMQRQAVPLVRAEAPF
RPOB_GLUOX       -DFRVVPPDQVTACDVSPKQLVSVAAALIPFLENDDANRALMGANMQRQAVPLVKADAPL
RPOB_GRABC       -DFRLVKPEDVTSMDVSPKQLVSVAAALIPFLENDDANRALMGSNMQRQAVPLIRADAPL
RPOB_MAGSA       -DFVMVPPNEINMIDVSPKQLVSVAAALIPFLENDDANRALMGSNMQRQAVPLIRAEAPL
RPOB_RHORT       -DFEMVQPQDIDYIDVSPKQLVSVAAALIPFLENDDANRALMGSNMQRQAVPLVKAEAPY
RPOB_CAUVC       -EPTLLQKETVDLMDVSPRQVVSVAAALIPFLENDDANRALMGSNMQRQAVPLVQSDAPL
RPOB_MARMM       -DVTLVPREDVEYIDVSPKQVVSVAAALIPFLENDDANRALMGSNMQRQAVPLVKAEAPL
RPOB_HYPNA       -EATMIAKEEVQYMDVSPKQVVSVAASLIPFLENDDANRALMGSNMQRQAVPLVKSEAPF
RPOB_RHOS1       -EFMLNPPDAIDLIDVSPKQLVSVAASLIPFLENDDANRALMGSNMQRQAVPLLQSDAPF
RPOB_PARDP       -DFMLNPVEAVDLIDVSPKQLVSVAAALIPFLENDDANRALMGSNMQRQAVPLLRAEAPF
RPOB_ROSDO       -DYTLAPSENVDLIDVSPKQLVSVAASLIPFLENDDANRALMGSNMQRQAVPLLQAEAPL
RPOB_JANSC       -EYTLNPREAIDLIDVSPKQLVSVAASLIPFLENDDANRALMGSNMQRQAVPLLQADAPF
RPOB_NOVAD       -EFVMAPRDTVTLMDVSPKQLVSVAASLIPFLENDDANRALMGSNMQRQAVPLIKADAPF
RPOB_ERYLH       -DNLMAPSETVTLMDVSPKQLVSVAASLIPFLENDDANRALMGSNMQRQAVPLVKAEAPW
RPOB_SPHAL       -EFLMAPREQITLMDVSPKQLVSVAASLIPFLENDDANRALMGSNMQRQAVPLLRAEAPV
RPOB_ZYMMO       -EFLMAPREQITLMDVSPKQLVSVAASLIPFLENDDANRALMGSNMQRQAVSLVRAEAPF
RPOB_PELUB       -NFVLSNPSKIDYIDVSPKQLVSVAASLIPFLENDDANRALMGSNMMRQAVPLLKPESPL
RPOB_RICBR       -NFVMVEPHEVDFIDVTPMQVVSVAASLIPFLENDDANRALMGSNMQRQAVPLIKTDAPF
RPOB_ORITB       -NFVMVLAQEVDFIDLTPMQVVSVAASMIPFLENDDANRALMGANMQRQAVPLLKSQAPL
RPOB_ANAMM       -NFVMVKSEDVDYVDVSPKQIVSVAASLIPFLENNDANRALMGSNMQRQAVPLLKSEAPL
RPOB_ANAPZ       -NFVMVKREDVNYIDVSPKQIVSVAASLIPFLENNDANRALMGSNMQRQAVPLLKAEAPL
RPOB_EHRRW       -NFVMVKREQVDYIDVSPKQIVSVAASLIPFLENNDANRALMGSNMQRQAVPLLKADAPL
RPOB_NEOSM       -ENVFIPRSEVQFADVSAKQIVSVAASLIPFLENDDANRALMGSNMQRQAVPLIMPEAPL
RPOB_MAGMM       -EFMVATPDRVNYQDVSPKQTVSVAASLIPFLENDDANRALMGSNMQRQAVPLIKTDAPL
RPOB_ANADE       GEYIYVRPDEVDLMDVSPNQLVSVAASLVPFLENDDANRALMGSNMQRQAVPLLRTQAPL
RPOB_MYXXD       GEFVQARAEDVDLMDVSPKQLVSVAASLIPFLENDDANRALMGSNMQRQAVPLLRTAAPL
RPOB_SYNFM       GEPVMVPPNEIRYMDVSPNQLVSVSASLIPFLEHDDANRALMGSNMQRQAVPLIQTRAPL
RPOB_SYNAS       GDFVNVVPSEVNMVDVSPNQLVSVAATLIPFLEHDDANRALMGSNMQRQAVPLMRPEIPL
RPOB_GEOSL       GEFLLVHRDELELMDVAPMQLVSVAASLIPFLENDDANRALMGSNMQRQAVPLLKADSPL
RPOB_PELPD       GEFILVHRDEIELMDVAPKQLVSVAAALIPFLENDDANRALMGSNMQRQAVPLLRADSPL
RPOB_PELCD       GEFVLIQREEIGLMDVSPKQLVSVAASLIPFLENDDANRALMGSNMQRQAVPLLRADAPL
RPOB_BDEBA       GEYEIVDKDKVALMDVSPSQLVSIAASLIPFLEHDDANRALMGSNMQRQAVPLLRSRAPL
RPOB_DESPS       GDVITIGSDNVTYMDVAPNQMISVAASLVPFLENDDANRALMGSNMQRQAVPLLVTAAPL
RPOB_DESVV       GDVLMSHRDEVTLMDISPSQMVSISAALIPFLEHDDANRALMGSNMQRQAVPLLRSEKPI
RPOB_DESAG       GDVIMSPREEVTLMDISPSQMVSISAALIPFLEHDDANRALMGSNMQRQAVPLLRSTKPI
RPOB_LAWIP       GDVLMSAREEVTLMDISPSQMVSISAALIPFLEHDDANRALMGSNMQRQAVPLLRSERPL
RPOB_KORVE       GNFVLISRDDIDYIDVSPKQLVSVAASLVPFLEHDDANRALMGANMQRQSVPLLRAEAPI
RPOB_SOLUE       GNFVLKPKEEIEYIDVSPKQLVSVAASLIPFLENDDANRALMGSNMQRQAVPLLRADAPY
RPOB_CAMJJ       GETILARREEVQLIDLCSGMVVGVAASLIPFLEHDDANRALMGSNMQRQAVPLLTASAPI
RPOB_CAMFF       GEMLLAKREDVTLIDLCSGMVMGVAASLIPFLEHDDANRALMGSNMQRQAVPLLRSTAPI
RPOB_SULDN       GEILHRPVTECNYADLSSHMVVGVAASLIPFLEHDDANRALMGANMQRQAVPLIKHEAPI
RPOB_BACV8       ADYPVVTPDQVELMDVSPQQIASIAASLIPFLEHDDANRALMGSNMMRQAVPLLRTEAPI
RPOB_PARD8       ADFPVVPPSEIDLMDVAPQQIASIAASLIPFLEHDDANRALMGSNMMRQAVPLLRTDAPI
RPOB_PORGI       SDFPLVTPDEVDLMDVSPTQIASIAAALIPFLEHDDANRALMGSNMMRQAVPLLRPESPI
RPOB_FLAPJ       GDFPVIDPTAVHYTDVAPNQIASISASLIPFLEHDDANRALMGSNMMRQAVPLIRPEAPI
RPOB_GRAFK       GDFPVVDPKEIHYTDVAPNQISSISASLIPFLEHDDANRALMGSNMMRQAVPLLRTDSPI
RPOB_CYTH3       GDFPVIAPDKVDLIDIATNQIVSVAASLIPFLEHDDANRALMGSNMQRQAVPLLRPEAPI
RPOB_SALRD       GDFPIVEPEEVDYMDVAPNQIVSPSASLVPFLSHNDANRALMGSNMQRQGVPLLRSDSPI
RPOB_PELLD       GDYPLVPSEDVNYMDVSPVQIVSAAAALIPFLEHDDGNRALMGANMQRQAVPLLVSEAPV
RPOB_CHLPD       GDYPLVPAEDVNYMDVSPVQIVSAAAALIPFLEHDDGNRALMGANMQRQAVPLLTAEAPI
RPOB_CHLCH       GDYPVVAATDVHYMDVSPVQIVSAAAALIPFLEHDDGNRALMGANMQRQAVPLLTSDAPV
RPOB_CHLTE       GDYPLVLAEEVNYMDVSPVQIVSAAAALIPFLEHDDGNRALMGANMQRQAVPLLVSEAPI
RPOB_CHLMU       GEAFEADTSTVTHMDVSPKQLVSVVTGLIPFLEHDDANRALMGSNMQRQAVPLLKTEAAI
RPOB_CHLPN       GEAFEADTSTVTHMDVSPKQLVSIVTGLIPFLEHDDANRALMGSNMQRQAVPLLKTEAPV
RPOB_PARUW       GEQFETDTKNVTHMDVSPKQLVSIVTGLIPFLEHDDANRALMGSNMQRQGVPLLKPTAPI
RPOB_RHOBA       SDFEIVMPEQVSFMDVAPAQMVGVSAGLIPFLEHDDANRALMGSNMQRQAVPLLVTEPPI
RPOB_TREDE       GDYTSISPKDIQYMDVSPKQIISVSASLIPFLEHDDANRALMGSNMQRQAVPLVFPEPPR
RPOB_TREPA       GDYSTRSPKDIQYMDVSPKQIISVSASLIPFLEHDDANRALMGSNMQRQGVPLIFPEPPR
RPOB_BORAP       GDYTTTNPKNIDYMDVSPRQLISVSSALIPFLEHNDANRALMGSNMQRQAVPLLFPKPPI
RPOB_LEPBL       GDFPFRNPSEIQYMDLAPLQVVSVSTALIPFLEHDDANRALMGSNMQRQAVPLLREEAPF
RPOB_FUSNN       HEIVEIEPERVNYMDVSPKQVVSVSAGLIPFLEHDDANRALMGSNMQRQAVPLLKSEAPF
RPOB_CYAM1       QEWTTCDASHVDYMAISPIQFISAATCLIPFLEHDDANRALMGSNMQRQAVPLIRASKPY
RPOB_AQUAE       NDIRLVKPEQVEYIDVSPRQVISPSSSLIPFLEHDDANRALMGSNMQRQAVPLIFTQAPL
RPOB_DEIRA       GDPLLYTPDEVDYMDVSPKQIVSINTSLIPFLEHDDANRALMGSNMQSQAVPLVRADSPA
RPOB_DEIGD       GDPMLYAPTEVDFMDVSPKQIVSINTSLIPFLEHDDANRALMGSNMQSQAVPLVRADSPA
RPOB_THET8       GEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPV
RPOB_THEMA       EDIRLVPKEEVDFMDVSTKQPFSVSASLIPFLEHDDASRALMGSNMQRQAVPLLKTEAPL
RPOB_BACCR       -ENIVTNRERIDYMDVSPKQVVSAATACIPFLENDDSNRALMGANMQRQAVPLMNPESPI
RPOB_BACSU       -ENTVVSRNRVDYMDVSPKQVVSAATACIPFLENDDSNRALMGANMQRQAVPLMQPEAPF
RPOB_BACHD       -ENIVVSRDRVDYMDVSPKQVVSAATSCIPFLENDDSNRALMGANMQRQAVPLLVPEAPI
RPOB_GEOTN       -ENIVVKRDRVDYMDVSPKQVVSAATACIPFLENDDSNRALMGANMQRQAVPLLQPEAPI
RPOB_OCEIH       -DNIVVSRDKIDYMDVSPKQVVSAATACIPFLENDDSNRALMGANMQRQAVPLMKPQAPI
RPOB_LISIN       -ENLAVEKERIDYMDVSPKQVVSVATACIPFLENDDSNRALMGANMQRQAVPLMHPEAPF
RPOB_STAS1       -NNTVMAKEKMDYMDVSPKQVVSAATACIPFLENDDSNRALMGANMQRQAVPLMNPESPF
RPOB_STRS2       -NNQEFPADSADFMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIDPKAPY
RPOB_LACLA       -NNIEVEASTADYMDVSPKQVIAVAAACIPFLENDDSNRALMGANMQRQAVPLIDPHAPW
RPOB_LACGA       -DNLEVTPDKIDYMDVIPKQVVSVTSACIPFLENDDSNRALMGANHQRQAVPLINPHAPI
RPOB_LACAC       -DNVEVTPDKIDYMDVIPKQVVSVASACIPFLENDDSNRALMGANQQRQAAPLINPHSSL
RPOB_LACDB       -DNVEVSPDRIDYIDVIPKQVVSVTSACIPFLENDDSNRALMGANHQRQAVPLINPHGPL
RPOB_LACPL       -ENLETPIENVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLLDPHAPL
RPOB_LACBA       -ENIETSADRIDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLLNPHAPL
RPOB_PEDPA       -DNIETSIENVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLVDPHSPL
RPOB_LACS1       -DDVEISTEKVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIKPHAPL
RPOB_LACSS       -DNIETSIDKLDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLVNPHAPL
RPOB_LACP3       -NNIEISPDKVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLVNPHAPL
RPOB_ENTFA       -ENLEVAVDKVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIQPRSPW
RPOB_LEUMM       -ENIETPIDRIDYMDVSPKQVVSVGTAAIPFLENDDSNRALMGANMQRQAVPLLDPHSPL
RPOB_OENOB       -NNIETPIEDVDYMDVSPKQVVAVSTAAIPFLENDDSNRALMGANMQRQAVPLVAPHSPI
RPOB_CARHZ       -EILHVEPSKVDFVDVSPKQVFSVATSLIPFLEHDDANRALMGANMQRQAVPLIRTEAPV
RPOB_MOOTA       -EILVVPASQVDYMDVSPKQMVSVATALIPFLEHDDANRALMGANMQRQAVPLLRTEAPI
RPOB_SYMTH       -EILQVPPSQVDYMDVSPKQVVSIATALIPFLENDDASRALMGSNMQRQAVPLLRTEAPY
RPOB_DESHY       -DFVLVAPERIDYMDVSPKQMVSIATALIPFLEHDDANRALMGANMQRQAVPLLRTDAPY
RPOB_CLOAB       -EVLVVPANEVDLMDVSARQMVSVATAMIPFLENDDASRALMGSNMQRQAVPLLKPQAPV
RPOB_CLONN       -DVIVVSKDQVDLMDVSPSQIVSVATAMIPFLENDDASRALMGSNMQRQAVPLLKPAAPI
RPOB_CLOPS       -EVLVVPSKDVDLMDVSPRQLVSVATAMIPFLENDDASRALMGSNMQRQAVPLLKPYAPI
RPOB_CLOTE       -DVLVVPKEEVDFMDVSPRQLVSVATAMIPFLENDDASRALMGSNMQRQAVPLLKPEAPI
RPOB_HUNT2       -EFIEVDPSKIDFMDVSPKQIVSVATSMIPFLENDDANRALMGANMQRQAVPLIKTESPI
RPOB_CLOD6       -AVEMVPESRVDYMDISPKQVVSVATAMIPFLENDDANRALMGANMQRQAVPLVRREAPI
RPOB_CALS4       -EIISVPPTEVDFMDVSPKQIVSVSASLIPFLENDDANRALMGSNMQRQAVPLLKPEAPI
RPOB_SYNWW       -EILEIPKNRVDYMDVSPKQVFSVATALIPFLENDDANRALMGANMQRQAVPLVKTEAPI
RPOB_ONYPE       -ETGIFERSQITYADVSPKQIVSVATSSIPFLEHNDASRALMGANMQRQAVPLLIPESPI
RPOB_COREF       -DIAMVSRTDVDYMDVSPRQMVSVGTAMIPFLEHDDANRALMGANMQKQAVPLVRAEAPF
RPOB_CORDI       -DIQVVAPESVDYLDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPF
RPOB_CORJK       -DVEVVPYTEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLLRSEAPF
RPOB2_NOCFA      -EMEYVAATEVDFMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLIRSEAPI
RPOB_RHOJR       -EVEFVSSAEIDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPL
RPOB_MYCS2       -EVEFVSADQVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPL
RPOB1_NOCFA      -EVELVDSAAVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLIRSEAPI
RPOB_SACEN       -EVELLAPTEIDYMDVSPRQMVSAATAMIPFLEHDDANRALMGANMQRQAVPLLRSEAPL
RPOB_FRAAA       -EVEFIPPDEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGSNMQRQSVPLLRSEAPL
RPOB_STRCO       -EVDYVPGDDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMMRQAVPLIKSESPL
RPOB_THEFY       -EFESVAAEEVHYMDISPRQMVSVATAMIPFLEHDDANRALMGSNMQRQAVPLLRAEAPL
RPOB_ACIC1       -EVDYVHPSTVDYMDVSPRQMVSVATALIPFLEHDDANRALMGSNMQRQAVPLLRAEAPL
RPOB_NOCSJ       -EVSEVLADEVDYMDVSPRQMVSVATALIPFLEHDDANRALMGANMQRQAVPLIKSDSPL
RPOB_ARTS2       GEPVLVPAADVEFMDVSPRQMVSVATALIPFLEHDDANRALMGANMQRQAVPLVRSEAPF
RPOB_LEIXX       -EVDLVPAEEIGYMDVSPRQMVSVGTSLIPFLEHDDANRALMGANMQRQAVPLLRSESPV
RPOB_CUTAK       -EADEVPSSEVDYMDVSPRQMVSVASALIPFLEHDDASRALMGANMQRQAVPLVRTEAPF
RPOB_BIFAA       -EAVDVPVSSVDYMDVSPRQMVSVGASLIPFLEHDEGHRALMGTNMQRQAVPLIESERPL
RPOB_TROWT       -EVEVVPADQVDYMDVSGRQMVSVATSLIPFLEHNDANRALMGSNMQRQAVPLLVTESPL
RPOB_RUBXD       -DVTTVSPEEVDYMDVSPVQTVSVATSLIPFLEHDDANRALMGANMQRQAVPLLRSEAPY
RPOB_DEHMC       --YVVEPPDKIDYMDVSPKQIFSVAASLIPFLEHDDANRALMGANMQRQAVPLLRAEAPM
RPOB_MYCMS       GDDYMAKVEEIDYIDVSPKQIVSVATSGIPFLENDDANRALMGANMQRQAVPLIKPESPI
RPOB_MESFL       GDDYIAKVSEVQFIDVSPKQIVSVATSAIPFLENDDANRALMGANMQRQAVPTIVPESPF
RPOB_MYCMO       HDYLIVSPSEVDYIDISSKQMTSIAAAAIPFLENNDANRALMGSNMQRQAIPLLEAEAPL
RPOB_MYCPU       FDYNVVSPKEVDYIDVSSKQMTSLAASSIPFLENNDANRALMGSNMQRQAVPLLFAEAPL
RPOB_MYCS5       YNYIIGSPKDIDFLEVSSKQIVSVAAAAIPFLENNDANRALMGSNMQRQAVPLIEAEAPL
RPOB_MYCH2       QTYLVLDAEQVNYIDVSSMQMTSISASAIPFLENNDANRALMGSNMQRQAVPLIKSEAPL
RPOB_CITSI       QEFLTIAWEQVHLRSIFPFQYFSIGASLIPFIEHNDANRALMSSNMQRQAVPLVRSEKCI
RPOB_POPTR       QEFLTIAWEQVRLRSFFPFQYFSIGASLIPFIEHNDANRALMSSNMQRQAVPLARSEKCI
RPOB_AETGR       QEFLTIAWEEVHLRSIFPFQYFSIGASLIPFIEHNDANRALMSSNMQRQAVPLSRSEKCI
RPOB_OENEH       QEFLTLAWDQVHLRSIFPFQYFSIGASLIPFIEHNDANRALMSSNMQRQAVPLSQSERCI
RPOB_NYMAL       QEFLTIAWEQIHLRNIYPFQYFSIGASLIPFIEHNDANRALMSSNMQRQAVPLSQSEKCI
RPOB_PIPCE       QEFLTIAWEQIHLRSIFPFQYFSMGASLIPFIEHNDANRALMSSNMQRQAVPLSRSEKCI
RPOB_PHAAO       QEFLTIAWEEIHLRSIFPFQYFSIGASLIPFIEHNDANRALMSSNMQRQAVPLSRSEKCI
RPOB_DIOEL       QEFLTIAWEQIHLRSIFPFQYFSIGASLIPFIEHNDANRALMSSNMQRQAVPLSRSEKCI
RPOB_PHAVU       QEFLTIAWEQVHLRSIYPFQYFSIGASLIPFIEHNDANRALMSSNMQRQAVPLSQSEKCI
RPOB_LOTJA       QEFLTIAWEQVHLRSIFSFQYFSIGASLIPFIEHNDANRALMSSNMQRQAVPLSQSEKCI
RPOB_JASNU       QEFLTIAWEQVHFRSILPFQYFSIGASLIPFIEHNDANRALMSSNMQRQAVPLSRPEKCI
RPOB_LACSA       QEFLTIAWEQVHLRSIFSFQYFSIGASLIPFIEHNDANRALMSSNMQRQAVPLSQSEKCI
RPOB_SACHY       QEFLTIAWEQIHVRSIFPFQYFSIGGSLIPFIEHNDANRALMSSNMQRQAVPLSRSEKCI
RPOB_PELHO       QEFLTIAWEEVHFRSVFPFQYFSIGVSLIPFLEHNDATRALMSSNMQRQAVPLSRSEKCI
RPOB_ANTAG       QEFVATAWNQINLRSIFPLQYFSIGTSLIPFLEHNDANRALMGFNMQRQAVPLSKPEKCI
RPOB_MARPO       QDFVAIAWEQVHLRSIFPLQYFSVGASLIPFLEHNDANRALMGSNMQRQAVPLLKPEKCI
RPOB_PHYPA       QEFLAIAWEQIHLRSIYPLQYFSVGVSLIPFLEHNDANRALMGSNMQRQAVPLIKLEKCI
RPOB_PSINU       QEFLTIAWEQVHFRSLFPLQYFSIGASLIPFLEHNDANRALMGSHMQRQAVPLLKPEKCI
RPOB_ANGEV       QEFLTIAWKQIHFRSIFPFQYFSIGTSLIPFLEHNDANRALMGSNMQRQAVPLSQPEKCI
RPOB_PINTH       QEFIVIAWEQIHFRSIFPFQYFSVGVSLIPFLEHNDANRALMGSNMQRQAVPLFRPEKCI
RPOB_CYCTA       QEFLAIAWEQIHFRSIFPFQYFSVGVSLIPFLEHNDANRALMGSNMQRQAVPLFQPEKCI
RPOB_ADICA       QEFLSVLWEQVDFRSIHPLHHFSIGASLIPFIEHNDANRALMGSTMQRQAVPLIKPERCI
RPOB_HUPLU       QEFLTTSWDRIKLRIISPLQYFSVGVCPIPSFEHNDANRALMGSNMQRQAVPLFEPERCI
RPOB_CHAGL       QEFINTPWSLANLRSIFPWQYFSIGASLIPFLEHDDANRALMGSNMQRQAVPLLITERPI
RPOB_CHAVU       QEFSATAFHFLHFRDILPIQYFSIATSLIPFLEHDDANRALMGSNMQRQAVPLLRPEKPI
RPOB_STAPU       QEFVSMSWDQINLRSILPIQYFAIGASLIPFLEHNDATRTLMGSSMQRQAVPLVKPEKSI
RPOB_ZYGCR       REFVTLRWDEIGFRNTLPVHSFSVGVVLIPFLEHDDATRALMGSNMQRQAVPLLKLERPI
RPOB_NEPOL       QEFHTGSFRDVNYVGIAPTQMISVATSLIPFLEHDDANRALMGSNMQRQAVPLLKTEAPI
RPOB_OSTTA       SQFTENTVQEINFLGLCPIQFMSIATSLIPFLEHDDANRALMGSNMQRQAVSLLRSERPF
RPOB_MESVI       QEFTTSKAEEVDYVGISPTQAISIATSLIPFLEHDDANRALMGSNMQRQAVPLLKPNRPI
RPOB_CHLAT       QDFSTSRSDQVDYVGISPIQAISIATSLIPFLEHDDANRALMGSNMQRQAVPVIRPERPV
RPOB_OLTVI       AEFTRTTREKIDYISVSPLQMISIATSLIPFLEHDDANRALMGSNMQRQAVPLMTAEAPV
RPOB_BIGNA       QQFKEVSKKKVDFISISQLQMLSVATSLIPFMEHNDANRVLMGSNMQRQAVPLLKTECCL
RPOB_PHATC       QDFVNVTPSEVDFIAISTIQVVSVAASLIPFFEHDDANRALMGSNMQRQSVPLLLPQKPI
RPOB_THAPS       QDFLTVTPSEVDFIAVSPIQVVSVAASLIPFFEHDDANRALMGSNMQRQSVPLLLPQKPI
RPOB_TRIV2       QEFSTTTPEQVDYVAVSPVQIVSVATSMIPFLEHDDANRALMGSNMQRQAVPLLKPERPL
RPOB_TRIEI       QDFTTTNPQQVDYVAVSPVQVVSVATSLIPFLEHDDANRALMGSNMQRQAVPLLNPDRPL
RPOB_SYNY3       QEFSTTSPEQVDYVAVSPVQIISVATSMIPFLEHDDANRALMGSNMQRQAVPLLRPERPL
RPOB_SYNE7       QDFTTTTPERVDYVALSPVQIISVATSLIPFLEHDDANRALMGSNMQRQAVPLLRPERPL
RPOB_THEEB       QDFTTTTPDQVDYVAVSPVQIISVATSLIPFLEHDDANRALMGSNMQRQAVPLLRPQRPL
RPOB_SYNJA       QEFTTAHPSEVHYVQVSPVQLISVATSLIPFLEHDDANRALMGANMQRQAVPLLKPDRPY
RPOB_GLOVI       QEFGLASPAEVDYVAVSPIQIVSVATSLIPFLEHDDANRALMGANMQRQAVPLLRPERPL
RPOB_PROM5       QDFEKVPPHQVDYVQLSPVQVISVATSLIPFLEHDDANRALMGSNMQRQAVPLLRPERPL
RPOB_GUITH       QEFTTTKPNQVDFIAVSPIQVISIATSLIPFLEHDDANRALMGSNMQRQAVPLLYPESPL
RPOB_RHDSA       QEFTITKPEQIDYIQVSPIQVISIATSLIPFLEHDDANRALMGSNMQRQAVPLLYPESPL
RPOB_PYRYE       QEFITTTPTQVDYIAISPIQVISAATSLIPFLEHDDANRALMGSNMQRQAVPLLYPEKPI
RPOB_GRATL       QEFITATISQVDYMAVSPIQFISAATSLIPFLEHDDANRALMGSNMQRQAVPLLFPEKSI
RPOB_CYAPA       QEFITTKIDQIDFIAISPLQTFSVSTSLIPFLEHDDANRALMGSNMQRQAVPLLHAEKPL
RPOB_CYACA       QEFTQCPAEEIDFIAVSPIQVISAATSLIPFLEHNDANRALMGSNMQRQAVPLIFPERPL
RPOB_EMIHU       QNIVTVSKNEVDYIAVSPIQVVSLATSLIPFLEHDDANRALMGSNMQRQSVPLLYADAPL
RPOB_EUGLO       NEFYYDSYKSINFISTSTDQFNSIGTGIIPFLEHNDANRVLMGATMQKQALILKNKEPSL
                                       .     :*  .:::. *.**.     *.          

RPOB_MYCGE       VGTGQEHKIASDSGLTMSSPCS--GVVSYVDNSKIIITSDS-------------------
RPOB_MYCPN       VGTGQEYKIARDSGLTMLAPCS--GTVKYVDNSKITIESDS-------------------
RPOB_MYCGA       VGTGVEYKIAQDSGMLVTAKNP--GTVTYVDASKITVKGED-------------------
RPOB_MYCPE       VGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGS-------------------
RPOB_UREPA       VGTGTEFKIAHDSGMAVVAKND--GVVEFVDSQKIIIRNDN-------------------
RPOB_ALKEH       VGTGMERAVARDSGVIVTAERG--GVVEQVDAGRIVVRVNDDETE---------------
RPOB_HALHL       VGTGMERTVARDSGVIVTAERG--GVVEQVDSGRIVVRVDDEETT---------------
RPOB_METCA       VGTGMERIVARDSGVAVVAKRG--GTVEFVDASRIVVRVNDEETE---------------
RPOB_XANC8       VGTGIERAVARDSGVTVNARRG--GVIEQIDAARIVVKVNEAEIG---------------
RPOB_XYLFT       VGTGIERTVARDSGVTVNARRG--GVIDQVDAGRIVVKVNESEII---------------
RPOB_LEGPA       VGTGMERIVASDSGVSVVAKRG--GVIDLVDASRIVVRVNDDET----------------
RPOB_COXBU       VGTGMERTVAVDSGVTVIAKRS--GVIDSVDASRIVVRVDRKETE---------------
RPOB_NITOC       VGTGMEQVVARDSGVMVVARRG--GIVDSVDAARVVVRVNDEET----------------
RPOB_AROAE       VGTGIERTVAVDSGTAVQAMRG--GIVDYVDANRIVVRVNDDET----------------
RPOB_AZOSB       VGTGIERTVAVDSGTAVQAMRG--GVVDYVDAQRVVVRVNDNEA----------------
RPOB_METFK       VGTGIERTVAVDSGTVVTARRG--GVVDYVDSSRIVVRVHDEEA----------------
RPOB_NITEC       VGTGIERVVAVHSGTAVKALRG--GVVDYVDAGRIVIRVHDAET----------------
RPOB_NITMU       VGTGIERVVAVDSGTAVKAVRG--GVVDYVDASRIVVRVHDIET----------------
RPOB_THIDA       VGTGIERTAAVDSGTVVIAHRG--GRVDYVDAGRIVIRVHDEEA----------------
RPOB_DECAR       VGTGIERTVAVDSGTAVVALRG--GMVDYVDAARVVVRVNDDET----------------
RPOB_PARXL       VGTGIERTVAVDSGTTVQAFRG--GVVDYVDAGRMVIRVNDDEA----------------
RPOB_HERAR       VGTGIERTVAVDSGTTVQALRG--GIVDYIDAGRVVIRVNDDEA----------------
RPOB_RALSO       VGTGVERTVAVDSGTAVQATRG--GLVDYVDANRVVIRVNDDEA----------------
RPOB_BORA1       VGTGIERTVAVDSGTTVQALRG--GLVDHVDAERVVIRVNDEEN----------------
RPOB_RHOFT       VGTGIERVAAIDSGTVVTATRG--GMVDYVDATRVVIRVNDDEA----------------
RPOB_POLSJ       VGTGIERVSAVDSGTVVTANRG--GVVDYVDATRIVVRVNDAEA----------------
RPOB_VEREI       VGTGIERVAAIDSGTVVTATRG--GSVDYVDATRIVVRVNDDET----------------
RPOB_METPP       VGTGVERVSAVDSGTVVTAKRG--GVVDYIDTNRIVIRVNDAET----------------
RPOB_NEIG1       VGTGIERSVAVDSATAIVARRG--GVVEYVDANRVVIRVHDDEA----------------
RPOB_CHRVO       VGTGIERSVAVDSGTTVVARRG--GVVDYVDAGRVVVRVNDEEA----------------
RPOB_ACIBT       VGTGMEANVARDSGVCVIANRG--GVIEYVDASRIVIRVNEDEM----------------
RPOB_PSYCK       VGTGMERHVARDSGVCVIAKRG--GVIEDVDASRVVVRVNEDEM----------------
RPOB_HAHCH       VGTGMERYVAQDSGVCVVARRG--GVVVSVDAARIVVRVSDDET----------------
RPOB_MARHV       VGTGVERTVAQDSGVCVTARRG--GVIESVDAARIVVRVNNEET----------------
RPOB_SACD2       VGTGMERNVAADSGVCVVAKRG--GVIERVDAARIVVRVADDEV----------------
RPOB_PSEU5       VGTGMERNVARDSGVCVVARRG--GVIDSVDASRIVVRVRDDEV----------------
RPOB_CHRSD       VGTGMERFVARDSGVCAVARRG--GVIDSVDAKRIVVRINEDEI----------------
RPOB_ALCBS       VGTGFERHVARDSGVCVVATRG--GIVDKVDASRIIVKVNDDEV----------------
RPOB_SODGM       VGTGMERAVAVDSGVTAVAKRG--GTVQYVDASRIVINVNPDEM----------------
RPOB_ECOLI       VGTGMERAVAVDSGVTAVAKRG--GVVQYVDASRIVIKVNEDEM----------------
RPOB_BAUCH       VGTGMERIVAVDSGVTVVAKRG--GIVQYVDASRIVINVHSDEM----------------
RPOB_BLOFL       VGTGMERSVAVDSGVTVVAKRG--GMVKYVDASRIVIHVNVNEI----------------
RPOB_BLOPB       VGTGMERAVAIDSGVTVVAKRG--GVIKYVDASRIVIHVNKNET----------------
RPOB_BUCAI       IGTGMERAVAVDSGVTAVAKRS--GVVQYVDASRIVIKVDEKEM----------------
RPOB_BUCAP       VGTGMERAVAVDSGVTVVAKRG--GIIQYIDASRIIIKVNEEET----------------
RPOB_BUCBP       VGTGMERAVAVDSGVTIIAKRG--GIVQYVDASRIIIKVKKNEI----------------
RPOB_WIGBR       IGTGMERAVAVDSGVTAVAKRG--GIVQFLDSSKIIIKVNQEEI----------------
RPOB_BUCCC       VGTGMERSVAIDSGVTIIAKRS--GKIEYVDASRIVVRIKDEKI----------------
RPOB_ACTP2       VGTGMEKPIALDSGVAIVAKRG--GIVQRVDASRIVVKVNEDET----------------
RPOB_MANSM       VGTGMEKPIALDSGVAVVAKRG--GIIQYVDASRIVVKVNEDET----------------
RPOB_HAEI8       VGTGMEKPIALDSGVAVVAKRG--GTVQYVDASRIVIKVNEDET----------------
RPOB_ALIF1       VGTGIERNVAVDSGVTAVAKRG--GVVQSVDASRIVIKVNEDELVP--------------
RPOB_PHOPR       VGTGIERSVAVDSGVTAVAKRG--GQVQSVDASRIVVKVNEDEL----------------
RPOB_VIBCH       VGTGIERNVAVDSGVTAVAKRG--GVIQSVDASRIVVKVNEEEL----------------
RPOB_AERS4       VGTGMERAVAVDSGVTVVAKRG--GMIDYVDASRIVIKVNEDEL----------------
RPOB_COLP3       VGTGMEKVVAVDSGVTAVAKRG--GVVSYVDASRIVVKVNENEM----------------
RPOB_PSEA6       VGTGMEKTVAVDSGVTVVAKRG--GRVDYVDASRIVIKVNEEET----------------
RPOB_PSEHT       VGTGIELTLAKDSGVTIVAKRG--GEVMYCDASRIVVNVHEEER----------------
RPOB_SHEAM       VGTGIERALAVDSGVVVAAKRG--GVIDYVDASRIVVKVNEDEL----------------
RPOB_IDILO       VGTGIERTIAVDSGVTVVAKRG--GVVDYVDASRIVVKVNEEEM----------------
RPOB_PSYIN       VGTGIERRLAIDSGVTIIAKRS--GVIDYVDASRIVVKVDDNEL----------------
RPOB_DICNV       VGTGMERVVAMDSGVLVKAARG--GVIDSVDSSRIVVKVNDDEV----------------
RPOB_HYDCU       VGTGIEKTVAIDSGVTVIALRG--GEIVSSDSARIVVRANQEEI----------------
RPOB_VESOH       VGTGIERVVAKDSRVCVTAKHG--GVVEAVDASRIVIRVDSKKT----------------
RPOB_FRATO       VGTGMEKIVARDSGNCIIARNV--GEVAEVDSNRIVIKVDTEKS----------------
RPOB_RHIL3       VGTGMEPVVARDSGAAIGARRG--GVVDQVDATRIVIRA--TEDL---------------
RPOB_RHIME       VGTGMEPVVARDSGAAIAARRG--GIVDQVDATRIVIRA--TEDL---------------
RPOB_AGRFC       VGTGMEPIVARDSGAAIAARRG--GVVDQVDATRIVIRA--TEDL---------------
RPOB_RHILO       VGTGMEPIVARDSGAAIGARRG--GIVDQVDATRIVIRA--TEDL---------------
RPOB_CHESB       VGTGMEPVVARDSGAAIAARRT--GVVDQVDATRIVIRA--TEDV---------------
RPOB_BRUSU       VGTGMEPIVARDSGAAIAARRG--GIVDQVDATRIVIRA--TEEL---------------
RPOB_BARBK       VGTGMEAIVARDSGAAISAKRG--GIVDQVDATRIVIRA--TEDL---------------
RPOB_RHOPB       VGTGMEGVVARDSGAAIAARRT--GVIDQIDATRIVIRA--TDDL---------------
RPOB_GLUOX       VGTGMEAAVAHDSGATIVAKRR--GVIDQIDGARIVVRA--TDE----------------
RPOB_GRABC       VGTGMEAAVARDSGATIVARRA--GVVDQIDGARIVVRA--SGE----------------
RPOB_MAGSA       VGTGMEQAVARDSGAAITAKRT--GVVDQVDATRVVIRA--TEET---------------
RPOB_RHORT       VGTGMEAAVARDSGATIAAKRA--GVVQQVDATRIVIRA--TEDL---------------
RPOB_CAUVC       VGTGMEAVVARDSGAVVIAKRT--GVVEQIDGTRIVIRA--TEET---------------
RPOB_MARMM       VGTGMESIVARDSGAAIAARRT--GVIEQVDATRIVIRA--TEDL---------------
RPOB_HYPNA       VGTGMEAVVARDSRAAIVARRA--GVVEQVDAMRIVVRA--TEDL---------------
RPOB_RHOS1       VGTGIEAVVARDSGAAIMARRA--GVIDQVDATRIVVRA--TEML---------------
RPOB_PARDP       VGTGMEATVARDSGAAIMARRG--GIIDQVDAQRIVIRA--TEDL---------------
RPOB_ROSDO       VGTGIEEVVARDSGAAIMAKRA--GIIDQVDAQRIVIRA--TSDL---------------
RPOB_JANSC       VGTGIESVVAKDSGAAIMAKRG--GVIDQVDAQRIVIRA--TEDL---------------
RPOB_NOVAD       VGTGMEETVARDSGAAISALRS--GVVDQVDATRIVIRA--SGDI---------------
RPOB_ERYLH       VGTGMEETVARDSGAAITATRG--GIVDQVDATRIVIRA--IGDV---------------
RPOB_SPHAL       VGTGMEETVARDSGAAIAARRG--GVIDQVDATRIVIRA--TDMV---------------
RPOB_ZYMMO       VGTGMEETVARDSGAAISARRA--GIVDQVDASRIVIRT--TGEI---------------
RPOB_PELUB       VGTGIESDVALDSGVTIVASRD--GTVDKIDGKRIVIKA--TEET---------------
RPOB_RICBR       VGTGVEGVVAKDSGASVLALND--GIVEQVDSNRIVIRA--IAQK---------------
RPOB_ORITB       VGTGIESVVAHDSGTVVAALHD--GIVEQVDSTRIVVKT--SVKK---------------
RPOB_ANAMM       VGTGMEFVVAAGSGAVVLAKRD--GIVHRVDGSYIVIRA--FDAN---------------
RPOB_ANAPZ       VGTGMESVVAAGSGAVVLAKRD--GVVHRVDGSYIVIRA--FDKN---------------
RPOB_EHRRW       VGTGMESIVAAGSGTVVLAKRS--GIVHRVDGLYIVIRA--FDKE---------------
RPOB_NEOSM       VGTGMEGYVARGSGAVIVAKRA--GVVQYIDARNIVVAS--ESKD---------------
RPOB_MAGMM       VGTGIESVVARDSGVTITARRT--GVVDEVDAARIVVKA--DEEP---------------
RPOB_ANADE       VGTGIEAIVARDSGVTTVAKRD--GVVQSVDASRIVVKADVPTSA---------------
RPOB_MYXXD       VGTGIESIVARDSGVTCVARRD--GIVESVDAGRIVVKADVPASL---------------
RPOB_SYNFM       VGTGIERIVAKDSGVAIVARRT--GVVEYVDATRIVIRAIEDNG----------------
RPOB_SYNAS       VGTGMERIVARDSGAVVVAKRS--GIVESVDASRIVIKCE-SAEK---------------
RPOB_GEOSL       VGTGMERVVAKDSGVSVVARHT--GIVESVDASRIVVKID-EDEF---------------
RPOB_PELPD       VGTGMERIVAKDSGVSVIARHN--GVVESVDASRIVVKID-ESEV---------------
RPOB_PELCD       VGTGMERIVAHDSGAAVVARHN--GVVESVDASRIVVKID-EGEV---------------
RPOB_BDEBA       VGTGVERLVARDSGTSIVAQND--GIVEEVDASRIVIRRF-AKGG---------------
RPOB_DESPS       VGTGMERYVARDSGACLLSAGD--GVVEEVDSNRVVVRYD-KPGV---------------
RPOB_DESVV       VGTGMEGDVARDSGACILAEGP--GIVRYADATRIIVSYE-N-GL---------------
RPOB_DESAG       VGTGMEADVARDSGACIIAEAD--GVVRYADADRIVVSYE-G-DL---------------
RPOB_LAWIP       VGTGMEVDVAHDSGSCILAEGD--GIIRYADANRIIVSYD-DPNL---------------
RPOB_KORVE       VGTGMEGVTARDSGAVVLARRS--GIIDSVDSERVIVRVEGEHHPM--------------
RPOB_SOLUE       VGTGMEMVTARDSGAVVLNKRA--GVVDSVDSERIIVRVEGAAHEG--------------
RPOB_CAMJJ       VGTGMEQIIARDAWEAVKAKRG--GVVEKVDNKSIFILGEDDKGP---------------
RPOB_CAMFF       VGTGMEAIVARDAWEAIKAKRG--GVIEKVDNRNIFILGEDENGP---------------
RPOB_SULDN       VGTGVEKLVARDSWECVKARRS--GIVEKVDGKHIYVMGDDDGEI---------------
RPOB_BACV8       VGTGIEKQLVEDSRTQIAAEGD--GVVEYVDATTIRILYDRNEDEE--------------
RPOB_PARD8       VGTGIEAQVARDSRTQIMAERE--GEVVFVDATCIKIKYDRTEDEE--------------
RPOB_PORGI       VGTGIEGKLVKDSRTQIVAERG--GEVVFVDASCIKIRYDRTADEE--------------
RPOB_FLAPJ       VGTGLERQVASDSRVLINAEGA--GVVEYVDADMITIKYDRTDAER--------------
RPOB_GRAFK       VGTGLERQVATDSRVLINAEGE--GEVEYVDANKIVIKYDRTEEER--------------
RPOB_CYTH3       VGTGLERRVAMDSRTLLIAEAD--GVVEFVDANEIKMRYDLTDEDR--------------
RPOB_SALRD       VGTGLEGRVAKDSRSCVVAEGE--GVVEYVDAERLVVRYDEEQDKT--------------
RPOB_PELLD       VGTGMEAKVARDSRSVILGEGP--GFVEEVTSEFIKVRYDIDTENNEHMS----------
RPOB_CHLPD       VGTGMESKVARDSRSVILAEGD--GIVDDVTAEYIKVRYDIDADTDVRLS----------
RPOB_CHLCH       VGTGMEGKVARDSRAVIVAEGP--GEVVDVTADYIQVRYQLDADNNLRLS----------
RPOB_CHLTE       VGTGMEAKVARDSRAVIVAEGP--GVVQCVTADRIEVRYDLDPENN-TVS----------
RPOB_CHLMU       VGTGLEGRAAKDSGAIVVAQED--GVVEYVDSYEIVVAKKNNPTLK--------------
RPOB_CHLPN       VGTGLECRAAKDSGAIVVAEED--GVVDFVDGYKVVVAAKHNPTIK--------------
RPOB_PARUW       VGTGLEARAARDSGAVLIAHED--GVVDYVDGLKIVISPDDNRLEK--------------
RPOB_RHOBA       VGTGMEREVAKNSAMVVRARRA--GKVTYADATRIEIGSDH-------------------
RPOB_TREDE       VGTGMEKKCAYDSGVLVKAKRS--GKVEFVSSDTIIIAPE--------------------
RPOB_TREPA       VGTGMEEKCAYDSGVLVKAKQD--GTVAYVSSEKIVVCSA--------------------
RPOB_BORAP       VGTGMESVVAKDSGVVVKAKRS--GEVILATSNKIVVKPF--------------------
RPOB_LEPBL       VGTGMETRAAYDSRICIVNKHD--GVVTSVDAETIVVE----------------------
RPOB_FUSNN       IGTGLERKVAVDSGAVVTTKVS--GKVTYVDGKKIIIE----------------------
RPOB_CYAM1       VSTGQEKWMVQG----VFSKAD--GIVRSVQATSIRIQ----------------------
RPOB_AQUAE       IGTGMEKKIARDSHAVVVAKRG--GVVEEVDSSKIIIRVNPEEINF--------------
RPOB_DEIRA       VGTGVERRVVTDSGTSVVSDVN--GRVSYVDARAIQVTLSEDHREL--------------
RPOB_DEIGD       VGTGVEERVVTDSGTSVISDVT--GRVTYVDARAIQVTLTEDAPQI--------------
RPOB_THET8       VMTGLEERVVRDSLAALYAEED--GEVAKVDGNRIVVRYED-------------------
RPOB_THEMA       VGTGMEWEAAKNSGYVILAEHD--GIVKEVDAARVVVHRTDENGNLMYD-----------
RPOB_BACCR       VGTGMEYVSAKDSGAAVICKHP--GVVERVEAREVWVRRYVEV-----------------
RPOB_BACSU       VGTGMEYVSGKDSGAAVICKHP--GIVERVEAKNVWVRRYEEV-----------------
RPOB_BACHD       VGTGMEHVSAKDSGAAIVSKHR--GIVERVTAKEIWVRRLEEV-----------------
RPOB_GEOTN       VGTGMEYVSAKDSGAAIICKHR--GIVERVEAKEIWVRRLIEV-----------------
RPOB_OCEIH       VGTGMEYVNGKDSGAAVICHHD--GVIERVEAKEVYVRRISIV-----------------
RPOB_LISIN       VGTGMEHVSAKDSGAAVTAKHD--GIVEHVEAREIWVRRVSLV-----------------
RPOB_STAS1       VGTGMEHVAARDSGAAIVAKRK--GRVEHVESNEILVRQLIEE-----------------
RPOB_STRS2       VGTGMEYQAAHDSGAAIIAQHD--GKVVYADADKVEVRRED-------------------
RPOB_LACLA       IGTGMEHQTARDSGAALIAKHA--GVVEYVDGNEIRVRRTS-------------------
RPOB_LACGA       VGTGMEYRAAHDSGDALVAKAP--GVVEYVDANEIRIRRDD-------------------
RPOB_LACAC       VGTGMEYRAAHDSGAALIAKAA--GTVEYVDADEIRIRRED-------------------
RPOB_LACDB       VATGMEYRAGHDSGDALLAEAD--GEVEYVDANEIRVRRED-------------------
RPOB_LACPL       IGTGIEYKAAHDSGIALICRHE--GTVEYVDAREVRVRRDD-------------------
RPOB_LACBA       IGTGIEYKAAHDSGVALISQHD--GTVEYVDAREIRVRRED-------------------
RPOB_PEDPA       IGTGIEYKAAHDSGVALLCQHA--GVVEYVDAREVRVRRDD-------------------
RPOB_LACS1       VGTGIEYKAAHDSGVALISEHE--GTVEYVDAREIRVRRDD-------------------
RPOB_LACSS       VGTGMEYKAAHDSGIALLAQHA--GTVEYVDAKVIRVRRED-------------------
RPOB_LACP3       VGTGMEYKAAHDSGTAVLANNA--GTVEYVDAKQIRVRRED-------------------
RPOB_ENTFA       VGTGMEYKSAHDSGAALLCKHD--GVVEFVDAKEIRVRRDN-------------------
RPOB_LEUMM       VGTGIEYKAAHDSGVAMIARAS--GEVEYVDGRQIRVRRED-------------------
RPOB_OENOB       VGTGIEYRAAVDSGLAQIAEEK--GTVEYVDGRTIKVREED-------------------
RPOB_CARHZ       VGTGIEYKAAKDSGVVVLAKNP--GVVERVTADEIVIRND--------------------
RPOB_MOOTA       VGTGMEWRAARDSGTVVLARNN--GVVERVTAREIVIRTD--------------------
RPOB_SYMTH       VGTGMEYRSAWDSGVCVIAEND--GVVLRATASEVVVQYD--------------------
RPOB_DESHY       VGTGMEYKAAKDSGVCVLASKD--GTVERATAEDIIIRHD--------------------
RPOB_CLOAB       VGTGIEHKAAVDSGILPKARNA--GVVEYVSANEVRVRRD--------------------
RPOB_CLONN       VGTGIEYKAAVDSGVLPKAEHD--GVIEYVSSTEVRIRRD--------------------
RPOB_CLOPS       VGTGIEYKAAVDSGVLPKAKNA--GEVVYVSANEVRVKRE--------------------
RPOB_CLOTE       VGTGIEYKAAVDSAVLPKAKKP--GVVTYVSASEIRVKKDKP------------------
RPOB_HUNT2       VGTGIEYRAARDSGVVILAKNP--GVVEKVTANEIIIRTK--------------------
RPOB_CLOD6       IGTGIEYRAAKDSGAVVVARNS--GIAERVTADEIIIKRE--------------------
RPOB_CALS4       VGTGMEYKAAVDSGAVILAKND--GIVEKVTADKVVIRTK--------------------
RPOB_SYNWW       VGTGLEHKAARDSGAVVIAKKA--GTVKKASASRISIEKDD-------------------
RPOB_ONYPE       VGTGVEYRAAKDSGCLIIARES--GFVTYVDAQKIIITKKPNQNVSLNGKTLYDTTQEFT
RPOB_COREF       VGTGMELRAAYDAGDLVITPKA--GVVENVTADIVTIMDDE-------------------
RPOB_CORDI       VGTGMERAAAYDAGDLIINKKG--GVVENVSADIITVMADD-------------------
RPOB_CORJK       VGTGMELRAAYDAGDMIIAPKA--GVVEYVSADYITVMDDE-------------------
RPOB2_NOCFA      VGTGMELRAAVDAGDVVVNEKA--GVVEEVSADYVTVMADD-------------------
RPOB_RHOJR       VGTGMELRAAVDAGDVIVTEKT--GVVEEVSADYVTVMADD-------------------
RPOB_MYCS2       VGTGMELRAAIDAGDVVVADKT--GVIEEVSADYITVMADD-------------------
RPOB1_NOCFA      VGTGMELRAAVDAGDVVVNEKA--GVVEEVSADYVTVMADD-------------------
RPOB_SACEN       VGTGMELRAAVDAGDVVTAEKA--GVIEELCADYITVMADD-------------------
RPOB_FRAAA       VGTGMEARAAKDAGDVVVCVQA--GVVEDLSADYITVMHDD-------------------
RPOB_STRCO       VGTGMEYRSAADAGDVVKAEKA--GVVQEVSADYITTTNDD-------------------
RPOB_THEFY       VGTGMEYRAATDAGDVILAEKS--GVVEDVTADYITVLADD-------------------
RPOB_ACIC1       VGTGMEFRAAVDAGDVVIASKA--GVVEEVSADAITIAADD-------------------
RPOB_NOCSJ       VGTGIEYRAAVDAGDVVVATAA--GVVKEVSADVIETMNDD-------------------
RPOB_ARTS2       VGTGMERAAAVDAGDVVIAKKA--GVVTEVSAELVIMLNDD-------------------
RPOB_LEIXX       VGTGMEGYAAIDAGDVVIAEKS--GIVSEVSADAVTVQADD-------------------
RPOB_CUTAK       VGTGMEYRCAVDVGDVTLAEKA--GSVLSVSADLIDIACDD-------------------
RPOB_BIFAA       VGTGAEWRAAVDSGDVILAEKP--GVVTYVSADIIRTMNDD-------------------
RPOB_TROWT       VGTGMERYVAIDAGDVLIAEDP--GIVGDVSADVVTVKQDD-------------------
RPOB_RUBXD       VGTGMEFRAATDTGDVLLARNA--GTVERVTASRIVVRRED-------------------
RPOB_DEHMC       VATGMEREAARYSGQVIFAKHA--GVASSVTSEKIIIRTAE-------------------
RPOB_MYCMS       VATGIEFEAARDSGEAIVAKED--AIVKYVDSKTIITDGESGIR----------------
RPOB_MESFL       VGTGIEFEAARDSGVCIVATEN--GIVKYVDAKQITVESKAGIK----------------
RPOB_MYCMO       VATGIEADIAKFSVSNLIVKEE--GEVSYVDGTKIKVKSKNDKS----------------
RPOB_MYCPU       VATGIEADIAKFSPNNLKSTVD--GEVVFVDGSQIKIKDSASEKGS--------------
RPOB_MYCS5       VATGIEADIAKFSSYNIVANND--GEVIYVDGTKIQVRTAKKID----------------
RPOB_MYCH2       VATGIEEAVARFSATNLRAAIS--GKVTYVDAKKIIIDDGEKPE----------------
RPOB_CITSI       VGTGLEPQVALDSGVPAIAEHE--GKIIYTDIDKIVLSGNG-------------------
RPOB_POPTR       VGTGLERQVALDSGVPAIAEHE--GKIIYTDIDKIILSGNG-------------------
RPOB_AETGR       VGTGLERQVALDSGVPAIAEQE--GKILYTDTKKIILSGNGD------------------
RPOB_OENEH       VGTGLERQASLDSGVTAIAERE--GKIIYTNSDKIILSGSG-------------------
RPOB_NYMAL       VGTGLERQAALDSGGSAIAERE--GKIIYTDAEKIVLSGNG-------------------
RPOB_PIPCE       VGTGLERQAALDSGVSAISERE--GKVIYTNTDKIILSGNG-------------------
RPOB_PHAAO       VGTGLEGQTALDSGVSVIAECK--GKIIYTDTQKIFLSSNG-------------------
RPOB_DIOEL       VGTGLERQTALDSGVSAIAERE--GKIIYTDTHKIIFSSNG-------------------
RPOB_PHAVU       VGTGLECQVALDSGVSAIADHE--GNIVYTDTDRIFLFVNG-------------------
RPOB_LOTJA       VGTGLERQVALDSGTLAIAEHE--GKIIYKDTNKIVLFGSG-------------------
RPOB_JASNU       VGTGLERQVALDSGALAIAERE--GKIVSTDTEKILFSGNG-------------------
RPOB_LACSA       VGTGLEGQAALDSGALAIAEHE--GEIIYTDTDKILLSGNG-------------------
RPOB_SACHY       VGTGLERQTALDSRVSVIAERE--GKIISSDSHKILLSSSG-------------------
RPOB_PELHO       VGTGFEGQVALDSGIPLITEHA--GKIISTHTDKILLSVNG-------------------
RPOB_ANTAG       VGTGLESQTALDSGSVIVATEG--GRISYTDGRRITLLTKEK------------------
RPOB_MARPO       VGTGIESQTALDSGSVTVSSHG--GKIEYLDGNQIILSLKKK------------------
RPOB_PHYPA       VGTGLESQVALDSGNVMITKQS--EKIMYTDGKKISLLNNTN------------------
RPOB_PSINU       VGTGLEGQVALDSGSVTRSTQE--GQIVYVDGAKITLSLNDN------------------
RPOB_ANGEV       VGTGLESQIALDSGSVVVSNQD--GQIAYLDGETISILLQNE------------------
RPOB_PINTH       AGTGLEGQAALDSGSVAIATQE--GRIEYIDAVNITSSV-NG------------------
RPOB_CYCTA       VGTGLEGQAAPDSGSAAIATQG--GRITYIDAGKITSSV-DG------------------
RPOB_ADICA       VGTGLESQVALDSGSVAISEQD--GKVCYIDGNRIELSLIHE------------------
RPOB_HUPLU       VGTGLEGQAASDSGSVVIAEQG--GKVDYVDGKEITLLVNGG------------------
RPOB_CHAGL       VGTGFEANIARDSGAPLISNID--GKIQYLDSEFIEILGVDK------------------
RPOB_CHAVU       VGTGLEGQVALDSAALVLSKIE--GKVDFVDGRNINIRSNIV------------------
RPOB_STAPU       VGTGIEAHISLDSGTVLISLKD--GKIKYVDGKQIVLVDKDN------------------
RPOB_ZYGCR       VGTGIESQVALDSGTVITAVQE--CKIHNVDATQIAYVPKDS------------------
RPOB_NEPOL       IGTGLEAQVAADAGGVVQSPFE--GIVVYVDATRIVVSTSK-------------------
RPOB_OSTTA       VGTGLEAHVTRDIGATIVAKQN--SYISYVDAQRIDYFTPVI------------------
RPOB_MESVI       VGTGFEEQVALDSGTVVICRHK--GIVISVDSKTILV-----------------------
RPOB_CHLAT       VGTGLEAQAALDSGTVIVARHD--GIVSLVDSNKIIL-----------------------
RPOB_OLTVI       VGTGLECRVASDSGHVLQAKKS--GFVTYSSAEKITILSPVDSTPAVPKLSKGNNSPQHF
RPOB_BIGNA       VGTGLETKIFFDLQDNVKSPPN--GFISYLSLKKITI-----------------------
RPOB_PHATC       VGTGLENQIAIDSGMTLNSYSN--GVVSSVTANKIVV-----------------------
RPOB_THAPS       VGTGLENQIALDSGMVINAQRA--GIVESVTANKIII-----------------------
RPOB_TRIV2       VGTGLEAQGARDSGMVIVSRTD--GDVVYVDATEIRVRVSGQLPAAS-------------
RPOB_TRIEI       VGTGLEPQAARDSGMVVVTRTD--GEVSYVDSTKISV-----------------------
RPOB_SYNY3       VGTGLEAQAARDSGMVIVSRTH--GIVTYVDATEIRVQPHSP------------------
RPOB_SYNE7       VGTGLEPQAARDSGMVITSPVD--GTISYVDATHIEV-----------------------
RPOB_THEEB       VGTGLEAQAARDSGMVILSQTN--GVVSYVDANQIRV-----------------------
RPOB_SYNJA       VGTGLEAQAARDSGMVVVSRTS--GVVTYVSADEIVVR----------------------
RPOB_GLOVI       VGTGLEGQAARDSGMVIVSDID--GAITYVSGEQIRVR----------------------
RPOB_PROM5       VGTGLESQVARDSGMVPITKVN--GIVSYVDANEIVVK----------------------
RPOB_GUITH       VGTGLEAQAARDSGMVVVSIED--GQVTFVSGDKICVT----------------------
RPOB_RHDSA       IGTGIEAQAARDSGMVVVSYQD--GRVTYVSANKICIT----------------------
RPOB_PYRYE       IGTGLETKIARDSGMVVISRTS--GHVNYVSANKIGIQ----------------------
RPOB_GRATL       VGTGLEAKIAKDSGMTIISRTN--GTVSYVSGTKIGIQ----------------------
RPOB_CYAPA       VGTGLEFQVAKDSRRVLINKSE--GLVKRVTGDHICIQ----------------------
RPOB_CYACA       VGTGLEAQIAKDSGIMAISRSN--GIVKFTSAEKIIVT----------------------
RPOB_EMIHU       VGTGLESQTARDSGMAILSSNC--GKVVTLSDEQIVVQ----------------------
RPOB_EUGLO       IETGREILINRDSKSTIIAKES--GTVIYSSSKKIIIQKKSKKSKFKNINLFKKYFKKKL
                   ** *                            :                         

RPOB_MYCGE       ------------------------------------------------------------
RPOB_MYCPN       ------------------------------------------------------------
RPOB_MYCGA       ------------------------------------------------------------
RPOB_MYCPE       ------------------------------------------------------------
RPOB_UREPA       ------------------------------------------------------------
RPOB_ALKEH       ------------------------------------------------------------
RPOB_HALHL       ------------------------------------------------------------
RPOB_METCA       ------------------------------------------------------------
RPOB_XANC8       ------------------------------------------------------------
RPOB_XYLFT       ------------------------------------------------------------
RPOB_LEGPA       ------------------------------------------------------------
RPOB_COXBU       ------------------------------------------------------------
RPOB_NITOC       ------------------------------------------------------------
RPOB_AROAE       ------------------------------------------------------------
RPOB_AZOSB       ------------------------------------------------------------
RPOB_METFK       ------------------------------------------------------------
RPOB_NITEC       ------------------------------------------------------------
RPOB_NITMU       ------------------------------------------------------------
RPOB_THIDA       ------------------------------------------------------------
RPOB_DECAR       ------------------------------------------------------------
RPOB_PARXL       ------------------------------------------------------------
RPOB_HERAR       ------------------------------------------------------------
RPOB_RALSO       ------------------------------------------------------------
RPOB_BORA1       ------------------------------------------------------------
RPOB_RHOFT       ------------------------------------------------------------
RPOB_POLSJ       ------------------------------------------------------------
RPOB_VEREI       ------------------------------------------------------------
RPOB_METPP       ------------------------------------------------------------
RPOB_NEIG1       ------------------------------------------------------------
RPOB_CHRVO       ------------------------------------------------------------
RPOB_ACIBT       ------------------------------------------------------------
RPOB_PSYCK       ------------------------------------------------------------
RPOB_HAHCH       ------------------------------------------------------------
RPOB_MARHV       ------------------------------------------------------------
RPOB_SACD2       ------------------------------------------------------------
RPOB_PSEU5       ------------------------------------------------------------
RPOB_CHRSD       ------------------------------------------------------------
RPOB_ALCBS       ------------------------------------------------------------
RPOB_SODGM       ------------------------------------------------------------
RPOB_ECOLI       ------------------------------------------------------------
RPOB_BAUCH       ------------------------------------------------------------
RPOB_BLOFL       ------------------------------------------------------------
RPOB_BLOPB       ------------------------------------------------------------
RPOB_BUCAI       ------------------------------------------------------------
RPOB_BUCAP       ------------------------------------------------------------
RPOB_BUCBP       ------------------------------------------------------------
RPOB_WIGBR       ------------------------------------------------------------
RPOB_BUCCC       ------------------------------------------------------------
RPOB_ACTP2       ------------------------------------------------------------
RPOB_MANSM       ------------------------------------------------------------
RPOB_HAEI8       ------------------------------------------------------------
RPOB_ALIF1       ------------------------------------------------------------
RPOB_PHOPR       ------------------------------------------------------------
RPOB_VIBCH       ------------------------------------------------------------
RPOB_AERS4       ------------------------------------------------------------
RPOB_COLP3       ------------------------------------------------------------
RPOB_PSEA6       ------------------------------------------------------------
RPOB_PSEHT       ------------------------------------------------------------
RPOB_SHEAM       ------------------------------------------------------------
RPOB_IDILO       ------------------------------------------------------------
RPOB_PSYIN       ------------------------------------------------------------
RPOB_DICNV       ------------------------------------------------------------
RPOB_HYDCU       ------------------------------------------------------------
RPOB_VESOH       ------------------------------------------------------------
RPOB_FRATO       ------------------------------------------------------------
RPOB_RHIL3       ------------------------------------------------------------
RPOB_RHIME       ------------------------------------------------------------
RPOB_AGRFC       ------------------------------------------------------------
RPOB_RHILO       ------------------------------------------------------------
RPOB_CHESB       ------------------------------------------------------------
RPOB_BRUSU       ------------------------------------------------------------
RPOB_BARBK       ------------------------------------------------------------
RPOB_RHOPB       ------------------------------------------------------------
RPOB_GLUOX       ------------------------------------------------------------
RPOB_GRABC       ------------------------------------------------------------
RPOB_MAGSA       ------------------------------------------------------------
RPOB_RHORT       ------------------------------------------------------------
RPOB_CAUVC       ------------------------------------------------------------
RPOB_MARMM       ------------------------------------------------------------
RPOB_HYPNA       ------------------------------------------------------------
RPOB_RHOS1       ------------------------------------------------------------
RPOB_PARDP       ------------------------------------------------------------
RPOB_ROSDO       ------------------------------------------------------------
RPOB_JANSC       ------------------------------------------------------------
RPOB_NOVAD       ------------------------------------------------------------
RPOB_ERYLH       ------------------------------------------------------------
RPOB_SPHAL       ------------------------------------------------------------
RPOB_ZYMMO       ------------------------------------------------------------
RPOB_PELUB       ------------------------------------------------------------
RPOB_RICBR       ------------------------------------------------------------
RPOB_ORITB       ------------------------------------------------------------
RPOB_ANAMM       ------------------------------------------------------------
RPOB_ANAPZ       ------------------------------------------------------------
RPOB_EHRRW       ------------------------------------------------------------
RPOB_NEOSM       ------------------------------------------------------------
RPOB_MAGMM       ------------------------------------------------------------
RPOB_ANADE       ------------------------------------------------------------
RPOB_MYXXD       ------------------------------------------------------------
RPOB_SYNFM       ------------------------------------------------------------
RPOB_SYNAS       ------------------------------------------------------------
RPOB_GEOSL       ------------------------------------------------------------
RPOB_PELPD       ------------------------------------------------------------
RPOB_PELCD       ------------------------------------------------------------
RPOB_BDEBA       ------------------------------------------------------------
RPOB_DESPS       ------------------------------------------------------------
RPOB_DESVV       ------------------------------------------------------------
RPOB_DESAG       ------------------------------------------------------------
RPOB_LAWIP       ------------------------------------------------------------
RPOB_KORVE       ------------------------------------------------------------
RPOB_SOLUE       ------------------------------------------------------------
RPOB_CAMJJ       ------------------------------------------------------------
RPOB_CAMFF       ------------------------------------------------------------
RPOB_SULDN       ------------------------------------------------------------
RPOB_BACV8       ------------------------------------------------------------
RPOB_PARD8       ------------------------------------------------------------
RPOB_PORGI       ------------------------------------------------------------
RPOB_FLAPJ       ------------------------------------------------------------
RPOB_GRAFK       ------------------------------------------------------------
RPOB_CYTH3       ------------------------------------------------------------
RPOB_SALRD       ------------------------------------------------------------
RPOB_PELLD       ------------------------------------------------------------
RPOB_CHLPD       ------------------------------------------------------------
RPOB_CHLCH       ------------------------------------------------------------
RPOB_CHLTE       ------------------------------------------------------------
RPOB_CHLMU       ------------------------------------------------------------
RPOB_CHLPN       ------------------------------------------------------------
RPOB_PARUW       ------------------------------------------------------------
RPOB_RHOBA       ------------------------------------------------------------
RPOB_TREDE       ------------------------------------------------------------
RPOB_TREPA       ------------------------------------------------------------
RPOB_BORAP       ------------------------------------------------------------
RPOB_LEPBL       ------------------------------------------------------------
RPOB_FUSNN       ------------------------------------------------------------
RPOB_CYAM1       ------------------------------------------------------------
RPOB_AQUAE       ------------------------------------------------------------
RPOB_DEIRA       ------------------------------------------------------------
RPOB_DEIGD       ------------------------------------------------------------
RPOB_THET8       ------------------------------------------------------------
RPOB_THEMA       ------------------------------------------------------------
RPOB_BACCR       ------------------------------------------------------------
RPOB_BACSU       ------------------------------------------------------------
RPOB_BACHD       ------------------------------------------------------------
RPOB_GEOTN       ------------------------------------------------------------
RPOB_OCEIH       ------------------------------------------------------------
RPOB_LISIN       ------------------------------------------------------------
RPOB_STAS1       ------------------------------------------------------------
RPOB_STRS2       ------------------------------------------------------------
RPOB_LACLA       ------------------------------------------------------------
RPOB_LACGA       ------------------------------------------------------------
RPOB_LACAC       ------------------------------------------------------------
RPOB_LACDB       ------------------------------------------------------------
RPOB_LACPL       ------------------------------------------------------------
RPOB_LACBA       ------------------------------------------------------------
RPOB_PEDPA       ------------------------------------------------------------
RPOB_LACS1       ------------------------------------------------------------
RPOB_LACSS       ------------------------------------------------------------
RPOB_LACP3       ------------------------------------------------------------
RPOB_ENTFA       ------------------------------------------------------------
RPOB_LEUMM       ------------------------------------------------------------
RPOB_OENOB       ------------------------------------------------------------
RPOB_CARHZ       ------------------------------------------------------------
RPOB_MOOTA       ------------------------------------------------------------
RPOB_SYMTH       ------------------------------------------------------------
RPOB_DESHY       ------------------------------------------------------------
RPOB_CLOAB       ------------------------------------------------------------
RPOB_CLONN       ------------------------------------------------------------
RPOB_CLOPS       ------------------------------------------------------------
RPOB_CLOTE       ------------------------------------------------------------
RPOB_HUNT2       ------------------------------------------------------------
RPOB_CLOD6       ------------------------------------------------------------
RPOB_CALS4       ------------------------------------------------------------
RPOB_SYNWW       ------------------------------------------------------------
RPOB_ONYPE       YAQAKAL-----------------------------------------------------
RPOB_COREF       ------------------------------------------------------------
RPOB_CORDI       ------------------------------------------------------------
RPOB_CORJK       ------------------------------------------------------------
RPOB2_NOCFA      ------------------------------------------------------------
RPOB_RHOJR       ------------------------------------------------------------
RPOB_MYCS2       ------------------------------------------------------------
RPOB1_NOCFA      ------------------------------------------------------------
RPOB_SACEN       ------------------------------------------------------------
RPOB_FRAAA       ------------------------------------------------------------
RPOB_STRCO       ------------------------------------------------------------
RPOB_THEFY       ------------------------------------------------------------
RPOB_ACIC1       ------------------------------------------------------------
RPOB_NOCSJ       ------------------------------------------------------------
RPOB_ARTS2       ------------------------------------------------------------
RPOB_LEIXX       ------------------------------------------------------------
RPOB_CUTAK       ------------------------------------------------------------
RPOB_BIFAA       ------------------------------------------------------------
RPOB_TROWT       ------------------------------------------------------------
RPOB_RUBXD       ------------------------------------------------------------
RPOB_DEHMC       ------------------------------------------------------------
RPOB_MYCMS       ------------------------------------------------------------
RPOB_MESFL       ------------------------------------------------------------
RPOB_MYCMO       ------------------------------------------------------------
RPOB_MYCPU       ------------------------------------------------------------
RPOB_MYCS5       ------------------------------------------------------------
RPOB_MYCH2       ------------------------------------------------------------
RPOB_CITSI       ------------------------------------------------------------
RPOB_POPTR       ------------------------------------------------------------
RPOB_AETGR       ------------------------------------------------------------
RPOB_OENEH       ------------------------------------------------------------
RPOB_NYMAL       ------------------------------------------------------------
RPOB_PIPCE       ------------------------------------------------------------
RPOB_PHAAO       ------------------------------------------------------------
RPOB_DIOEL       ------------------------------------------------------------
RPOB_PHAVU       ------------------------------------------------------------
RPOB_LOTJA       ------------------------------------------------------------
RPOB_JASNU       ------------------------------------------------------------
RPOB_LACSA       ------------------------------------------------------------
RPOB_SACHY       ------------------------------------------------------------
RPOB_PELHO       ------------------------------------------------------------
RPOB_ANTAG       ------------------------------------------------------------
RPOB_MARPO       ------------------------------------------------------------
RPOB_PHYPA       ------------------------------------------------------------
RPOB_PSINU       ------------------------------------------------------------
RPOB_ANGEV       ------------------------------------------------------------
RPOB_PINTH       ------------------------------------------------------------
RPOB_CYCTA       ------------------------------------------------------------
RPOB_ADICA       ------------------------------------------------------------
RPOB_HUPLU       ------------------------------------------------------------
RPOB_CHAGL       ------------------------------------------------------------
RPOB_CHAVU       ------------------------------------------------------------
RPOB_STAPU       ------------------------------------------------------------
RPOB_ZYGCR       ------------------------------------------------------------
RPOB_NEPOL       ------------------------------------------------------------
RPOB_OSTTA       ------------------------------------------------------------
RPOB_MESVI       ------------------------------------------------------------
RPOB_CHLAT       ------------------------------------------------------------
RPOB_OLTVI       HESVGGSCKESQSLQAAAEGYLSGVASSSSSKFTGSSFSTISALNDGVLRRALTQKVLTT
RPOB_BIGNA       ------------------------------------------------------------
RPOB_PHATC       ------------------------------------------------------------
RPOB_THAPS       ------------------------------------------------------------
RPOB_TRIV2       ------------------------------------------------------------
RPOB_TRIEI       ------------------------------------------------------------
RPOB_SYNY3       ------------------------------------------------------------
RPOB_SYNE7       ------------------------------------------------------------
RPOB_THEEB       ------------------------------------------------------------
RPOB_SYNJA       ------------------------------------------------------------
RPOB_GLOVI       ------------------------------------------------------------
RPOB_PROM5       ------------------------------------------------------------
RPOB_GUITH       ------------------------------------------------------------
RPOB_RHDSA       ------------------------------------------------------------
RPOB_PYRYE       ------------------------------------------------------------
RPOB_GRATL       ------------------------------------------------------------
RPOB_CYAPA       ------------------------------------------------------------
RPOB_CYACA       ------------------------------------------------------------
RPOB_EMIHU       ------------------------------------------------------------
RPOB_EUGLO       KK----------------------------------------------------------
                                                                             

RPOB_MYCGE       ------------------------------------------------------------
RPOB_MYCPN       ------------------------------------------------------------
RPOB_MYCGA       ------------------------------------------------------------
RPOB_MYCPE       ------------------------------------------------------------
RPOB_UREPA       ------------------------------------------------------------
RPOB_ALKEH       ------------------------------------------------------------
RPOB_HALHL       ------------------------------------------------------------
RPOB_METCA       ------------------------------------------------------------
RPOB_XANC8       ------------------------------------------------------------
RPOB_XYLFT       ------------------------------------------------------------
RPOB_LEGPA       ------------------------------------------------------------
RPOB_COXBU       ------------------------------------------------------------
RPOB_NITOC       ------------------------------------------------------------
RPOB_AROAE       ------------------------------------------------------------
RPOB_AZOSB       ------------------------------------------------------------
RPOB_METFK       ------------------------------------------------------------
RPOB_NITEC       ------------------------------------------------------------
RPOB_NITMU       ------------------------------------------------------------
RPOB_THIDA       ------------------------------------------------------------
RPOB_DECAR       ------------------------------------------------------------
RPOB_PARXL       ------------------------------------------------------------
RPOB_HERAR       ------------------------------------------------------------
RPOB_RALSO       ------------------------------------------------------------
RPOB_BORA1       ------------------------------------------------------------
RPOB_RHOFT       ------------------------------------------------------------
RPOB_POLSJ       ------------------------------------------------------------
RPOB_VEREI       ------------------------------------------------------------
RPOB_METPP       ------------------------------------------------------------
RPOB_NEIG1       ------------------------------------------------------------
RPOB_CHRVO       ------------------------------------------------------------
RPOB_ACIBT       ------------------------------------------------------------
RPOB_PSYCK       ------------------------------------------------------------
RPOB_HAHCH       ------------------------------------------------------------
RPOB_MARHV       ------------------------------------------------------------
RPOB_SACD2       ------------------------------------------------------------
RPOB_PSEU5       ------------------------------------------------------------
RPOB_CHRSD       ------------------------------------------------------------
RPOB_ALCBS       ------------------------------------------------------------
RPOB_SODGM       ------------------------------------------------------------
RPOB_ECOLI       ------------------------------------------------------------
RPOB_BAUCH       ------------------------------------------------------------
RPOB_BLOFL       ------------------------------------------------------------
RPOB_BLOPB       ------------------------------------------------------------
RPOB_BUCAI       ------------------------------------------------------------
RPOB_BUCAP       ------------------------------------------------------------
RPOB_BUCBP       ------------------------------------------------------------
RPOB_WIGBR       ------------------------------------------------------------
RPOB_BUCCC       ------------------------------------------------------------
RPOB_ACTP2       ------------------------------------------------------------
RPOB_MANSM       ------------------------------------------------------------
RPOB_HAEI8       ------------------------------------------------------------
RPOB_ALIF1       ------------------------------------------------------------
RPOB_PHOPR       ------------------------------------------------------------
RPOB_VIBCH       ------------------------------------------------------------
RPOB_AERS4       ------------------------------------------------------------
RPOB_COLP3       ------------------------------------------------------------
RPOB_PSEA6       ------------------------------------------------------------
RPOB_PSEHT       ------------------------------------------------------------
RPOB_SHEAM       ------------------------------------------------------------
RPOB_IDILO       ------------------------------------------------------------
RPOB_PSYIN       ------------------------------------------------------------
RPOB_DICNV       ------------------------------------------------------------
RPOB_HYDCU       ------------------------------------------------------------
RPOB_VESOH       ------------------------------------------------------------
RPOB_FRATO       ------------------------------------------------------------
RPOB_RHIL3       ------------------------------------------------------------
RPOB_RHIME       ------------------------------------------------------------
RPOB_AGRFC       ------------------------------------------------------------
RPOB_RHILO       ------------------------------------------------------------
RPOB_CHESB       ------------------------------------------------------------
RPOB_BRUSU       ------------------------------------------------------------
RPOB_BARBK       ------------------------------------------------------------
RPOB_RHOPB       ------------------------------------------------------------
RPOB_GLUOX       ------------------------------------------------------------
RPOB_GRABC       ------------------------------------------------------------
RPOB_MAGSA       ------------------------------------------------------------
RPOB_RHORT       ------------------------------------------------------------
RPOB_CAUVC       ------------------------------------------------------------
RPOB_MARMM       ------------------------------------------------------------
RPOB_HYPNA       ------------------------------------------------------------
RPOB_RHOS1       ------------------------------------------------------------
RPOB_PARDP       ------------------------------------------------------------
RPOB_ROSDO       ------------------------------------------------------------
RPOB_JANSC       ------------------------------------------------------------
RPOB_NOVAD       ------------------------------------------------------------
RPOB_ERYLH       ------------------------------------------------------------
RPOB_SPHAL       ------------------------------------------------------------
RPOB_ZYMMO       ------------------------------------------------------------
RPOB_PELUB       ------------------------------------------------------------
RPOB_RICBR       ------------------------------------------------------------
RPOB_ORITB       ------------------------------------------------------------
RPOB_ANAMM       ------------------------------------------------------------
RPOB_ANAPZ       ------------------------------------------------------------
RPOB_EHRRW       ------------------------------------------------------------
RPOB_NEOSM       ------------------------------------------------------------
RPOB_MAGMM       ------------------------------------------------------------
RPOB_ANADE       ------------------------------------------------------------
RPOB_MYXXD       ------------------------------------------------------------
RPOB_SYNFM       ------------------------------------------------------------
RPOB_SYNAS       ------------------------------------------------------------
RPOB_GEOSL       ------------------------------------------------------------
RPOB_PELPD       ------------------------------------------------------------
RPOB_PELCD       ------------------------------------------------------------
RPOB_BDEBA       ------------------------------------------------------------
RPOB_DESPS       ------------------------------------------------------------
RPOB_DESVV       ------------------------------------------------------------
RPOB_DESAG       ------------------------------------------------------------
RPOB_LAWIP       ------------------------------------------------------------
RPOB_KORVE       ------------------------------------------------------------
RPOB_SOLUE       ------------------------------------------------------------
RPOB_CAMJJ       ------------------------------------------------------------
RPOB_CAMFF       ------------------------------------------------------------
RPOB_SULDN       ------------------------------------------------------------
RPOB_BACV8       ------------------------------------------------------------
RPOB_PARD8       ------------------------------------------------------------
RPOB_PORGI       ------------------------------------------------------------
RPOB_FLAPJ       ------------------------------------------------------------
RPOB_GRAFK       ------------------------------------------------------------
RPOB_CYTH3       ------------------------------------------------------------
RPOB_SALRD       ------------------------------------------------------------
RPOB_PELLD       ------------------------------------------------------------
RPOB_CHLPD       ------------------------------------------------------------
RPOB_CHLCH       ------------------------------------------------------------
RPOB_CHLTE       ------------------------------------------------------------
RPOB_CHLMU       ------------------------------------------------------------
RPOB_CHLPN       ------------------------------------------------------------
RPOB_PARUW       ------------------------------------------------------------
RPOB_RHOBA       ------------------------------------------------------------
RPOB_TREDE       ------------------------------------------------------------
RPOB_TREPA       ------------------------------------------------------------
RPOB_BORAP       ------------------------------------------------------------
RPOB_LEPBL       ------------------------------------------------------------
RPOB_FUSNN       ------------------------------------------------------------
RPOB_CYAM1       ------------------------------------------------------------
RPOB_AQUAE       ------------------------------------------------------------
RPOB_DEIRA       ------------------------------------------------------------
RPOB_DEIGD       ------------------------------------------------------------
RPOB_THET8       ------------------------------------------------------------
RPOB_THEMA       ------------------------------------------------------------
RPOB_BACCR       ------------------------------------------------------------
RPOB_BACSU       ------------------------------------------------------------
RPOB_BACHD       ------------------------------------------------------------
RPOB_GEOTN       ------------------------------------------------------------
RPOB_OCEIH       ------------------------------------------------------------
RPOB_LISIN       ------------------------------------------------------------
RPOB_STAS1       ------------------------------------------------------------
RPOB_STRS2       ------------------------------------------------------------
RPOB_LACLA       ------------------------------------------------------------
RPOB_LACGA       ------------------------------------------------------------
RPOB_LACAC       ------------------------------------------------------------
RPOB_LACDB       ------------------------------------------------------------
RPOB_LACPL       ------------------------------------------------------------
RPOB_LACBA       ------------------------------------------------------------
RPOB_PEDPA       ------------------------------------------------------------
RPOB_LACS1       ------------------------------------------------------------
RPOB_LACSS       ------------------------------------------------------------
RPOB_LACP3       ------------------------------------------------------------
RPOB_ENTFA       ------------------------------------------------------------
RPOB_LEUMM       ------------------------------------------------------------
RPOB_OENOB       ------------------------------------------------------------
RPOB_CARHZ       ------------------------------------------------------------
RPOB_MOOTA       ------------------------------------------------------------
RPOB_SYMTH       ------------------------------------------------------------
RPOB_DESHY       ------------------------------------------------------------
RPOB_CLOAB       ------------------------------------------------------------
RPOB_CLONN       ------------------------------------------------------------
RPOB_CLOPS       ------------------------------------------------------------
RPOB_CLOTE       ------------------------------------------------------------
RPOB_HUNT2       ------------------------------------------------------------
RPOB_CLOD6       ------------------------------------------------------------
RPOB_CALS4       ------------------------------------------------------------
RPOB_SYNWW       ------------------------------------------------------------
RPOB_ONYPE       ------------------------------------------------------------
RPOB_COREF       ------------------------------------------------------------
RPOB_CORDI       ------------------------------------------------------------
RPOB_CORJK       ------------------------------------------------------------
RPOB2_NOCFA      ------------------------------------------------------------
RPOB_RHOJR       ------------------------------------------------------------
RPOB_MYCS2       ------------------------------------------------------------
RPOB1_NOCFA      ------------------------------------------------------------
RPOB_SACEN       ------------------------------------------------------------
RPOB_FRAAA       ------------------------------------------------------------
RPOB_STRCO       ------------------------------------------------------------
RPOB_THEFY       ------------------------------------------------------------
RPOB_ACIC1       ------------------------------------------------------------
RPOB_NOCSJ       ------------------------------------------------------------
RPOB_ARTS2       ------------------------------------------------------------
RPOB_LEIXX       ------------------------------------------------------------
RPOB_CUTAK       ------------------------------------------------------------
RPOB_BIFAA       ------------------------------------------------------------
RPOB_TROWT       ------------------------------------------------------------
RPOB_RUBXD       ------------------------------------------------------------
RPOB_DEHMC       ------------------------------------------------------------
RPOB_MYCMS       ------------------------------------------------------------
RPOB_MESFL       ------------------------------------------------------------
RPOB_MYCMO       ------------------------------------------------------------
RPOB_MYCPU       ------------------------------------------------------------
RPOB_MYCS5       ------------------------------------------------------------
RPOB_MYCH2       ------------------------------------------------------------
RPOB_CITSI       ------------------------------------------------------------
RPOB_POPTR       ------------------------------------------------------------
RPOB_AETGR       ------------------------------------------------------------
RPOB_OENEH       ------------------------------------------------------------
RPOB_NYMAL       ------------------------------------------------------------
RPOB_PIPCE       ------------------------------------------------------------
RPOB_PHAAO       ------------------------------------------------------------
RPOB_DIOEL       ------------------------------------------------------------
RPOB_PHAVU       ------------------------------------------------------------
RPOB_LOTJA       ------------------------------------------------------------
RPOB_JASNU       ------------------------------------------------------------
RPOB_LACSA       ------------------------------------------------------------
RPOB_SACHY       ------------------------------------------------------------
RPOB_PELHO       ------------------------------------------------------------
RPOB_ANTAG       ------------------------------------------------------------
RPOB_MARPO       ------------------------------------------------------------
RPOB_PHYPA       ------------------------------------------------------------
RPOB_PSINU       ------------------------------------------------------------
RPOB_ANGEV       ------------------------------------------------------------
RPOB_PINTH       ------------------------------------------------------------
RPOB_CYCTA       ------------------------------------------------------------
RPOB_ADICA       ------------------------------------------------------------
RPOB_HUPLU       ------------------------------------------------------------
RPOB_CHAGL       ------------------------------------------------------------
RPOB_CHAVU       ------------------------------------------------------------
RPOB_STAPU       ------------------------------------------------------------
RPOB_ZYGCR       ------------------------------------------------------------
RPOB_NEPOL       ------------------------------------------------------------
RPOB_OSTTA       ------------------------------------------------------------
RPOB_MESVI       ------------------------------------------------------------
RPOB_CHLAT       ------------------------------------------------------------
RPOB_OLTVI       GTNCSSMLKNQRFFVEPKAQLYTGAQTPVGRVETILQPNHAEGYLSEVETIQQTQNKLPL
RPOB_BIGNA       ------------------------------------------------------------
RPOB_PHATC       ------------------------------------------------------------
RPOB_THAPS       ------------------------------------------------------------
RPOB_TRIV2       ------------------------------------------------------------
RPOB_TRIEI       ------------------------------------------------------------
RPOB_SYNY3       ------------------------------------------------------------
RPOB_SYNE7       ------------------------------------------------------------
RPOB_THEEB       ------------------------------------------------------------
RPOB_SYNJA       ------------------------------------------------------------
RPOB_GLOVI       ------------------------------------------------------------
RPOB_PROM5       ------------------------------------------------------------
RPOB_GUITH       ------------------------------------------------------------
RPOB_RHDSA       ------------------------------------------------------------
RPOB_PYRYE       ------------------------------------------------------------
RPOB_GRATL       ------------------------------------------------------------
RPOB_CYAPA       ------------------------------------------------------------
RPOB_CYACA       ------------------------------------------------------------
RPOB_EMIHU       ------------------------------------------------------------
RPOB_EUGLO       ------------------------------------------------------------
                                                                             

RPOB_MYCGE       ------------------------------------------------------------
RPOB_MYCPN       ------------------------------------------------------------
RPOB_MYCGA       ------------------------------------------------------------
RPOB_MYCPE       ------------------------------------------------------------
RPOB_UREPA       ------------------------------------------------------------
RPOB_ALKEH       ------------------------------------------------------------
RPOB_HALHL       ------------------------------------------------------------
RPOB_METCA       ------------------------------------------------------------
RPOB_XANC8       ------------------------------------------------------------
RPOB_XYLFT       ------------------------------------------------------------
RPOB_LEGPA       ------------------------------------------------------------
RPOB_COXBU       ------------------------------------------------------------
RPOB_NITOC       ------------------------------------------------------------
RPOB_AROAE       ------------------------------------------------------------
RPOB_AZOSB       ------------------------------------------------------------
RPOB_METFK       ------------------------------------------------------------
RPOB_NITEC       ------------------------------------------------------------
RPOB_NITMU       ------------------------------------------------------------
RPOB_THIDA       ------------------------------------------------------------
RPOB_DECAR       ------------------------------------------------------------
RPOB_PARXL       ------------------------------------------------------------
RPOB_HERAR       ------------------------------------------------------------
RPOB_RALSO       ------------------------------------------------------------
RPOB_BORA1       ------------------------------------------------------------
RPOB_RHOFT       ------------------------------------------------------------
RPOB_POLSJ       ------------------------------------------------------------
RPOB_VEREI       ------------------------------------------------------------
RPOB_METPP       ------------------------------------------------------------
RPOB_NEIG1       ------------------------------------------------------------
RPOB_CHRVO       ------------------------------------------------------------
RPOB_ACIBT       ------------------------------------------------------------
RPOB_PSYCK       ------------------------------------------------------------
RPOB_HAHCH       ------------------------------------------------------------
RPOB_MARHV       ------------------------------------------------------------
RPOB_SACD2       ------------------------------------------------------------
RPOB_PSEU5       ------------------------------------------------------------
RPOB_CHRSD       ------------------------------------------------------------
RPOB_ALCBS       ------------------------------------------------------------
RPOB_SODGM       ------------------------------------------------------------
RPOB_ECOLI       ------------------------------------------------------------
RPOB_BAUCH       ------------------------------------------------------------
RPOB_BLOFL       ------------------------------------------------------------
RPOB_BLOPB       ------------------------------------------------------------
RPOB_BUCAI       ------------------------------------------------------------
RPOB_BUCAP       ------------------------------------------------------------
RPOB_BUCBP       ------------------------------------------------------------
RPOB_WIGBR       ------------------------------------------------------------
RPOB_BUCCC       ------------------------------------------------------------
RPOB_ACTP2       ------------------------------------------------------------
RPOB_MANSM       ------------------------------------------------------------
RPOB_HAEI8       ------------------------------------------------------------
RPOB_ALIF1       ------------------------------------------------------------
RPOB_PHOPR       ------------------------------------------------------------
RPOB_VIBCH       ------------------------------------------------------------
RPOB_AERS4       ------------------------------------------------------------
RPOB_COLP3       ------------------------------------------------------------
RPOB_PSEA6       ------------------------------------------------------------
RPOB_PSEHT       ------------------------------------------------------------
RPOB_SHEAM       ------------------------------------------------------------
RPOB_IDILO       ------------------------------------------------------------
RPOB_PSYIN       ------------------------------------------------------------
RPOB_DICNV       ------------------------------------------------------------
RPOB_HYDCU       ------------------------------------------------------------
RPOB_VESOH       ------------------------------------------------------------
RPOB_FRATO       ------------------------------------------------------------
RPOB_RHIL3       ------------------------------------------------------------
RPOB_RHIME       ------------------------------------------------------------
RPOB_AGRFC       ------------------------------------------------------------
RPOB_RHILO       ------------------------------------------------------------
RPOB_CHESB       ------------------------------------------------------------
RPOB_BRUSU       ------------------------------------------------------------
RPOB_BARBK       ------------------------------------------------------------
RPOB_RHOPB       ------------------------------------------------------------
RPOB_GLUOX       ------------------------------------------------------------
RPOB_GRABC       ------------------------------------------------------------
RPOB_MAGSA       ------------------------------------------------------------
RPOB_RHORT       ------------------------------------------------------------
RPOB_CAUVC       ------------------------------------------------------------
RPOB_MARMM       ------------------------------------------------------------
RPOB_HYPNA       ------------------------------------------------------------
RPOB_RHOS1       ------------------------------------------------------------
RPOB_PARDP       ------------------------------------------------------------
RPOB_ROSDO       ------------------------------------------------------------
RPOB_JANSC       ------------------------------------------------------------
RPOB_NOVAD       ------------------------------------------------------------
RPOB_ERYLH       ------------------------------------------------------------
RPOB_SPHAL       ------------------------------------------------------------
RPOB_ZYMMO       ------------------------------------------------------------
RPOB_PELUB       ------------------------------------------------------------
RPOB_RICBR       ------------------------------------------------------------
RPOB_ORITB       ------------------------------------------------------------
RPOB_ANAMM       ------------------------------------------------------------
RPOB_ANAPZ       ------------------------------------------------------------
RPOB_EHRRW       ------------------------------------------------------------
RPOB_NEOSM       ------------------------------------------------------------
RPOB_MAGMM       ------------------------------------------------------------
RPOB_ANADE       ------------------------------------------------------------
RPOB_MYXXD       ------------------------------------------------------------
RPOB_SYNFM       ------------------------------------------------------------
RPOB_SYNAS       ------------------------------------------------------------
RPOB_GEOSL       ------------------------------------------------------------
RPOB_PELPD       ------------------------------------------------------------
RPOB_PELCD       ------------------------------------------------------------
RPOB_BDEBA       ------------------------------------------------------------
RPOB_DESPS       ------------------------------------------------------------
RPOB_DESVV       ------------------------------------------------------------
RPOB_DESAG       ------------------------------------------------------------
RPOB_LAWIP       ------------------------------------------------------------
RPOB_KORVE       ------------------------------------------------------------
RPOB_SOLUE       ------------------------------------------------------------
RPOB_CAMJJ       ------------------------------------------------------------
RPOB_CAMFF       ------------------------------------------------------------
RPOB_SULDN       ------------------------------------------------------------
RPOB_BACV8       ------------------------------------------------------------
RPOB_PARD8       ------------------------------------------------------------
RPOB_PORGI       ------------------------------------------------------------
RPOB_FLAPJ       ------------------------------------------------------------
RPOB_GRAFK       ------------------------------------------------------------
RPOB_CYTH3       ------------------------------------------------------------
RPOB_SALRD       ------------------------------------------------------------
RPOB_PELLD       ------------------------------------------------------------
RPOB_CHLPD       ------------------------------------------------------------
RPOB_CHLCH       ------------------------------------------------------------
RPOB_CHLTE       ------------------------------------------------------------
RPOB_CHLMU       ------------------------------------------------------------
RPOB_CHLPN       ------------------------------------------------------------
RPOB_PARUW       ------------------------------------------------------------
RPOB_RHOBA       ------------------------------------------------------------
RPOB_TREDE       ------------------------------------------------------------
RPOB_TREPA       ------------------------------------------------------------
RPOB_BORAP       ------------------------------------------------------------
RPOB_LEPBL       ------------------------------------------------------------
RPOB_FUSNN       ------------------------------------------------------------
RPOB_CYAM1       ------------------------------------------------------------
RPOB_AQUAE       ------------------------------------------------------------
RPOB_DEIRA       ------------------------------------------------------------
RPOB_DEIGD       ------------------------------------------------------------
RPOB_THET8       ------------------------------------------------------------
RPOB_THEMA       ------------------------------------------------------------
RPOB_BACCR       ------------------------------------------------------------
RPOB_BACSU       ------------------------------------------------------------
RPOB_BACHD       ------------------------------------------------------------
RPOB_GEOTN       ------------------------------------------------------------
RPOB_OCEIH       ------------------------------------------------------------
RPOB_LISIN       ------------------------------------------------------------
RPOB_STAS1       ------------------------------------------------------------
RPOB_STRS2       ------------------------------------------------------------
RPOB_LACLA       ------------------------------------------------------------
RPOB_LACGA       ------------------------------------------------------------
RPOB_LACAC       ------------------------------------------------------------
RPOB_LACDB       ------------------------------------------------------------
RPOB_LACPL       ------------------------------------------------------------
RPOB_LACBA       ------------------------------------------------------------
RPOB_PEDPA       ------------------------------------------------------------
RPOB_LACS1       ------------------------------------------------------------
RPOB_LACSS       ------------------------------------------------------------
RPOB_LACP3       ------------------------------------------------------------
RPOB_ENTFA       ------------------------------------------------------------
RPOB_LEUMM       ------------------------------------------------------------
RPOB_OENOB       ------------------------------------------------------------
RPOB_CARHZ       ------------------------------------------------------------
RPOB_MOOTA       ------------------------------------------------------------
RPOB_SYMTH       ------------------------------------------------------------
RPOB_DESHY       ------------------------------------------------------------
RPOB_CLOAB       ------------------------------------------------------------
RPOB_CLONN       ------------------------------------------------------------
RPOB_CLOPS       ------------------------------------------------------------
RPOB_CLOTE       ------------------------------------------------------------
RPOB_HUNT2       ------------------------------------------------------------
RPOB_CLOD6       ------------------------------------------------------------
RPOB_CALS4       ------------------------------------------------------------
RPOB_SYNWW       ------------------------------------------------------------
RPOB_ONYPE       ------------------------------------------------------------
RPOB_COREF       ------------------------------------------------------------
RPOB_CORDI       ------------------------------------------------------------
RPOB_CORJK       ------------------------------------------------------------
RPOB2_NOCFA      ------------------------------------------------------------
RPOB_RHOJR       ------------------------------------------------------------
RPOB_MYCS2       ------------------------------------------------------------
RPOB1_NOCFA      ------------------------------------------------------------
RPOB_SACEN       ------------------------------------------------------------
RPOB_FRAAA       ------------------------------------------------------------
RPOB_STRCO       ------------------------------------------------------------
RPOB_THEFY       ------------------------------------------------------------
RPOB_ACIC1       ------------------------------------------------------------
RPOB_NOCSJ       ------------------------------------------------------------
RPOB_ARTS2       ------------------------------------------------------------
RPOB_LEIXX       ------------------------------------------------------------
RPOB_CUTAK       ------------------------------------------------------------
RPOB_BIFAA       ------------------------------------------------------------
RPOB_TROWT       ------------------------------------------------------------
RPOB_RUBXD       ------------------------------------------------------------
RPOB_DEHMC       ------------------------------------------------------------
RPOB_MYCMS       ------------------------------------------------------------
RPOB_MESFL       ------------------------------------------------------------
RPOB_MYCMO       ------------------------------------------------------------
RPOB_MYCPU       ------------------------------------------------------------
RPOB_MYCS5       ------------------------------------------------------------
RPOB_MYCH2       ------------------------------------------------------------
RPOB_CITSI       ------------------------------------------------------------
RPOB_POPTR       ------------------------------------------------------------
RPOB_AETGR       ------------------------------------------------------------
RPOB_OENEH       ------------------------------------------------------------
RPOB_NYMAL       ------------------------------------------------------------
RPOB_PIPCE       ------------------------------------------------------------
RPOB_PHAAO       ------------------------------------------------------------
RPOB_DIOEL       ------------------------------------------------------------
RPOB_PHAVU       ------------------------------------------------------------
RPOB_LOTJA       ------------------------------------------------------------
RPOB_JASNU       ------------------------------------------------------------
RPOB_LACSA       ------------------------------------------------------------
RPOB_SACHY       ------------------------------------------------------------
RPOB_PELHO       ------------------------------------------------------------
RPOB_ANTAG       ------------------------------------------------------------
RPOB_MARPO       ------------------------------------------------------------
RPOB_PHYPA       ------------------------------------------------------------
RPOB_PSINU       ------------------------------------------------------------
RPOB_ANGEV       ------------------------------------------------------------
RPOB_PINTH       ------------------------------------------------------------
RPOB_CYCTA       ------------------------------------------------------------
RPOB_ADICA       ------------------------------------------------------------
RPOB_HUPLU       ------------------------------------------------------------
RPOB_CHAGL       ------------------------------------------------------------
RPOB_CHAVU       ------------------------------------------------------------
RPOB_STAPU       ------------------------------------------------------------
RPOB_ZYGCR       ------------------------------------------------------------
RPOB_NEPOL       ------------------------------------------------------------
RPOB_OSTTA       ------------------------------------------------------------
RPOB_MESVI       ------------------------------------------------------------
RPOB_CHLAT       ------------------------------------------------------------
RPOB_OLTVI       QVRFGVEAPKSSFDSEATKISSTLNSIPQHPVLGEDSPSKQVGWALKDPQIQTMLKPKWH
RPOB_BIGNA       ------------------------------------------------------------
RPOB_PHATC       ------------------------------------------------------------
RPOB_THAPS       ------------------------------------------------------------
RPOB_TRIV2       ------------------------------------------------------------
RPOB_TRIEI       ------------------------------------------------------------
RPOB_SYNY3       ------------------------------------------------------------
RPOB_SYNE7       ------------------------------------------------------------
RPOB_THEEB       ------------------------------------------------------------
RPOB_SYNJA       ------------------------------------------------------------
RPOB_GLOVI       ------------------------------------------------------------
RPOB_PROM5       ------------------------------------------------------------
RPOB_GUITH       ------------------------------------------------------------
RPOB_RHDSA       ------------------------------------------------------------
RPOB_PYRYE       ------------------------------------------------------------
RPOB_GRATL       ------------------------------------------------------------
RPOB_CYAPA       ------------------------------------------------------------
RPOB_CYACA       ------------------------------------------------------------
RPOB_EMIHU       ------------------------------------------------------------
RPOB_EUGLO       ------------------------------------------------------------
                                                                             

RPOB_MYCGE       ------------------------------------------------------------
RPOB_MYCPN       ------------------------------------------------------------
RPOB_MYCGA       ------------------------------------------------------------
RPOB_MYCPE       ------------------------------------------------------------
RPOB_UREPA       ------------------------------------------------------------
RPOB_ALKEH       ------------------------------------------------------------
RPOB_HALHL       ------------------------------------------------------------
RPOB_METCA       ------------------------------------------------------------
RPOB_XANC8       ------------------------------------------------------------
RPOB_XYLFT       ------------------------------------------------------------
RPOB_LEGPA       ------------------------------------------------------------
RPOB_COXBU       ------------------------------------------------------------
RPOB_NITOC       ------------------------------------------------------------
RPOB_AROAE       ------------------------------------------------------------
RPOB_AZOSB       ------------------------------------------------------------
RPOB_METFK       ------------------------------------------------------------
RPOB_NITEC       ------------------------------------------------------------
RPOB_NITMU       ------------------------------------------------------------
RPOB_THIDA       ------------------------------------------------------------
RPOB_DECAR       ------------------------------------------------------------
RPOB_PARXL       ------------------------------------------------------------
RPOB_HERAR       ------------------------------------------------------------
RPOB_RALSO       ------------------------------------------------------------
RPOB_BORA1       ------------------------------------------------------------
RPOB_RHOFT       ------------------------------------------------------------
RPOB_POLSJ       ------------------------------------------------------------
RPOB_VEREI       ------------------------------------------------------------
RPOB_METPP       ------------------------------------------------------------
RPOB_NEIG1       ------------------------------------------------------------
RPOB_CHRVO       ------------------------------------------------------------
RPOB_ACIBT       ------------------------------------------------------------
RPOB_PSYCK       ------------------------------------------------------------
RPOB_HAHCH       ------------------------------------------------------------
RPOB_MARHV       ------------------------------------------------------------
RPOB_SACD2       ------------------------------------------------------------
RPOB_PSEU5       ------------------------------------------------------------
RPOB_CHRSD       ------------------------------------------------------------
RPOB_ALCBS       ------------------------------------------------------------
RPOB_SODGM       ------------------------------------------------------------
RPOB_ECOLI       ------------------------------------------------------------
RPOB_BAUCH       ------------------------------------------------------------
RPOB_BLOFL       ------------------------------------------------------------
RPOB_BLOPB       ------------------------------------------------------------
RPOB_BUCAI       ------------------------------------------------------------
RPOB_BUCAP       ------------------------------------------------------------
RPOB_BUCBP       ------------------------------------------------------------
RPOB_WIGBR       ------------------------------------------------------------
RPOB_BUCCC       ------------------------------------------------------------
RPOB_ACTP2       ------------------------------------------------------------
RPOB_MANSM       ------------------------------------------------------------
RPOB_HAEI8       ------------------------------------------------------------
RPOB_ALIF1       ------------------------------------------------------------
RPOB_PHOPR       ------------------------------------------------------------
RPOB_VIBCH       ------------------------------------------------------------
RPOB_AERS4       ------------------------------------------------------------
RPOB_COLP3       ------------------------------------------------------------
RPOB_PSEA6       ------------------------------------------------------------
RPOB_PSEHT       ------------------------------------------------------------
RPOB_SHEAM       ------------------------------------------------------------
RPOB_IDILO       ------------------------------------------------------------
RPOB_PSYIN       ------------------------------------------------------------
RPOB_DICNV       ------------------------------------------------------------
RPOB_HYDCU       ------------------------------------------------------------
RPOB_VESOH       ------------------------------------------------------------
RPOB_FRATO       ------------------------------------------------------------
RPOB_RHIL3       ------------------------------------------------------------
RPOB_RHIME       ------------------------------------------------------------
RPOB_AGRFC       ------------------------------------------------------------
RPOB_RHILO       ------------------------------------------------------------
RPOB_CHESB       ------------------------------------------------------------
RPOB_BRUSU       ------------------------------------------------------------
RPOB_BARBK       ------------------------------------------------------------
RPOB_RHOPB       ------------------------------------------------------------
RPOB_GLUOX       ------------------------------------------------------------
RPOB_GRABC       ------------------------------------------------------------
RPOB_MAGSA       ------------------------------------------------------------
RPOB_RHORT       ------------------------------------------------------------
RPOB_CAUVC       ------------------------------------------------------------
RPOB_MARMM       ------------------------------------------------------------
RPOB_HYPNA       ------------------------------------------------------------
RPOB_RHOS1       ------------------------------------------------------------
RPOB_PARDP       ------------------------------------------------------------
RPOB_ROSDO       ------------------------------------------------------------
RPOB_JANSC       ------------------------------------------------------------
RPOB_NOVAD       ------------------------------------------------------------
RPOB_ERYLH       ------------------------------------------------------------
RPOB_SPHAL       ------------------------------------------------------------
RPOB_ZYMMO       ------------------------------------------------------------
RPOB_PELUB       ------------------------------------------------------------
RPOB_RICBR       ------------------------------------------------------------
RPOB_ORITB       ------------------------------------------------------------
RPOB_ANAMM       ------------------------------------------------------------
RPOB_ANAPZ       ------------------------------------------------------------
RPOB_EHRRW       ------------------------------------------------------------
RPOB_NEOSM       ------------------------------------------------------------
RPOB_MAGMM       ------------------------------------------------------------
RPOB_ANADE       ------------------------------------------------------------
RPOB_MYXXD       ------------------------------------------------------------
RPOB_SYNFM       ------------------------------------------------------------
RPOB_SYNAS       ------------------------------------------------------------
RPOB_GEOSL       ------------------------------------------------------------
RPOB_PELPD       ------------------------------------------------------------
RPOB_PELCD       ------------------------------------------------------------
RPOB_BDEBA       ------------------------------------------------------------
RPOB_DESPS       ------------------------------------------------------------
RPOB_DESVV       ------------------------------------------------------------
RPOB_DESAG       ------------------------------------------------------------
RPOB_LAWIP       ------------------------------------------------------------
RPOB_KORVE       ------------------------------------------------------------
RPOB_SOLUE       ------------------------------------------------------------
RPOB_CAMJJ       ------------------------------------------------------------
RPOB_CAMFF       ------------------------------------------------------------
RPOB_SULDN       ------------------------------------------------------------
RPOB_BACV8       ------------------------------------------------------------
RPOB_PARD8       ------------------------------------------------------------
RPOB_PORGI       ------------------------------------------------------------
RPOB_FLAPJ       ------------------------------------------------------------
RPOB_GRAFK       ------------------------------------------------------------
RPOB_CYTH3       ------------------------------------------------------------
RPOB_SALRD       ------------------------------------------------------------
RPOB_PELLD       ------------------------------------------------------------
RPOB_CHLPD       ------------------------------------------------------------
RPOB_CHLCH       ------------------------------------------------------------
RPOB_CHLTE       ------------------------------------------------------------
RPOB_CHLMU       ------------------------------------------------------------
RPOB_CHLPN       ------------------------------------------------------------
RPOB_PARUW       ------------------------------------------------------------
RPOB_RHOBA       ------------------------------------------------------------
RPOB_TREDE       ------------------------------------------------------------
RPOB_TREPA       ------------------------------------------------------------
RPOB_BORAP       ------------------------------------------------------------
RPOB_LEPBL       ------------------------------------------------------------
RPOB_FUSNN       ------------------------------------------------------------
RPOB_CYAM1       ------------------------------------------------------------
RPOB_AQUAE       ------------------------------------------------------------
RPOB_DEIRA       ------------------------------------------------------------
RPOB_DEIGD       ------------------------------------------------------------
RPOB_THET8       ------------------------------------------------------------
RPOB_THEMA       ------------------------------------------------------------
RPOB_BACCR       ------------------------------------------------------------
RPOB_BACSU       ------------------------------------------------------------
RPOB_BACHD       ------------------------------------------------------------
RPOB_GEOTN       ------------------------------------------------------------
RPOB_OCEIH       ------------------------------------------------------------
RPOB_LISIN       ------------------------------------------------------------
RPOB_STAS1       ------------------------------------------------------------
RPOB_STRS2       ------------------------------------------------------------
RPOB_LACLA       ------------------------------------------------------------
RPOB_LACGA       ------------------------------------------------------------
RPOB_LACAC       ------------------------------------------------------------
RPOB_LACDB       ------------------------------------------------------------
RPOB_LACPL       ------------------------------------------------------------
RPOB_LACBA       ------------------------------------------------------------
RPOB_PEDPA       ------------------------------------------------------------
RPOB_LACS1       ------------------------------------------------------------
RPOB_LACSS       ------------------------------------------------------------
RPOB_LACP3       ------------------------------------------------------------
RPOB_ENTFA       ------------------------------------------------------------
RPOB_LEUMM       ------------------------------------------------------------
RPOB_OENOB       ------------------------------------------------------------
RPOB_CARHZ       ------------------------------------------------------------
RPOB_MOOTA       ------------------------------------------------------------
RPOB_SYMTH       ------------------------------------------------------------
RPOB_DESHY       ------------------------------------------------------------
RPOB_CLOAB       ------------------------------------------------------------
RPOB_CLONN       ------------------------------------------------------------
RPOB_CLOPS       ------------------------------------------------------------
RPOB_CLOTE       ------------------------------------------------------------
RPOB_HUNT2       ------------------------------------------------------------
RPOB_CLOD6       ------------------------------------------------------------
RPOB_CALS4       ------------------------------------------------------------
RPOB_SYNWW       ------------------------------------------------------------
RPOB_ONYPE       ------------------------------------------------------------
RPOB_COREF       ------------------------------------------------------------
RPOB_CORDI       ------------------------------------------------------------
RPOB_CORJK       ------------------------------------------------------------
RPOB2_NOCFA      ------------------------------------------------------------
RPOB_RHOJR       ------------------------------------------------------------
RPOB_MYCS2       ------------------------------------------------------------
RPOB1_NOCFA      ------------------------------------------------------------
RPOB_SACEN       ------------------------------------------------------------
RPOB_FRAAA       ------------------------------------------------------------
RPOB_STRCO       ------------------------------------------------------------
RPOB_THEFY       ------------------------------------------------------------
RPOB_ACIC1       ------------------------------------------------------------
RPOB_NOCSJ       ------------------------------------------------------------
RPOB_ARTS2       ------------------------------------------------------------
RPOB_LEIXX       ------------------------------------------------------------
RPOB_CUTAK       ------------------------------------------------------------
RPOB_BIFAA       ------------------------------------------------------------
RPOB_TROWT       ------------------------------------------------------------
RPOB_RUBXD       ------------------------------------------------------------
RPOB_DEHMC       ------------------------------------------------------------
RPOB_MYCMS       ------------------------------------------------------------
RPOB_MESFL       ------------------------------------------------------------
RPOB_MYCMO       ------------------------------------------------------------
RPOB_MYCPU       ------------------------------------------------------------
RPOB_MYCS5       ------------------------------------------------------------
RPOB_MYCH2       ------------------------------------------------------------
RPOB_CITSI       --------------------------NT--------------------------------
RPOB_POPTR       --------------------------YT--------------------------------
RPOB_AETGR       --------------------------NT--------------------------------
RPOB_OENEH       --------------------------DT--------------------------------
RPOB_NYMAL       --------------------------DT--------------------------------
RPOB_PIPCE       --------------------------DT--------------------------------
RPOB_PHAAO       --------------------------DT--------------------------------
RPOB_DIOEL       --------------------------DT--------------------------------
RPOB_PHAVU       --------------------------DT--------------------------------
RPOB_LOTJA       --------------------------ET--------------------------------
RPOB_JASNU       --------------------------DT--------------------------------
RPOB_LACSA       --------------------------DT--------------------------------
RPOB_SACHY       --------------------------KT--------------------------------
RPOB_PELHO       --------------------------ET--------------------------------
RPOB_ANTAG       --------------------------E---------------------------------
RPOB_MARPO       --------------------------K---------------------------------
RPOB_PHYPA       --------------------------ET--------------------------------
RPOB_PSINU       --------------------------ET--------------------------------
RPOB_ANGEV       --------------------------KT--------------------------------
RPOB_PINTH       --------------------------DT--------------------------------
RPOB_CYCTA       --------------------------DT--------------------------------
RPOB_ADICA       --------------------------AKKN------------------------------
RPOB_HUPLU       --------------------------G---------------------------------
RPOB_CHAGL       --------------------------KT--------------------------------
RPOB_CHAVU       --------------------------INE-------------------------------
RPOB_STAPU       --------------------------VQ--------------------------------
RPOB_ZYGCR       --------------------------FE--------------------------------
RPOB_NEPOL       ------------------------------------------------------------
RPOB_OSTTA       --------------------------GDTNLI----------------------------
RPOB_MESVI       ---------------RSLRMNAKGIQHS--------------------------------
RPOB_CHLAT       ---------------RSSCGSNQTKVDSV-------------------------------
RPOB_OLTVI       HSAQTMSRENWYQNLKGQNVKTFTQVESGRLVTKPTNTKMPMSSLAGTANSKKTGEALYK
RPOB_BIGNA       ---SNIRNEHKSFNFKSNPLETITCIKS-----KSRNFNRLKYNLKDLLTN---------
RPOB_PHATC       ------------------------NDKTG-------------------------------
RPOB_THAPS       ------------------------LEDSG-------------------------------
RPOB_TRIV2       ---------------GKSTDNGQLTSQKGQ------------------------------
RPOB_TRIEI       ------------------------IDKEGN------------------------------
RPOB_SYNY3       ----------------------DNPAEKGE------------------------------
RPOB_SYNE7       ------------------------TADTGE------------------------------
RPOB_THEEB       ------------------------KTDNGP------------------------------
RPOB_SYNJA       ------------------------PDDGGD------------------------------
RPOB_GLOVI       -------------------------GENGQ------------------------------
RPOB_PROM5       -------------------------DVDGN------------------------------
RPOB_GUITH       -------------------------NKKGD------------------------------
RPOB_RHDSA       -------------------------DDEGK------------------------------
RPOB_PYRYE       -------------------------DNSGR------------------------------
RPOB_GRATL       -------------------------NKEGY------------------------------
RPOB_CYAPA       -------------------------TDTGK------------------------------
RPOB_CYACA       -------------------------DSSNN------------------------------
RPOB_EMIHU       -------------------------DKNGN------------------------------
RPOB_EUGLO       ------------------------------------------------------------
                                                                             

RPOB_MYCGE       ------------------SKKETVNLVKFERSNQNTCYNHKPIVEI--------------
RPOB_MYCPN       ------------------GEQHTLDLIKFERSNQNTCYNHVPLVEK--------------
RPOB_MYCGA       ------------------NKSTDYNLLKFVKSNKNTCYNQSPIVAV--------------
RPOB_MYCPE       ------------------EEK-VYELTKFNKSNQNTCNNQVPIVSV--------------
RPOB_UREPA       ------------------DKLDDYKLIKYRKSNQDTCNNQIPIVKV--------------
RPOB_ALKEH       --------------AG-EPGVDIYNLVKYLRSNQNTCMNQKPLVRP--------------
RPOB_HALHL       --------------PG-EPGVDIYSLTKYTRSNQNTCFSQKPLVHV--------------
RPOB_METCA       --------------AG-VPGVDIYNLTKYTRSNQNTCINQRPLVKP--------------
RPOB_XANC8       --------------GGTDAGVDIYNLIKYTRSNQNTCINQRPLVNV--------------
RPOB_XYLFT       --------------GATDAGVDIYGLIKYTRSNQNTCINQRPLVNV--------------
RPOB_LEGPA       --------------TAGETGVDIYNLTKYFRSNQDTCINQRPIVST--------------
RPOB_COXBU       --------------DDDDIGVDIYNLTKFTRSNQNTCINQHPIVEV--------------
RPOB_NITOC       --------------ASDEPGVDIYNLIKYARSNQNTCINQSPLVKP--------------
RPOB_AROAE       --------------LAGEVGVDIYNMIKYTRSNQNTNINQRPVVKV--------------
RPOB_AZOSB       --------------LAGEVGVDIYNMIKYTRSNQNTNINQRPVVRV--------------
RPOB_METFK       --------------AAGEVGVDIYNLIKYTRSNQNTNINQRPLVNV--------------
RPOB_NITEC       --------------RAGEVGVDIYNLTKYIRSNQNTNINQRPIVKI--------------
RPOB_NITMU       --------------RAGEVGVDIYNLTKYTRSNQNTNINQRPLVKV--------------
RPOB_THIDA       --------------RAGEVGVDIYSLIKYTRSNQNTNINQRPLVKV--------------
RPOB_DECAR       --------------IAGEVGVDIYNLVKYTRSNQNTNINQRPMVRV--------------
RPOB_PARXL       --------------VAGDVGVDIYNLIKYTRSNQNTNINQRPIVKV--------------
RPOB_HERAR       --------------QAGEVGVDIYNLIKYTRSNQNTNINQRPIVQV--------------
RPOB_RALSO       --------------VAGEVGVDIYNLIKYTRSNQNTNINQRPMVKV--------------
RPOB_BORA1       --------------VAGEVGVDIYNLIKYTRSNQNTNINQRPIVKR--------------
RPOB_RHOFT       --------------QAGEVGVDIYNLIKYQRSNQNTNIHQRPIVKK--------------
RPOB_POLSJ       --------------LAGEVGVDIYNLIKYQRSNQNTNIHQRPIVKI--------------
RPOB_VEREI       --------------VAGEVGVDIYNLIKYQRSNQNTNIHQRPIVKK--------------
RPOB_METPP       --------------VAGEVGVDIYNLIKYQRSNQNTNIHQRPIVQR--------------
RPOB_NEIG1       --------------TAGEVGVDIYNLVKFTRSNQSTNINQRPAVKA--------------
RPOB_CHRVO       --------------TAGEVGVDIYNLTKFTRSNQNTNINQRPVVKV--------------
RPOB_ACIBT       --------------VAGEAGVDIYNLIKYTRSNQNTCINQNVIVNL--------------
RPOB_PSYCK       --------------IAGEAGIDIYNLVKYTRSNQNTCINQRIIVNQ--------------
RPOB_HAHCH       --------------EAGDAGVDIYNLTKYQRSNQNTCINQRSLVME--------------
RPOB_MARHV       --------------EAGDAGVDIYNLTKYTRSNQNTCINQRSIVRQ--------------
RPOB_SACD2       --------------EAGEAGVDIYNLTKYTRSNQNTCINQRSIVRT--------------
RPOB_PSEU5       --------------ETGEAGVDIYNLTKYTRSNQNTCINQRPLVRK--------------
RPOB_CHRSD       --------------IGGEAGVDIYNLTKYVRSNQNTCMNQRPIVRP--------------
RPOB_ALCBS       --------------SEGEAGVDIYNLTKYTRSNQNTCINQRPLVKV--------------
RPOB_SODGM       --------------YPGEAGIDIYNLTKYIRSNQNTCISQTPCVSL--------------
RPOB_ECOLI       --------------YPGEAGIDIYNLTKYTRSNQNTCINQMPCVSL--------------
RPOB_BAUCH       --------------YSGEAGIDIYHMTKYIRSNQNTCISQKPCVTL--------------
RPOB_BLOFL       --------------SVEEAGIDIYNLKKYVRSNQNTCINQRPCVEL--------------
RPOB_BLOPB       --------------HTEESGIDIYQLTKYIRSNQNTCINQRPCVSL--------------
RPOB_BUCAI       --------------YSREAGIDIYNLTKYTRSNQNTCINQQPCVNL--------------
RPOB_BUCAP       --------------YTGEAGIDIYNLTKYTRSNQNTCINQKPCVKL--------------
RPOB_BUCBP       --------------NSEEAGIDIYNLKKYTRSNQNTCINQIPCISL--------------
RPOB_WIGBR       --------------IKEKIGIDIYHLTKYVRSNQNTCINQTPCVCL--------------
RPOB_BUCCC       --------------RTYESGIDIYNLTKYSRSNQNTCINQIPCINL--------------
RPOB_ACTP2       --------------IPGEAGIDIYNLIKYTRSNQNTCINQIPCVNL--------------
RPOB_MANSM       --------------IPGEAGIDIYNLIKYTRSNQNTCINQIPCVNL--------------
RPOB_HAEI8       --------------IAGEAGIDIYNLIKYTRSNQNTCINQIPCVNL--------------
RPOB_ALIF1       ----------------GEAGIDIYNLTKYTRSNQNTCINQRPTVLP--------------
RPOB_PHOPR       --------------VPGEAGIDIYNLTKYTRSNQNTCINQRPTVMP--------------
RPOB_VIBCH       --------------IPGEAGIDIYNLTKYTRSNQNTCINQRPCVMP--------------
RPOB_AERS4       --------------LPGEAGIDIYSLTKYTRSNQNTCINQRPCVML--------------
RPOB_COLP3       --------------HAGEAGIDIYNLTKYTRSNQNTCINQRPVCRM--------------
RPOB_PSEA6       --------------VAGEAGIDIYNLTKYTRSNQNTCINQRPTCNV--------------
RPOB_PSEHT       --------------VPGEAGIDIYNLTKYTRSNQNTCINQKPTCMV--------------
RPOB_SHEAM       --------------RPGEAGIDIYNLTKYTRSNQNTCINQRPCCQV--------------
RPOB_IDILO       --------------VPGEAGIDIYNLTKYTRSNQNTCINQKPTVNP--------------
RPOB_PSYIN       --------------LPGEAGIDIYNLTKYTRSNQNTCINQKPTCEP--------------
RPOB_DICNV       --------------QAGGLGVDIYNLTKYTRSNQNTCINQKPLVSP--------------
RPOB_HYDCU       --------------AEGETGVDIYNLIKYQRSNQNTCINQKPIVKA--------------
RPOB_VESOH       --------------KANELGVDIYNLTKYSRSNQNTCINQKPLVRT--------------
RPOB_FRATO       ---------------QTSNLVDIYSLTKFKRSNKNTCINQRPIVNV--------------
RPOB_RHIL3       --------------EAGKSGVDIYRLQKFQRSNQNTCVNQRPLVTV--------------
RPOB_RHIME       --------------DPSKSGVDIYRLQKFQRSNQNTCVNQRPLVTV--------------
RPOB_AGRFC       --------------DAGKSGVDIYRLQKFQRSNQNTCVNQRPLVSV--------------
RPOB_RHILO       --------------DPGKSGVDIYRLMKFQRSNQNTCINQRPLVRM--------------
RPOB_CHESB       --------------DASQSGVDIYRLQKFQRSNQNTCINQRPLVRV--------------
RPOB_BRUSU       --------------DPSKSGVDIYRLQKFQRSNQSTCINQRPLVRV--------------
RPOB_BARBK       --------------DPSKSGVDIYRLQKFQRSNQSTCINQRPLVHV--------------
RPOB_RHOPB       --------------DPTKSGVDIYRLMKYQRSNQSTCINQRPLVKV--------------
RPOB_GLUOX       --------------AGATQGVDIYRLRKYMRSNQSTCINQRPLVKV--------------
RPOB_GRABC       --------------DGATQGVDIYRLRKFMRSNQSTCINQRPLVKV--------------
RPOB_MAGSA       --------------QASASGVDIYNLLKFQRSNQNTCITQRPLVKV--------------
RPOB_RHORT       --------------KIAESGVDIYRLQKFQRSNQSTCINQRPLVKV--------------
RPOB_CAUVC       --------------DPARSGVDIYRMSKFQRSNQSTCINQRPLVKV--------------
RPOB_MARMM       --------------DAAKSGVDIYRLSKFQRSNQSTCINQRPIVRV--------------
RPOB_HYPNA       --------------EGSKSGVDIYRLAKFRRSNQNSCINQRPIAKV--------------
RPOB_RHOS1       --------------EPGEPGVDIYRLRKFKRSNQSSCINQRPLVKV--------------
RPOB_PARDP       --------------GAGDAGVDIYRLRKFKRSNQSSTINQRPLVKV--------------
RPOB_ROSDO       --------------ELGDAGVDIYRMRKFQRSNQNTCINQRPLVKV--------------
RPOB_JANSC       --------------ELGDAGVDIYRLRKFQRSNQNTCINQRPLVKV--------------
RPOB_NOVAD       --------------EPGQSGVDIYRLQKFERSNQSTCINQRPLVKV--------------
RPOB_ERYLH       --------------EPGQSGVDIYTLQKFQRSNQNTCINQRPLVKV--------------
RPOB_SPHAL       --------------EPGKSGVDIYRLQKFQRSNQNTCINQRPLVKV--------------
RPOB_ZYMMO       --------------EAGKPGVDIYRLMKFQRSNQSTCINQRPLVSV--------------
RPOB_PELUB       --------------DFTKSGVDIYNLQKFKRSNQNTCINQKPLVRV--------------
RPOB_RICBR       --------------TESAPSVDIYNLLKFQKSNHNTCINQKPLVKV--------------
RPOB_ORITB       --------------DAGAPGVDIYNLKKFQRSNYNTCINQKVLVNV--------------
RPOB_ANAMM       --------------KDECLGVDIYRLRKFQRSNHNTCINQRPVVKL--------------
RPOB_ANAPZ       --------------KDEYLGVDIYKLRKFQRSNHNTCINQRPIVKI--------------
RPOB_EHRRW       --------------KNEYLGVDIYNLRKFQRSNHNTCINQKPLVKP--------------
RPOB_NEOSM       --------------D---FWIDSYTLCKFRKSNHNTCIHQRCVVHQ--------------
RPOB_MAGMM       --------------GSTEPGVDIYNLTKFSRSNQNTCINQVPLVKN--------------
RPOB_ANADE       --------------TDVANEVDIYNLIKYQRSNQNTCINQKPIVKP--------------
RPOB_MYXXD       --------------SDVTSEVDIYNLLKYQRSNQNTCLNQKPIISK--------------
RPOB_SYNFM       ---------------EMGSGVDIYKLIKFQRSNQNTCINQKPLVQH--------------
RPOB_SYNAS       --------------TDRDTGVDIYTLIKYQRSNQDTCFNQKAIVNK--------------
RPOB_GEOSL       --------------DETGTGVDIYNLIKFARSNQNTCINQRPVVKV--------------
RPOB_PELPD       --------------DETGTGVDIYNLIKFARSNQNTCINNKPVVKV--------------
RPOB_PELCD       --------------DEDGTGVDIYNLIKFARSNQNTCLNQKPIVKV--------------
RPOB_BDEBA       --------------E-LGANVDIYNLTKYQRTNQNTCFNQKPIVTV--------------
RPOB_DESPS       --------------DGYDTGVAVYRLTKYKKSNQNTCFTQTPTILP--------------
RPOB_DESVV       --------------YPDRGGVRAYDLQKYHKSNQNSCFGQRPTCHP--------------
RPOB_DESAG       --------------YPRTGGVRSYDLQKYHKSNQSSCFGQKPLVSR--------------
RPOB_LAWIP       --------------YPEFGGVRAYDLLKYHKSNQNFCFGQRPSCIP--------------
RPOB_KORVE       -------------QLSREVGSDIYQLTKFKRSNQNTCINQKPIVKQ--------------
RPOB_SOLUE       -------------QLSREVGADIYQLTKFKRSNQNTCINQKPIVRV--------------
RPOB_CAMJJ       -------------------FIDHYTMEKNLRTNQNTNYIQHPIVKK--------------
RPOB_CAMFF       -------------------YIDQYTMEKNLRTNQNTTFSQHPIVKK--------------
RPOB_SULDN       -------------------YIDYYPLQKNLRTNQNTAFGQKPIVNI--------------
RPOB_BACV8       -------------FVSFEPALKEYRIPKFRKTNQSMTIDLRPTCDK--------------
RPOB_PARD8       -------------FVSFEDAVKTYNIPKWRKTNQSTTVDLKPTCHR--------------
RPOB_PORGI       -------------FVSFDDAIVTYYLPKYRKTNQSTTIDLHPICSK--------------
RPOB_FLAPJ       -------------AVSFESDEKTYKLIKFRKTNQGTSINLKPIVRK--------------
RPOB_GRAFK       -------------MVSFDDDSKSYNLIKFRKTNQGSCINLKPIISV--------------
RPOB_CYTH3       -------------LVSFDSDIITYSLIKFRRTNQDTCINLKPVIQH--------------
RPOB_SALRD       -------------DLTFGEPVQEYELTKFRRTNQGTCMNQKPIVQA--------------
RPOB_PELLD       -------------LLDPDEGLKTYRMIKFKRSNQDTCISQRPIVKN--------------
RPOB_CHLPD       -------------LLDPDEGLKTYKLIKFKRSNQDTCISQKPLIHI--------------
RPOB_CHLCH       -------------MLDPDEGLKTYKLIKFKRSNQDTCISQKPLVRI--------------
RPOB_CHLTE       -------------LLDPDEGVKVYKLIKFKRSNQDTCISQRPLVHN--------------
RPOB_CHLMU       ---------------------DTYPLKKFLRSNSGTCINQTPLCSV--------------
RPOB_CHLPN       ---------------------RTYHLKKFLRSNSGTCINQQPLCAV--------------
RPOB_PARUW       ---------------------RTYLLKKFIRSNAGTCINQRPLCHV--------------
RPOB_RHOBA       -----------------------YPLKKYQGLNERTCQNQKPLITV--------------
RPOB_TREDE       -------------KGKNKEDKDEYTLLKYQRTNQETCYHQRPIVNV--------------
RPOB_TREPA       -------------AASGEEQEVVYPLLKYQRTNQDTCYHQRPIVHV--------------
RPOB_BORAP       -------------ESENVKDLDEYHIVKYERTNQDTCFNQSVLVKE--------------
RPOB_LEPBL       --------------RKGGKESDTYSLTKFKKTNQGTCFNQKPIVGVVHSEINGKVSKVSK
RPOB_FUSNN       ---------------DKDKKEHIYRLLNYERSNQSMCLHQTPLVDL--------------
RPOB_CYAM1       ----------------HARGPVDYALLKYQKSNQDTCIDYRPLVWV--------------
RPOB_AQUAE       -------------DDPLDIGIDIYELRKFQRTNQKTCVNQRPIVRK--------------
RPOB_DEIRA       --------------NMNAGNVRTFELIRFTRSNQGTNLDQHPIVSV--------------
RPOB_DEIGD       --------------GLVKGNVRTFELVRFTRSNQGTNLDQHPIVSV--------------
RPOB_THET8       ------------------GRLVEYPLRRFYRSNQGTALDQRPRVVV--------------
RPOB_THEMA       --------------DKGNPVVDEYRLLKFVRSNQDTMINQKPIVNE--------------
RPOB_BACCR       ------------DGQTVKGDLDRYKMQKFIRSNQGTCYNQRPIVSV--------------
RPOB_BACSU       ------------DGQKVKGNLDKYSLLKFVRSNQGTCYNQRPIVSV--------------
RPOB_BACHD       ------------DGKEIKGDLDKYRLQKFIRSNQGTSYNQRPIVKE--------------
RPOB_GEOTN       ------------DGKEVKGDLDKYRLLKFVRSNQGTCYNQRPIVKK--------------
RPOB_OCEIH       ------------DGKEVEGDLDRYGLQKYKRSNQGTCYNQRPIVSQ--------------
RPOB_LISIN       ------------DGKEVTGGIDKYTLRKFVRSNQGTCYNQRPNVAE--------------
RPOB_STAS1       ------------DGQEYEGELDRYPLAKFKRSNTGTCYNQRPIVAS--------------
RPOB_STRS2       ------------------GSLDVYHISKFRRSNSGTAYNQRTLVKL--------------
RPOB_LACLA       ------------------GELDIYNITKYRRSNSGTSYNQRPLARL--------------
RPOB_LACGA       ------------------DTLDKYVLEKFRRSNATKNYNQTPAVKQ--------------
RPOB_LACAC       ------------------GTLDKYTLEKYRRSNNSKSYNQTPNVKL--------------
RPOB_LACDB       ------------------QTLDTYTLEKYRRSNATKNYNQTPNVKR--------------
RPOB_LACPL       ------------------GSLDTYKLMKFRRSNGGKNYNQRPIVKV--------------
RPOB_LACBA       ------------------GALDTYKLMKFRRSNGGKNYNQRPIVKV--------------
RPOB_PEDPA       ------------------GALDTYKLMKFRRSNGGKNYNQRPIVRV--------------
RPOB_LACS1       ------------------GSLDKYKLMKFHRSNGGKNYNQTPIVRV--------------
RPOB_LACSS       ------------------SSLDTYELMKFRRSNAGKNYNQRPIVAK--------------
RPOB_LACP3       ------------------GALDAYNLMKFKRSNAGKNYNQRPIVTI--------------
RPOB_ENTFA       ------------------GALDKYMVTKFRRSNSGTSYNQRPIVHL--------------
RPOB_LEUMM       ------------------GQLDTYELMKFRRSNGGKNYNQKPIVHV--------------
RPOB_OENOB       ------------------GTLHEYPLMKFQRSNGGKNYNQTPIVKV--------------
RPOB_CARHZ       -----------------QGQIDRYKLIKFQRSNQGTCINQKPIVRK--------------
RPOB_MOOTA       -----------------NGHLETYRLQKFVRSNQGTCINQKPIVRK--------------
RPOB_SYMTH       -----------------DMQVKKYKLTKFTRSNQGTCMNQKPIVRA--------------
RPOB_DESHY       -----------------DGTLEKHKLLKYLRSNQGTCINQRPIVMK--------------
RPOB_CLOAB       ----------------SDGGVDTYRLLKFKRSNQGTCINQRPIVEK--------------
RPOB_CLONN       ----------------SDGGLDKHKLLKYKRSNQGTCINQRPIVSK--------------
RPOB_CLOPS       ----------------LDGGVDTYRLLKFKRSNQGTCINQRPIVAK--------------
RPOB_CLOTE       ---------------DSNGDVDKYKLLKFKRSNQGTCINQKPLVSK--------------
RPOB_HUNT2       -----------------DGKRDTYKLLKYMRSNQGTCINQRPIVKK--------------
RPOB_CLOD6       -----------------DGNRDRYNLLKFKRSNSGTCINQTPIINK--------------
RPOB_CALS4       -----------------DGKRDEYHLLKFKRSNQGTCINQRPIVNE--------------
RPOB_SYNWW       ------------------GTIDNYELLKFMRSNQGTCYNQRPIVKV--------------
RPOB_ONYPE       ------------YENNYKEHQAEYTLINFAKSNQDTLVLQKPIVVL--------------
RPOB_COREF       ------------------GKRDTYVLRKFQRTNQGTSYNQKPLVNQ--------------
RPOB_CORDI       ------------------GTRETYILRKFERTNQGTCYNQTPLVNI--------------
RPOB_CORJK       ------------------GVRDTFMLRKFERTNQGTCYNQTPLVDE--------------
RPOB2_NOCFA      ------------------GTRKSYRMRKFNRSNQGTCSNQRPIVDE--------------
RPOB_RHOJR       ------------------GSRKTYRMRKFARSNQGTCANQRPIVDE--------------
RPOB_MYCS2       ------------------GTRQSYRLRKFARSNHGTCANQRPIVDA--------------
RPOB1_NOCFA      ------------------GTRKSYRMRKFNRSNQGTCSNQRPIVDE--------------
RPOB_SACEN       ------------------GTRRTYRLQKFSRSNHGTCTNQKPIVNE--------------
RPOB_FRAAA       ------------------GTRRTYRLAKFRRSNQGTCINQKPIVFE--------------
RPOB_STRCO       ------------------GTYITYRLAKFSRSNQGTSVNQKVIVAE--------------
RPOB_THEFY       ------------------GTRKTYRVHKFRRTNQGTCFNQRPIVEE--------------
RPOB_ACIC1       ------------------GTRQTYRLAKFRRSNQGTCINQKPIVDE--------------
RPOB_NOCSJ       ------------------GTYSTYRLAKFKRSNQGTCINQRPLVSE--------------
RPOB_ARTS2       ------------------GTETNYRINKFARSNQGNCYNHRVLVSE--------------
RPOB_LEIXX       ------------------GTVKTYYLRKFDRSNQGTSYNHRVVVDE--------------
RPOB_CUTAK       ------------------GTYQTYKLEKFRRSNAGTCINQRPLVKV--------------
RPOB_BIFAA       ------------------GTTSSYKLAKFQRSNQTTCYNQVPLIHD--------------
RPOB_TROWT       ------------------GKHRDYHVGKFVRSNQGNCYNQRVVVRS--------------
RPOB_RUBXD       ------------------GGLDEYALRKFARSNQGTCVNQRPLVKE--------------
RPOB_DEHMC       ------------------GGHDEYLLKKFVRTNQGTCINQHAIINK--------------
RPOB_MYCMS       ----------------------TYILSDYERSNNGTSLTQSPIVKV--------------
RPOB_MESFL       ----------------------TYTLANFERSNNGSSIVQKPIVKV--------------
RPOB_MYCMO       ---------------------KTYYLKNFEHSNQGTLLSQKPIVKL--------------
RPOB_MYCPU       --------------------IKTYQLKTFEKTNQGTVISQSPIVKM--------------
RPOB_MYCS5       ----------------------TYNLKNFEKSNQGTIIQQKPIVKV--------------
RPOB_MYCH2       ----------------------IHYLRYFEKSNQETLILQKPTVKV--------------
RPOB_CITSI       ---------------------YSIPLIMYQRSNKNTCMHQKPQVGR--------------
RPOB_POPTR       ---------------------VSIPLVMYQRSNKNTCMHQKTQVQR--------------
RPOB_AETGR       ---------------------LGIPLIMYQRSNKNTCMHQKSQVRR--------------
RPOB_OENEH       ---------------------LSIPLVMYQRSNKNTWMHQKPQVPR--------------
RPOB_NYMAL       ---------------------ISIPLVMYQRSNKNTWMHQKPQVHR--------------
RPOB_PIPCE       ---------------------ITIPLVMYQRSNKNTCMHQKTQVSR--------------
RPOB_PHAAO       ---------------------LSIPLVMYQRSNKNTCMNQKTQVQR--------------
RPOB_DIOEL       ---------------------MSIPLVMYQRSNKNTCMHQKPQVPR--------------
RPOB_PHAVU       ---------------------LSIPLTIYQRSNKNTCMHQKPQVHR--------------
RPOB_LOTJA       ---------------------LSVPLVIYRRSNKNTCMHQKSQVQR--------------
RPOB_JASNU       ---------------------LSIPLVMYQSSNKNTCMHQKPQVQR--------------
RPOB_LACSA       ---------------------LRIPLVMYQRSNKNTCMHQKPQVQR--------------
RPOB_SACHY       ---------------------ISIPLVAHRRSNKNTCMHQKPRVPR--------------
RPOB_PELHO       ---------------------LSSPLVLFQRSNKNTWIHQTPQVSR--------------
RPOB_ANTAG       ---------------------VETKLVIYQRSNNSTCIHEKPRIQL--------------
RPOB_MARPO       ---------------------IDKNLIIYQRSNNSTCMHQKPKVEK--------------
RPOB_PHYPA       ---------------------VNTHLIIYQRSNNSTCIHQKPQVIS--------------
RPOB_PSINU       ---------------------IDTELITYKRSNNKTCIKERPIIST--------------
RPOB_ANGEV       ---------------------VDIKSIIYERSNNNTCIHQRPVVSQ--------------
RPOB_PINTH       ---------------------VRTESVIYQRSNTNTCTHQKPQIHQ--------------
RPOB_CYCTA       ---------------------VGTELVTYQRSNNNTCMHQKPRVRR--------------
RPOB_ADICA       ---------------KLAQPTTIEELKIFERSNNNTCMHQKPAVSL--------------
RPOB_HUPLU       --------------------TINTKLITYQRSNNNTCMHQKPRVNL--------------
RPOB_CHAGL       ---------------------YKLKLSNYQRSNNNTCIHHRAIVQL--------------
RPOB_CHAVU       --------------------FFSFQLINYERSNQNTCLHQKPIVKK--------------
RPOB_STAPU       --------------------QKF-NLITYERSNNGTCIHQRPTVKI--------------
RPOB_ZYGCR       --------------------LLYINLLNYERSNNATCLHQRPIVEC--------------
RPOB_NEPOL       --------SKLALSKKRKIHESNVFLQVYQRSNQGTCIHQRPIIPL--------------
RPOB_OSTTA       ---DYQNLTAEDVFASNQFKHNTIWLTSYQRSNQDTCLNHKPLVEA--------------
RPOB_MESVI       -------------------HIDRYYLQKYNRSNQDTCINQKPVVSQ--------------
RPOB_CHLAT       -------------GLNFDYQIDRYHLQKYNRSNQDTCINQRPVVHQ--------------
RPOB_OLTVI       LASSESATKSMDFSTKTQLKPITYELQKLFRSNQDTSIMHRPVVRE--------------
RPOB_BIGNA       ---SKESLKITNYMSYVREQKIQYYIKQYNSSNQGTCSVNRLTLNE--------------
RPOB_PHATC       -------------------KRLTYKLQKYLRSNQQTCINHRPIVWK--------------
RPOB_THAPS       -------------------RHYKYDLQKYQRSNQETCINHRPIVWE--------------
RPOB_TRIV2       --------------------EIRYTVSKYQRSNQDTCLNQKPLVRI--------------
RPOB_TRIEI       --------------------QADYPLCKYQRSNQDTCLNQRPLVFE--------------
RPOB_SYNY3       --------------------EIVYPIQKYQRSNQDTCLNQRPLVYA--------------
RPOB_SYNE7       --------------------KYGYALQKYQRSNQDTCLNQRPIVFE--------------
RPOB_THEEB       --------------------EITYTLQKYQRSNQDTCLNQRPIVFV--------------
RPOB_SYNJA       --------------------PIVYRLQKYQRSNQDTCLNQRPLVYA--------------
RPOB_GLOVI       --------------------EFAYPLQKYQRSNQDTCLSQRPIVNV--------------
RPOB_PROM5       --------------------EHVHYLQKYQRSNQDTCLNQRPIVKN--------------
RPOB_GUITH       --------------------EIAYYLQKYQRSNQDTCINQRPTVWL--------------
RPOB_RHDSA       --------------------EVVYYLQKYQRSNQDTCINQRPSVWL--------------
RPOB_PYRYE       --------------------TVHYRLKKYYRSNQDTCINQRPIVWV--------------
RPOB_GRATL       --------------------TIHYRLKKYYRSNQDTCINQRPIVWP--------------
RPOB_CYAPA       --------------------EINYTLIKYQRSNQDTCITQRPIVFE--------------
RPOB_CYACA       --------------------QITYNLQKYQKSNQETCINHRPIVWP--------------
RPOB_EMIHU       --------------------QLIYNLTKYKRSNQDTCINQKPCVSL--------------
RPOB_EUGLO       ------------NKKIKKHKHTIYLLNIDEKNNSNIYQTRTSIVKK--------------
                                                 *                           

RPOB_MYCGE       -----------------------------------------------------GQRVNKD
RPOB_MYCPN       -----------------------------------------------------GQRVTKD
RPOB_MYCGA       -----------------------------------------------------GDKIETN
RPOB_MYCPE       -----------------------------------------------------GEKVTKG
RPOB_UREPA       -----------------------------------------------------GQRVHKS
RPOB_ALKEH       -----------------------------------------------------GDVVARG
RPOB_HALHL       -----------------------------------------------------GDRVARG
RPOB_METCA       -----------------------------------------------------GDVVARN
RPOB_XANC8       -----------------------------------------------------GDVIARG
RPOB_XYLFT       -----------------------------------------------------GDIVASG
RPOB_LEGPA       -----------------------------------------------------GDRIQRG
RPOB_COXBU       -----------------------------------------------------GDKVQKG
RPOB_NITOC       -----------------------------------------------------GDTVAIG
RPOB_AROAE       -----------------------------------------------------GDHIGKG
RPOB_AZOSB       -----------------------------------------------------GDLIAKG
RPOB_METFK       -----------------------------------------------------GDVLARG
RPOB_NITEC       -----------------------------------------------------GDILSRE
RPOB_NITMU       -----------------------------------------------------GDVIARG
RPOB_THIDA       -----------------------------------------------------GDVIARG
RPOB_DECAR       -----------------------------------------------------GDHIAKG
RPOB_PARXL       -----------------------------------------------------GDIVSRG
RPOB_HERAR       -----------------------------------------------------GDRVAKH
RPOB_RALSO       -----------------------------------------------------GDIVARG
RPOB_BORA1       -----------------------------------------------------GDRVAKG
RPOB_RHOFT       -----------------------------------------------------GDMLAKG
RPOB_POLSJ       -----------------------------------------------------GDKLAKG
RPOB_VEREI       -----------------------------------------------------GDRLVKG
RPOB_METPP       -----------------------------------------------------GDQVGAG
RPOB_NEIG1       -----------------------------------------------------GDVLQRG
RPOB_CHRVO       -----------------------------------------------------GDHIARG
RPOB_ACIBT       -----------------------------------------------------GDKVARG
RPOB_PSYCK       -----------------------------------------------------GDAIAVG
RPOB_HAHCH       -----------------------------------------------------GDEVARG
RPOB_MARHV       -----------------------------------------------------GDVIARG
RPOB_SACD2       -----------------------------------------------------GEKVSRG
RPOB_PSEU5       -----------------------------------------------------GDVVARG
RPOB_CHRSD       -----------------------------------------------------GDVVARG
RPOB_ALCBS       -----------------------------------------------------GDRVAAR
RPOB_SODGM       -----------------------------------------------------GEPVERG
RPOB_ECOLI       -----------------------------------------------------GEPVERG
RPOB_BAUCH       -----------------------------------------------------GELVERG
RPOB_BLOFL       -----------------------------------------------------GELIKKG
RPOB_BLOPB       -----------------------------------------------------GELVEHG
RPOB_BUCAI       -----------------------------------------------------GEKIKKG
RPOB_BUCAP       -----------------------------------------------------REKINKN
RPOB_BUCBP       -----------------------------------------------------GENVEKG
RPOB_WIGBR       -----------------------------------------------------NDVVERG
RPOB_BUCCC       -----------------------------------------------------NDSIKKG
RPOB_ACTP2       -----------------------------------------------------GEPVARG
RPOB_MANSM       -----------------------------------------------------GEPIGRG
RPOB_HAEI8       -----------------------------------------------------GDPINRG
RPOB_ALIF1       -----------------------------------------------------GEPVTRG
RPOB_PHOPR       -----------------------------------------------------GEPVARG
RPOB_VIBCH       -----------------------------------------------------GEPVARG
RPOB_AERS4       -----------------------------------------------------GEPVMAG
RPOB_COLP3       -----------------------------------------------------GEPVVRG
RPOB_PSEA6       -----------------------------------------------------GEPIVAG
RPOB_PSEHT       -----------------------------------------------------GEPVTRG
RPOB_SHEAM       -----------------------------------------------------GDPIVRG
RPOB_IDILO       -----------------------------------------------------GEPVTRG
RPOB_PSYIN       -----------------------------------------------------GEPIVRG
RPOB_DICNV       -----------------------------------------------------GDIVARG
RPOB_HYDCU       -----------------------------------------------------GDVVSRG
RPOB_VESOH       -----------------------------------------------------GDKITFG
RPOB_FRATO       -----------------------------------------------------GDKVEAG
RPOB_RHIL3       -----------------------------------------------------GDEVNRG
RPOB_RHIME       -----------------------------------------------------GDVINKG
RPOB_AGRFC       -----------------------------------------------------GDAISKG
RPOB_RHILO       -----------------------------------------------------GDRVNKG
RPOB_CHESB       -----------------------------------------------------GDLINKG
RPOB_BRUSU       -----------------------------------------------------GDRIHKG
RPOB_BARBK       -----------------------------------------------------GDRIEKG
RPOB_RHOPB       -----------------------------------------------------GDMVAKG
RPOB_GLUOX       -----------------------------------------------------GDTVHAG
RPOB_GRABC       -----------------------------------------------------GDHVISG
RPOB_MAGSA       -----------------------------------------------------GDLIQKG
RPOB_RHORT       -----------------------------------------------------GDLVGRG
RPOB_CAUVC       -----------------------------------------------------GDRIVAG
RPOB_MARMM       -----------------------------------------------------GDQVHAG
RPOB_HYPNA       -----------------------------------------------------GDVVSKN
RPOB_RHOS1       -----------------------------------------------------GDVVHRG
RPOB_PARDP       -----------------------------------------------------GDKVVKG
RPOB_ROSDO       -----------------------------------------------------GDTVLKG
RPOB_JANSC       -----------------------------------------------------GDKIGKG
RPOB_NOVAD       -----------------------------------------------------GDLIEKG
RPOB_ERYLH       -----------------------------------------------------GETVEAG
RPOB_SPHAL       -----------------------------------------------------GDVVRAG
RPOB_ZYMMO       -----------------------------------------------------GDYVNAG
RPOB_PELUB       -----------------------------------------------------GDKVKSG
RPOB_RICBR       -----------------------------------------------------GHYVKKN
RPOB_ORITB       -----------------------------------------------------GDIVKKG
RPOB_ANAMM       -----------------------------------------------------GDYVKAN
RPOB_ANAPZ       -----------------------------------------------------GDYVRTN
RPOB_EHRRW       -----------------------------------------------------GDYVREN
RPOB_NEOSM       -----------------------------------------------------GQRVKKG
RPOB_MAGMM       -----------------------------------------------------GERVTAG
RPOB_ANADE       -----------------------------------------------------GERVRKG
RPOB_MYXXD       -----------------------------------------------------GDRVMKG
RPOB_SYNFM       -----------------------------------------------------GDLVTKG
RPOB_SYNAS       -----------------------------------------------------GQRVRKG
RPOB_GEOSL       -----------------------------------------------------GDHVKRG
RPOB_PELPD       -----------------------------------------------------GDVVKRH
RPOB_PELCD       -----------------------------------------------------GDRVASG
RPOB_BDEBA       -----------------------------------------------------GDKISKG
RPOB_DESPS       -----------------------------------------------------GLKVEKG
RPOB_DESVV       -----------------------------------------------------GQIVKKG
RPOB_DESAG       -----------------------------------------------------GQVIRKG
RPOB_LAWIP       -----------------------------------------------------GQIVKKG
RPOB_KORVE       -----------------------------------------------------GDHVKKG
RPOB_SOLUE       -----------------------------------------------------GQRVPKG
RPOB_CAMJJ       -----------------------------------------------------GDIVKAG
RPOB_CAMFF       -----------------------------------------------------GDMVKSG
RPOB_SULDN       -----------------------------------------------------GQRVEIG
RPOB_BACV8       -----------------------------------------------------GQRVKKG
RPOB_PARD8       -----------------------------------------------------GQRVKAG
RPOB_PORGI       -----------------------------------------------------GDRVEAG
RPOB_FLAPJ       -----------------------------------------------------GDKVIKG
RPOB_GRAFK       -----------------------------------------------------GDRVTKG
RPOB_CYTH3       -----------------------------------------------------GERVKKG
RPOB_SALRD       -----------------------------------------------------GDRVEEG
RPOB_PELLD       -----------------------------------------------------GQKVDKG
RPOB_CHLPD       -----------------------------------------------------GQRVSKG
RPOB_CHLCH       -----------------------------------------------------GDKVEKN
RPOB_CHLTE       -----------------------------------------------------GQRVNAG
RPOB_CHLMU       -----------------------------------------------------GDVVTHG
RPOB_CHLPN       -----------------------------------------------------GDVITKG
RPOB_PARUW       -----------------------------------------------------GDKIKAG
RPOB_RHOBA       -----------------------------------------------------GDKVEKG
RPOB_TREDE       -----------------------------------------------------GDTVKAG
RPOB_TREPA       -----------------------------------------------------GDRVQVG
RPOB_BORAP       -----------------------------------------------------GQKVERG
RPOB_LEPBL       EKIEVTGENGELKEYVLQIGSKQYAPIVSSGEEVKRGTTLAGQVVVGEKLDEMGNILVKG
RPOB_FUSNN       -----------------------------------------------------GDKVKAG
RPOB_CYAM1       -----------------------------------------------------GEHVVKG
RPOB_AQUAE       -----------------------------------------------------GEKVEKG
RPOB_DEIRA       -----------------------------------------------------GDEVKVG
RPOB_DEIGD       -----------------------------------------------------GDEVVPG
RPOB_THET8       -----------------------------------------------------GQRVRKG
RPOB_THEMA       -----------------------------------------------------GDFVKKG
RPOB_BACCR       -----------------------------------------------------GNEVVKG
RPOB_BACSU       -----------------------------------------------------GDEVVKG
RPOB_BACHD       -----------------------------------------------------GDVVEKR
RPOB_GEOTN       -----------------------------------------------------GDIVEKG
RPOB_OCEIH       -----------------------------------------------------GDRVTKG
RPOB_LISIN       -----------------------------------------------------GDRVVKG
RPOB_STAS1       -----------------------------------------------------GDVVTKG
RPOB_STRS2       -----------------------------------------------------GDIVEKG
RPOB_LACLA       -----------------------------------------------------GEKVEKG
RPOB_LACGA       -----------------------------------------------------GERVVAD
RPOB_LACAC       -----------------------------------------------------GDHVDES
RPOB_LACDB       -----------------------------------------------------GDKVVDG
RPOB_LACPL       -----------------------------------------------------GDHVDND
RPOB_LACBA       -----------------------------------------------------GDHVDND
RPOB_PEDPA       -----------------------------------------------------NDKVDAD
RPOB_LACS1       -----------------------------------------------------GDRVDAD
RPOB_LACSS       -----------------------------------------------------GDHVDVD
RPOB_LACP3       -----------------------------------------------------GDHVDVD
RPOB_ENTFA       -----------------------------------------------------GEKVEKG
RPOB_LEUMM       -----------------------------------------------------GEHIEAD
RPOB_OENOB       -----------------------------------------------------GEKIEKG
RPOB_CARHZ       -----------------------------------------------------GERVEKD
RPOB_MOOTA       -----------------------------------------------------GERVSAG
RPOB_SYMTH       -----------------------------------------------------GDRVRKG
RPOB_DESHY       -----------------------------------------------------NERVEAG
RPOB_CLOAB       -----------------------------------------------------NEKVEKG
RPOB_CLONN       -----------------------------------------------------GEKVKAG
RPOB_CLOPS       -----------------------------------------------------GDWVLKG
RPOB_CLOTE       -----------------------------------------------------GDKVDTK
RPOB_HUNT2       -----------------------------------------------------GEEVEAG
RPOB_CLOD6       -----------------------------------------------------GDQIIKG
RPOB_CALS4       -----------------------------------------------------GDEVKKG
RPOB_SYNWW       -----------------------------------------------------GERVEAN
RPOB_ONYPE       -----------------------------------------------------GEQINEG
RPOB_COREF       -----------------------------------------------------GDRVEAG
RPOB_CORDI       -----------------------------------------------------GDRVEAG
RPOB_CORJK       -----------------------------------------------------GDRVEAG
RPOB2_NOCFA      -----------------------------------------------------GQRVEAG
RPOB_RHOJR       -----------------------------------------------------GQRVEFG
RPOB_MYCS2       -----------------------------------------------------GQRVEAG
RPOB1_NOCFA      -----------------------------------------------------GQRVEAG
RPOB_SACEN       -----------------------------------------------------GDRVEAG
RPOB_FRAAA       -----------------------------------------------------GDRVEAG
RPOB_STRCO       -----------------------------------------------------GDRIIEG
RPOB_THEFY       -----------------------------------------------------GQRVEEG
RPOB_ACIC1       -----------------------------------------------------GQRVEAG
RPOB_NOCSJ       -----------------------------------------------------GDRLEIG
RPOB_ARTS2       -----------------------------------------------------GQRLEVG
RPOB_LEIXX       -----------------------------------------------------GDRIEAG
RPOB_CUTAK       -----------------------------------------------------GQRVEVG
RPOB_BIFAA       -----------------------------------------------------GERVEAG
RPOB_TROWT       -----------------------------------------------------GDRVEKG
RPOB_RUBXD       -----------------------------------------------------GEEVEAG
RPOB_DEHMC       -----------------------------------------------------GQKIAAG
RPOB_MYCMS       -----------------------------------------------------GDVVKKG
RPOB_MESFL       -----------------------------------------------------GDSIEAG
RPOB_MYCMO       -----------------------------------------------------GDKVEIG
RPOB_MYCPU       -----------------------------------------------------GDKVLKG
RPOB_MYCS5       -----------------------------------------------------GDHVKEG
RPOB_MYCH2       -----------------------------------------------------GDKVKKG
RPOB_CITSI       -----------------------------------------------------GKCIKKG
RPOB_POPTR       -----------------------------------------------------GKCIKRG
RPOB_AETGR       -----------------------------------------------------GKCIKKG
RPOB_OENEH       -----------------------------------------------------GKCIKKG
RPOB_NYMAL       -----------------------------------------------------GKYLKKG
RPOB_PIPCE       -----------------------------------------------------GKCIKKG
RPOB_PHAAO       -----------------------------------------------------GKYIKKG
RPOB_DIOEL       -----------------------------------------------------GKCIKKG
RPOB_PHAVU       -----------------------------------------------------GKFIKKG
RPOB_LOTJA       -----------------------------------------------------GKCIKRG
RPOB_JASNU       -----------------------------------------------------GKCIKKG
RPOB_LACSA       -----------------------------------------------------GKCIKKG
RPOB_SACHY       -----------------------------------------------------GKSIKKG
RPOB_PELHO       -----------------------------------------------------GNCTKKG
RPOB_ANTAG       -----------------------------------------------------REYVKKG
RPOB_MARPO       -----------------------------------------------------QKYIKKG
RPOB_PHYPA       -----------------------------------------------------KKFLKKG
RPOB_PSINU       -----------------------------------------------------GTYLKEG
RPOB_ANGEV       -----------------------------------------------------GERLRKG
RPOB_PINTH       -----------------------------------------------------GECVKKG
RPOB_CYCTA       -----------------------------------------------------GEYVKKG
RPOB_ADICA       -----------------------------------------------------GELLRGG
RPOB_HUPLU       -----------------------------------------------------GEYLKEG
RPOB_CHAGL       -----------------------------------------------------NQWVRKG
RPOB_CHAVU       -----------------------------------------------------DDYVKKG
RPOB_STAPU       -----------------------------------------------------GFSVRKG
RPOB_ZYGCR       -----------------------------------------------------GETVQKG
RPOB_NEPOL       -----------------------------------------------------HTPVIRG
RPOB_OSTTA       -----------------------------------------------------NTWVEAG
RPOB_MESVI       -----------------------------------------------------GEWVQKG
RPOB_CHLAT       -----------------------------------------------------GEFIKKG
RPOB_OLTVI       -----------------------------------------------------GEWVNRG
RPOB_BIGNA       -----------------------------------------------------GQFIIKK
RPOB_PHATC       -----------------------------------------------------GEQVKSG
RPOB_THAPS       -----------------------------------------------------GEKVKSG
RPOB_TRIV2       -----------------------------------------------------GERVVAG
RPOB_TRIEI       -----------------------------------------------------GDQVVAG
RPOB_SYNY3       -----------------------------------------------------GEDVVPG
RPOB_SYNE7       -----------------------------------------------------GDRVQRG
RPOB_THEEB       -----------------------------------------------------GDRVQAG
RPOB_SYNJA       -----------------------------------------------------GDRVVPG
RPOB_GLOVI       -----------------------------------------------------GDQVRNG
RPOB_PROM5       -----------------------------------------------------GDQVISG
RPOB_GUITH       -----------------------------------------------------GEDVIEG
RPOB_RHDSA       -----------------------------------------------------GEKVVAG
RPOB_PYRYE       -----------------------------------------------------GEKIVVG
RPOB_GRATL       -----------------------------------------------------GENIRIG
RPOB_CYAPA       -----------------------------------------------------GERVKKG
RPOB_CYACA       -----------------------------------------------------GERIKKG
RPOB_EMIHU       -----------------------------------------------------YEKVRVG
RPOB_EUGLO       -----------------------------------------------------NDWIKKG
                                                                             

RPOB_MYCGE       EIIVDGPAVNKSELALGQNVLVAFTTWNGYNYEDAIVISERLVKEDILTSLTINEYVAQC
RPOB_MYCPN       EVIADGPAVNKSELSLGQNVLVAFTTWNGYNYEDAIVISERLVKDDVLTSLTINEYVAQC
RPOB_MYCGA       QALADGPSMKNGELALGQNVLVGFTTWSGYNYEDAVIISDRLFKDDVYSSIHIDEYTIEC
RPOB_MYCPE       TTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDC
RPOB_UREPA       ETIGDGPAMQNGELALGRNILVGYTTWRGYNFEDAIIISERLVDQDVFTSIHIDEHTIQC
RPOB_ALKEH       DALADGPSTDMGELALGQNMLVAFMPWNGYNFEDSILISERVVKEDRYTTIHIEELTCVA
RPOB_HALHL       DALADGPSTDMGELALGQNMLVAFMPWNGYNFEDSILISEKLVKEDRYTSVHIEELTCVA
RPOB_METCA       DVLADGPSTDMGELALGQNLLVAFMPWNGYNFEDSILISERVVQDDRFTTIHIEEKTCVA
RPOB_XANC8       DVLADGPSTDIGELALGQNMLIAFMPWNGYNFEDSILLSERVVEEDRYTTIHIEELTCVA
RPOB_XYLFT       DVLADGPSTDIGELALGQNMLIAFMPWNGYNFEDSILLSERVVEEDRYTTIHIEELTCIA
RPOB_LEGPA       DVLADGPCTDMGELALGQNLLVAFMPWNGYNFEDSILISERIVHDDRFTTIHIEELTCIA
RPOB_COXBU       DVLADGPSTDIGELALGQNLLVAFMPWNGYNFEDSILISERLVEEDRFTTIHIQEFTCVA
RPOB_NITOC       DVLADGPSTDMGELALGQNLLVAFMPWNGYNFEDSILISERVVEEDRFTSIHIEELTCFA
RPOB_AROAE       DVIADGASTDLGELALGQNMLVAFMPWNGYNFEDSILISERVVAEDRFTSIHIEELTVVA
RPOB_AZOSB       DVIADGASTDLGELALGQNMLVAFMPWNGYNFEDSILISERVVADDRFTSIHVEELTVVA
RPOB_METFK       DVIADGASTDMGELALGQNMLVAFMPWNGYNFEDSILISERVVADDRYTSIHIEELSVVA
RPOB_NITEC       DVIADGASTDLGELALGQNMLIAFMPWNGLNFEDSILISERVVSDDRFTSIHIEELTAVS
RPOB_NITMU       DVVADGASTDKGELALGQNMLVAFMPWTGYNFEDSILISERIVANDRFTSIHIEELSVVS
RPOB_THIDA       DVIADGASTDMGELALGQNMLVAFMPWNGYNFEDSILINEKVVAEDRYTSIHIEELSVVA
RPOB_DECAR       DVVADGASTDKGELALGQNMLIAFMPWNGYNFEDSILISERVVAEDRYTSIHIEELTVVA
RPOB_PARXL       DVLADGASTDLGELALGQNMLVAFMPWNGYNFEDSILISEKVVADDRYTSIHIEELNVVA
RPOB_HERAR       DVIADGASTDLGELALGQNMLVAFMPWNGYNFEDSILISEKVVADDRYTSIHIEELSVVA
RPOB_RALSO       DVIADGASTDLGELALGQNMLVAFMPWNGYNFEDSILISERVVAEDRYTSIHIEELSVVA
RPOB_BORA1       DVLADGASTDLGELALGQNMLIAFMPWNGYNFEDSILISERVVADDRYTSVHIEELTVVA
RPOB_RHOFT       DVIADGASTDLGELALGQNMLIGFMTWNGYNFEDSILISERVVADDRYTSIHIEELVVMA
RPOB_POLSJ       DVIADGASTDIGELALGQNMLVAFMPWNGYNFEDSILISERVVAEDRYTSIHIEELVVMA
RPOB_VEREI       DVIADGASTDLGEIAIGQNMLIAFMPWNGYNFEDSILISERVVSEDRYTSIHIEELVVMA
RPOB_METPP       DVIADGASTDIGELALGQNMLVAFMPWNGYNFEDSILISERVVADDRYTSIHIEELVVMA
RPOB_NEIG1       DLVADGASTDLGELALGQNMTIAFMPWNGYNYEDSILISEKVAADDRYTSIHIEELNVVA
RPOB_CHRVO       DVVADGASTDLGELALGQNMTIAFMPWNGYNYEDSILISEKLVAEDRYTSIHIEELSVVA
RPOB_ACIBT       DILADGPSTDMGELALGQNMRVAFMTWNGYNYEDSILLSERVLQEDRLTSIHIQELSCVA
RPOB_PSYCK       DILADGPSTDLGELALGQNIRIAFMPWNGYNFEDSILLSEKVVKEDRFTTIHIQELTCVA
RPOB_HAHCH       DVLADGPSVDLGELALGQNMRIAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELTCVA
RPOB_MARHV       DVLADGPSVDLGELALGQNMRIAFMPWNGYNFEDSILISEKVVQEDRLTTIHIQELTCVA
RPOB_SACD2       DILADGPSVDLGELALGQNMRIAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELTCIA
RPOB_PSEU5       DIMADGPSTDMGELALGQNMRVAFMPWNGYNFEDSILLSERVVQEDRFTTIHIQELTCVS
RPOB_CHRSD       DILADGPSVDMGDLALGQNMRMAFMPWNGYNFEDSILISERVVEEDRFTSIHIQELTCVS
RPOB_ALCBS       DIMADGPSVDMGELALGQNMRVAFMPWNGYNFEDSILISEKVVKDDRFTSIHIQELTCIA
RPOB_SODGM       DVLADGPSTDLGELALGQNMRIAFMPWNGYNFEDSMLVSERVVQEDRFTTIHIQELACVS
RPOB_ECOLI       DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RPOB_BAUCH       NVLADGPSTDLGELALGQNMRIAFMPWNGYNFEDSMLVSERVVQKDCFTTIHIQELACMS
RPOB_BLOFL       DVIADGPSTDLGELALGQNMRIAFMPWNGYNFEDSMLVSERVVQEDRFTSIHIQELSCIS
RPOB_BLOPB       DVIADGPSTDLGELALGQNMRIAFMPWNGYNFEDSMLVSERVVQEDKFTSIHIQELTCVS
RPOB_BUCAI       DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELSCIS
RPOB_BUCAP       DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSEKVVQEDRFTTIHIQELSCIS
RPOB_BUCBP       NVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILISEKVVQEDRFTTIHIQELACIS
RPOB_WIGBR       DVLADGPSTDLGELALGQNMRIAFMPWNGYNFEDSMLVSEKVVHEDRFTTIHIQELACMS
RPOB_BUCCC       DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILISEKVEREDKFTTIHIQELSCIC
RPOB_ACTP2       EILADGPSTDLGELALGQNIRVAFMPWNGYNFEDSMLVSERVVQEDRFTTIHIQELSCVA
RPOB_MANSM       EVLADGPSTDLGELALGQNIRVAFMPWNGYNFEDSMLVSERVVQQDRFTTIHIQELSCVA
RPOB_HAEI8       EVLADGPSTDLGELALGQNIRVAFMPWNGYNFEDSMLVSERVVQQDRFTTIHIQELSCVA
RPOB_ALIF1       DVLADGPSTDLGELALGQNMRIAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELSCVA
RPOB_PHOPR       DVLADGPSTDLGELALGQNIRIAFMPWNGYNFEDSILVSERVVQQDRLTTIHIQELSCVA
RPOB_VIBCH       DVLADGPSTDLGELALGQNMRIAFMPWNGYNFEDSILVSERVVQDDRFTTIHIQELSCVA
RPOB_AERS4       DVVADGPSTDLGELALGQNLRVAFMPWNGYNFEDSILVNERVVQEDRLTTIHIQELACIS
RPOB_COLP3       DVLADGPSTDMGELALGQNMRIAFMPWNGYNFEDSMLLSERVAIEDRFTTIHIQELTCIA
RPOB_PSEA6       DVLADGPSTDLGELALGQNMRIAFMPWNGYNFEDSILISERVAMEDRFTTIHIQELSCVA
RPOB_PSEHT       DVLADGPSTDLGDLALGQNLRVAFMPWNGYNFEDSILLSERVVEEDRLTTIHIQELQCIA
RPOB_SHEAM       DVLADGPSTDLGDLALGQNMRVAFMPWNGYNFEDSILISERVVQDDRFTTIHIQELSCIA
RPOB_IDILO       DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILISERVAQEDRMTTIHIQELNCVA
RPOB_PSYIN       DVLADGPSTDMGDLALGQNMKIAFMPWNGYNFEDSILISERVSQEDRFTTIHIQEFSCVA
RPOB_DICNV       DVLADGPSTDMGELALGQNVLVAFMPWNGYNYEDSILISERVSQEDRFTTIHIEELTCIA
RPOB_HYDCU       DVLADGPSTDLGELAIGQNMRIAFMPWNGYNFEDSILVSERVVQEDRYTTIHIEELTCLA
RPOB_VESOH       DVLADGPSTDMGELALGQNMKIAFMPWNGYNFEDSILISEKVVQEDRYTTIHIEELTAYS
RPOB_FRATO       DILADGFATDFGELSLGHNLMVAFMPWNGYNFEDSILLSERIVKDDKYTSIHIEEFTCVA
RPOB_RHIL3       DILADGPSTDLGDLALGRNALVAFMPWNGYNYEDSILLSERIVADDVFTSIHIEEFEVMA
RPOB_RHIME       DIIADGPSTDLGDLALGRNALVAFMPWNGYNYEDSILLSERIVRDDVFTSIHIEEFEVMA
RPOB_AGRFC       DIIADGPSTDLGDLALGRNALVAFMPWNGYNYEDSILMSERIVSDDVFTSIHIEEFEVMA
RPOB_RHILO       DIIADGPSTELGDLALGRNVLVAFMPWNGYNYEDSILLSERIVADDVFTSIHIEEFEVMA
RPOB_CHESB       DIIADGPSTDLGDLALGRNVLVAFMPWNGYNYEDSILLSERIVRDDIFTSIHIEEFEVMA
RPOB_BRUSU       DIIADGPSTDLGDLALGRNVLVAFMPWNGYNYEDSILLSEKIVSDDVFTSIHIEEFEVAA
RPOB_BARBK       DIIADGPSTDLGDLALGRNVLVAFMPWNGYNYEDSILLSERIVADDVFTSIHIEEFEVAA
RPOB_RHOPB       DIIADGPSTDLGELALGRNVLVAFMPWNGYNFEDSILLSERIVKDDVFTSIHIEEFEVMA
RPOB_GLUOX       DIIADGPSTELGELALGRNVLVAFMPWNGYNFEDSILISERIARDDVFTSIHIEEFEVMA
RPOB_GRABC       DIIADGPSTELGELALGRNVLCAFMPWNGYNFEDSILISERIARDDVFTSIHIEEFEVMA
RPOB_MAGSA       DIIADGPSTQLGELALGRNVLVAFMPWNGYNFEDSILISERIVRDDVFTSIHIEEFEVMA
RPOB_RHORT       EILADGPLTEMGELALGRNVLVAFMPWNGYNFEDSILISERIVSDDVFTSIHIEEFEVMA
RPOB_CAUVC       DIIADGPSTELGELALGRNALVAFMPWNGYNFEDSILISERIVRDDVFTSIHIEEFEVMA
RPOB_MARMM       DIIADGPSTDLGELALGRNVVVAFMPWNGYNFEDSILISERIVRDDVFTSIHLEEFEIAA
RPOB_HYPNA       DIIADGPSTDLGELALGRNVLVAFMPWNGYNFEDSILISERIVRDDVFTSIHIEEFEVAA
RPOB_RHOS1       EVVADGPCTDMGELALGRNVIVAFMPWNGYNYEDSILISERILRDDVYTSIHIEEYEVAA
RPOB_PARDP       QVVADGPSTDQGELAIGRNVVVAFMPWNGYNYEDSILISERIHRDDVFTSIHIDEYEVAA
RPOB_ROSDO       QVIADGPSTDMGELALGKNVVVAFMPWNGYNYEDSILISERIARDDVFTSIHIEEFEVAA
RPOB_JANSC       EVIADGPSTDIGELALGKNVIVAFMPWNGYNYEDSILISERISRDDVFTSIHIEEFEVAA
RPOB_NOVAD       DIIADGPSTEFGELALGRNVLVAFMPWNGYNYEDSILISERIVKEDVFTSIHIEEFEVMA
RPOB_ERYLH       DVIADGPSTDLGELALGKNTLVAFMPWNGYNYEDSILISERIVKDDVFTSIHIEEFEVMA
RPOB_SPHAL       DIIADGPSTELGELALGKNVLVAFMPWNGYNYEDSILISERIVKDDVFTSIHIEEFEVTA
RPOB_ZYMMO       DVLADGPSTELGELALGRNVLVAFMPWNGYNYEDSILISERIVKDDVFTSIHIDEFEVMA
RPOB_PELUB       DIIADGPSTKLGELALGKNVTVAFMPWQGYNFEDSILISERCVTDDVFTSVHIVEYEVMA
RPOB_RICBR       DIIADGPSTDNGEIALGRNVLVAFLPWNGYNFEDSILISERIVKEDVFTSVHIEEFEVIA
RPOB_ORITB       DVIADGVATNKGEIALGRNVLVAFIAWNGYTFEDSILVSERIVKEDIYTSIHIEELELVA
RPOB_ANAMM       DVIADGSAIDRGELALGKNVLVAFMSWQGYNFEDSIVISSDVVKRDVFTSIHIEEFECVV
RPOB_ANAPZ       DVIADGAAIDRGELALGKNVLVAFMSWQGYNFEDSIVISSDVVKRDVFTSIHIEEFECVV
RPOB_EHRRW       DVIADGSAIDQGELALGKNVLVAFMSWQGYNFEDSIVISSEVVKKDVFTSIHIEEFECVV
RPOB_NEOSM       DILADGPAIQKGELALGRNLVVAFLSWRGYNFEDSVVISSNVVRDDLFTSVHLEGFECVV
RPOB_MAGMM       DIIADGPSTQIGELALGRNVLVAFMPWNGYNFEDSILISERLVAEDVFTSIHIDEFEVMA
RPOB_ANADE       DVIADGPATEMGELALGQNVVVAFMPWQGYNFEDSILLSERLIKEDVFTSVHIEEFECVA
RPOB_MYXXD       DVIADGPATETGELALGQNVVVAFMPWQGYNFEDSILISERILKDDVFTSIHIEEFECIA
RPOB_SYNFM       QIIADGPSTDHGELALGRNVMVAFMSWGGYNFEDSILVSERIGKEDVFTSIHIEEFEVVA
RPOB_SYNAS       DIIADGPATDNGELALGHNVMVAFMSWGGYNYEDSILVSERIVKEDIYTSIHIEEFETMA
RPOB_GEOSL       DVIADGPSTDMGELALGQNVVVAFMPWGGYNFEDSILVSEKLVKDDRYTSIHIEEFECVA
RPOB_PELPD       DVIADGPSTDMGELALGQNIVVAFMPWGGYNFEDSILVSEKLVKDDRYTSIHIEEYECVA
RPOB_PELCD       GIIADGPSTEWGELALGQNVLVAFMPWEGYNFEDSILISEKLVKEDRYTSIHIEELECVA
RPOB_BDEBA       DIIADGPSTELGELALGQNILVAFTPWQGYNFEDSILISERLLKDDVYTSIHIEEFECVA
RPOB_DESPS       TLLADGPGCEAGELALGKNLTVAFMPWRGFNYEDSILINERLLKEDAYTSIHIDVFETMA
RPOB_DESVV       DVLADGPGIEDGELALGKNLVVAFMPWCGYNFEDSILISERVVKEDVFTSIHIEEFEVVA
RPOB_DESAG       DVLADGPGIEDGELALGKNLVVAFMPWCGYNFEDSILISERCVKEDVFTSVHIEEFEVVA
RPOB_LAWIP       EVLADGPAIRDGGLALGKNLVVAFMPWCGYNFEDSILISERVVKEDTYTSVHIEEFEIVA
RPOB_KORVE       QVIADGPCTDHGELGLGRNVLVSFMPWRGYNFEDAILVSEKLVKEDYYTSVHIEEFEIEA
RPOB_SOLUE       AVLADGPCTDLGELALGRNVLVAFMPWRGYNFEDAILVSEKLVKEDYYTSIHIEEFEIEA
RPOB_CAMJJ       QIIADGPSMDQGELAIGKNALIAFMPWNGYNYEDAIVVSERIIREDTFTSVHIYEKEIEA
RPOB_CAMFF       QIIADGSSMEKGELAIGKNALIAFMPWNGYNYEDAIVMSERMIRADAFTSVHIYEKEIEA
RPOB_SULDN       QVIADGPNMDQGELALGVNAMVAFMPWNGYNFEDAIVISERLIRKDAFTSVHIYEKEVEA
RPOB_BACV8       DILTEGYSTQGGELALGKNLLVAYMPWKGYNYEDAIVLNERVVREDLLTSVHVDEYILEV
RPOB_PARD8       DILTEGYSTQKGELALGRNVKVAYMPWKGYNYEDAIVLNERMVREDFFTSVHVDEYILEV
RPOB_PORGI       QILTEGYSTQGGELALGRNVQVAYMPWKGYNYEDAIVLNERMVREDFFTSVHVDEYILEV
RPOB_FLAPJ       QVLCEGYATQNGELALGRNLKVAFMPWKGYNFEDAIVISEKVVRDDIFTSIHVDDYSLEV
RPOB_GRAFK       QVLCQGYATEAGELALGRNMKVAFMPWKGYNFEDAIVISEKVVRDDIFTSIHIDEYSLEV
RPOB_CYTH3       QVLCEGYATDKGELALGRNLMVAFMPWQGYNFEDAIVISEKVVRDDIFTSIHIEEFELEV
RPOB_SALRD       EVLTDGFAMEKGELALGKNVLCAFMPWHGYNYEDAIVISERLVADDVYTSVHIEEFEHEV
RPOB_PELLD       TVLADSSSTEDGELALGKNVLVAFMPWRGYNFEDAIILSERLVYDDVFTSIHVHEFEANV
RPOB_CHLPD       DVLADSSSTENGELALGKNVLVAFMPWRGYNFEDAIILSERLVYDDVFTSIHIHEFEANV
RPOB_CHLCH       TVLADSSSTEYGELALGKNVLVAFMPWRGYNFEDAIILSERLVYDDVFTSIHIHEFEANV
RPOB_CHLTE       DVLADSSSTDNGELALGKNVLVAFMPWRGYNFEDAIVLSERLVYDDVFTSIHVHEFESSV
RPOB_CHLMU       DVLADGPATDKGELALGKNVLVAFMPWYGYNFEDAIIISEKLIKQDAYTSIYIEEFELTA
RPOB_CHLPN       DVIADGPATDRGELALGKNVLVAFMPWYGYNFEDAIIISEKLIREDAYTSIYIEEFELTA
RPOB_PARUW       DVIADGPATDKGEVALGRNVLVAFMPWFGYNYEDAIIISEKLLREDYYTSLYIEEFELTA
RPOB_RHOBA       QIIADGAATQKGELALGRNVLVGFMSFDGFNYEDAIIISEELVRNDTYTSIHIEDFDVEI
RPOB_TREDE       QPIADGPATYNGELALGRNILVGFVPWNGYNYEDAILISRRVVKEDMFTSIHIKELSTDV
RPOB_TREPA       DALADGPATYRGELALGRNILVGFVPWNGYNYEDAILISHRVVKEDMFTSVHIKEFSTEV
RPOB_BORAP       EIIADGPATRYGELALGNNLLLGVIPWNGFNYEDAILISDRIVKEDLYTSIHIKEFSIEV
RPOB_LEPBL       TVLADGPAVDNGVLALGRNVLAAFMPWEGYNFEDAILISERIVRDDVFSSIHIEEFEIQA
RPOB_FUSNN       DIIADGPATKLGDLSLGRNILMGFMPWEGYNYEDAILISDRLRKDDVFTSIHIEEYEIDA
RPOB_CYAM1       QLIAQSAAMDSGELALGQNVLIAYMPWEGYNFEDAFVISERLVYEDVYTSIHIEKYETDA
RPOB_AQUAE       QIIADGHSTDRGELALGKDVLVAFMPWRGYNFEDAIVISERLVKEDVYTSIHIEELEVEA
RPOB_DEIRA       QVIADGPASERGRLALGQNITIAIMPFDGFNFEDAICINEDLVRQDFYTSVHIEKDEIEA
RPOB_DEIGD       QVIADGPASDQGRLALGQNITIAIMPFDGFNFEDAICISEGLVRKDFYTSVHIEKDEIEA
RPOB_THET8       DLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEA
RPOB_THEMA       DPIADGPATDMGELALGRNILVAFMPWEGYNYEDAILVSQELLEEDVFTSIHIEVYETQA
RPOB_BACCR       EILADGPSMELGELALGRNVLVGFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEYESEA
RPOB_BACSU       EILADGPSMELGELALGRNVMVGFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEYESEA
RPOB_BACHD       EILADGPSMEKGEMALGRNVLVGFMTWEGYNYEDAIILSERLVKDDVYTSIHIEEYESEA
RPOB_GEOTN       EILADGPSMDKGELALGRNVLVAFMTWDGYNYEDAIIMSERLVKEDVYTSIHIEEYEAES
RPOB_OCEIH       EVLADGPSMEDGELALGQNVLVGFMTWEGYNYEDAIIMSERLVKDDVYTSIHIEEFESEA
RPOB_LISIN       EILGNGPSMDSGELALGRNVLVAFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEFESEA
RPOB_STAS1       EILADGPSMELGEMALGRNVVVGFMTWDGYNYEDAVIMSERLVKDDVYTSIHIEEYESEA
RPOB_STRS2       DFIADGPSMENGEMALGQNPIVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEYESET
RPOB_LACLA       DIIADGPSMENGEMALGQNPLVAYMTWEGYNFEDAVIMSERLIKDDVYTSIAIEEYESET
RPOB_LACGA       EVIADGPAMENGELALGQNPIIAFLTWNMYNYEDAVMISERMVKDDVYTSIHIEDYESEA
RPOB_LACAC       DVIANGPTMDHGELALGQNPLIAFMTWNMYNYEDAIMLSERLVKDDVYTSISIEDYESEA
RPOB_LACDB       QVIANGPSMADGELALGQNPVIAFTTWNMYNFEDAIMLSERLVKEDVYTSIHIEDYDSEA
RPOB_LACPL       EVLADGPAMEGGELALGQNPLVAFMTWNGYNFEDAIIINERLVREDVYTSIHIEEYESEA
RPOB_LACBA       EVLADGPSMENGELALGQNPLVAFMTWQGYNFEDAIGINERLVRDDVYTSIHIEEYESEA
RPOB_PEDPA       EVLADGPSMEQGELALGQNPLIAFMTWQGYNFEDAIAINERLVRDDVYTSIHIEEYESEA
RPOB_LACS1       EVLADGPAMENGELALGQNPLIAFMTWDGYNFEDAIAINERLVKEDVYTSIHIEEHESEA
RPOB_LACSS       EIIADGPAMEKGELALGQNPLIAFMTWNMYNYEDAIVLSERLVKEDLYTSIHIEEYESEA
RPOB_LACP3       EIIADGPAMQNGELALGQNPIIAFMTWNMYNYEDAIVLSERLVKDDVYTSIHIEEYESEA
RPOB_ENTFA       DTLADGPSMEEGEMALGQNVLVAFMTWEGYNYEDAIIMSRRLVKDDVYTSVHIEEYESEA
RPOB_LEUMM       EVLADGPSMEQGELALGQNPLIAFMTWQGYNFEDAIVLNERLVREDVYTSIHIEEYDSEA
RPOB_OENOB       EVLADGPAMENGELALGQNPVIAFMTWHGYNFEDAIVLNERLVRDDVYTSIHIEEHESEA
RPOB_CARHZ       QIIADGPSTDHGELALGKNVLVAYMPWEGYNYEDAILISEKLVKEDVFTSIHIEEYECDA
RPOB_MOOTA       QTIADGPSTDQGELALGRNILVAFMTWEGYNYEDAILISEKLVKDDIFTSIHIEEYECDA
RPOB_SYMTH       DVIADGPSTDQGELALGRNVLVAYMCYEGYNYEDAIIINERLVREDVFTSIHIEEHECEA
RPOB_DESHY       QIIADGPSTDHGELALGRNVLIAFMTWEGYNYEDAILISEKLVKEDYYTSIHIEEYEADA
RPOB_CLOAB       TVLADGQSTDLGEIALGRNIRMGFITWEGYNYEDAMLISEQLVRDDVFTSIHIEEYEAEA
RPOB_CLONN       DVLADGPSTDFGEIALGQNIRMGFITWEGYNYEDAMLVSEQLVRDDIFTSIHIEEYESEA
RPOB_CLOPS       EVLADGPSTDLGEIALGKNIRMGFITWEGYNYEDAMLISEELVREDVFTSIHIEEYECEA
RPOB_CLOTE       TVLADGPSTDLGEIALGKNIRMGFITWEGYNYEDAMLISEELVREDVFTSIHIEEYEAEA
RPOB_HUNT2       DVIADGPSTDNGEIALGKNVLVGFMTWEGYNYEDAILISERLVKDDVFTSIHIEEYEAEA
RPOB_CLOD6       DVIADGPATDLGEVALGRNCLIAFMTWEGYNYEDAILINERLVKEDRLSTIHIEEYECEA
RPOB_CALS4       QVICDGPSTDHGELALGKNVLVGFMPWEGYNYEDAILISEELVMDDSLTSIHIEEYDAEA
RPOB_SYNWW       EVIADGPSTEQGELALGRNVMVAFMPWEGYNYEDAILISEKLVKDDVFTSIHIEEYECEA
RPOB_ONYPE       DILVSGPSTSQGELALGRNVTVAFMTWEGYNYEDAIIMSEELVKHDVYTSIHIDKYEVQT
RPOB_COREF       QVIADGPGTFNGEMSLGRNLLVAFMPWEGHNYEDAIILNQNIVEQDILTSIHIEEHEIDA
RPOB_CORDI       QVLADGPGTHNGEMSLGRNLLVAFMPWEGHNYEDAIILNQRVVEEDILTSIHIEEHEIDA
RPOB_CORJK       QVLADGPGTDNGEMALGKNLLVAFMPWEGHNYEDAIILNQRMVEEDVLTSIHIEEYEIDA
RPOB2_NOCFA      QVLADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSQRLVEQDVLTSIHIEEHEIDA
RPOB_RHOJR       QVLADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSQRLVEEDVLTSIHIEEHEIDA
RPOB_MYCS2       QVIADGPCTQNGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDA
RPOB1_NOCFA      QVLADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSQRLVEQDVLTSIHIEEHEIDA
RPOB_SACEN       QVIADGPCTQNGEMALGKNLRVAIMPWEGHNYEDAIILSQRLVQDDVLTSIHIEEHEVDA
RPOB_FRAAA       QVIADGPCTDNGEMALGKNLLVAFMPWEGHNYEDAIILSQRLVQDDVLSSIHIEEHEVDA
RPOB_STRCO       QVLADGPATENGEMALGKNLLVAFMPWEGHNYEDAIILSQRLVQDDVLSSIHIEEHEVDA
RPOB_THEFY       QVLADGPSTEAGEMALGKNLLVAYMSWEGHNYEDAIVLSQRLVEEDILSSIHIEEHEVDA
RPOB_ACIC1       QPIADGPCTQGGELALGRNLLVAFMSWEGHNYEDAIIISERLVKEDILSSIHIEEHEVDA
RPOB_NOCSJ       TPIADGPCTDEAEMALGTNLLVAFMPWQGHNYEDAIILSQRLVQEDILTSIHIEEHEVDA
RPOB_ARTS2       GIIADGPATDQGELALGKNLLVAFMSWEGHNFEDAIILSQRIVAEDVLSSIHIEEHEIDA
RPOB_LEIXX       EVVADGPATENGELALGKNLLVAFMPWEGHNFEDAIILSQNLVKDDTLSSIHIEEYEVDA
RPOB_CUTAK       TPLADGPSTDNGELALGRNMLAAFMPWQGLNYEDAIILSQRIVSDDVLTSIHIEEHEVDA
RPOB_BIFAA       TVLADGPATQKGEMALGKNLLIAFMPWNGYNYEDAVIISQRLVQDDTLSSIHIEEYEIDA
RPOB_TROWT       TVLADGPCTDKGELSLGRNLLVAFMPWEGYNFEDAIIISQNLVKDDTLSSIHIEEHEVST
RPOB_RUBXD       TVLADGSSTDQGELALGKNLLVAFMPWEGYNFEDAIIISERLVKEDVLTSIHIEEYEVQA
RPOB_DEHMC       QVLADSSATENGELALGQNCVVAFMSWQGFNYEDAIILSERLVREDAFTSIHITKHELEA
RPOB_MYCMS       EIIADGPSMDQGELAIGQNVVVAFSTYNGYNFEDAIVMSERIVIDDRFTSTHIDEYTLEV
RPOB_MESFL       QIIADGPSVDNGELALGQNVVVAFTTYNGYNFEDAIVMSERVIMEDKFTSVHIDEYVLEV
RPOB_MYCMO       DLLTDASSFKDGEMALGKNVMIAFSTWNGYNYEDAIVISERLVKDDVFTSVHIEDQTIQF
RPOB_MYCPU       DLISDSSSFKDGEMALGKNVLVGFSTWNGYNYEDAIIVSERLVKDDVFTSIHIEEQTIQF
RPOB_MYCS5       DLLVDGSSFKDGEMALGKNLLVGFTTWNGYNFEDAIIINERLVKDDVLTSIYIEEQTIQF
RPOB_MYCH2       QLICDGPSTDNGELALGKNVLVAFSTWYGYNYEDAIIISEKLVKDDVFTSIHIQEQTIKF
RPOB_CITSI       QVLADGAATVGGELALGKNILVAYMPWEGYNFEDAVLISERLIYRDIYTSFHIRKYEIQT
RPOB_POPTR       QVLADGAATVGGELALGKNILVAYMPWEGYNFEDAVLISERLVYEDVYTSFHIRKYEIQT
RPOB_AETGR       QILADGAATVGGELALGKNILVAYMPWEGYNFEDAVLISECLVYGDIYTSFHIRKYEIQT
RPOB_OENEH       QILADGAATVGGELALGKNVLVAYMPWEGYNFEDAVLISERLVYEDIYTSFHIRKYEMQT
RPOB_NYMAL       QILADGAATVGGELALGKNVSVAYMPWEGYNSEDAVLISERLVYDDIYTSFHIRKYEIQT
RPOB_PIPCE       QILANGAATVGGELALGKNVLVAYMPWEGYNFEDAVLISERLVYEDIYTSFHIRKYEIQT
RPOB_PHAAO       QILAGGAATAGGELALGKNVLVAYMPWEGYNFEDAVLISERLVYKDIYTSFHIRKYEIQT
RPOB_DIOEL       QILADGATTVGGELALGKNVLVAHMPWEGYNSEDAVLISERLVYEDIYTSFYIRKYEIQT
RPOB_PHAVU       QILADGAATVGGELALGKNVLVAYMPWEGYNSEDAVLISERLVYEDIFTSFHIRKYEIQT
RPOB_LOTJA       QILADGAATVGGELSLGKNVLVAYMPWEGYNSEDAVLISDRLVYEDIYTSFHIRKYEIQT
RPOB_JASNU       QILADGAATVGGELALGKNVLVAYMPWEGYNSEDAVLISERLVYEDIYTSFHIRKYEIQT
RPOB_LACSA       QILAYGAATVGGELALGKNVLVAYMPWEGYNFEDAVLISERLVYEDIYTSFHIRKYEIQI
RPOB_SACHY       QILAEGAATVGGELALGKNVLVAYMPWEGYNFEDAVLISERLVYEDIYTSFHIRKYEIQT
RPOB_PELHO       QILADGAATVGGELALGKNVLVGYMPWEGYNFEDAVLISERLVYEDIYTSFHIRKCEIKI
RPOB_ANTAG       QILADGRATAGGELALGKNILVAYMPWEGYNFEDAILISERLIHEDIYTSIHIERYEIEA
RPOB_MARPO       QILADGAATANGELALGKNILVAYMPWEGYNFEDAILINERLIYEDIYTSIHIERYEIEA
RPOB_PHYPA       QVLTDGAAILKGELTLGKNILVAYMPWEGYNFEDAILISERLIYEDIYTSIHIERYEIES
RPOB_PSINU       QLLADGTATVGGELAPGRNILVAYMPWEGYNFEDAILISERLISEDIFTSLHIERYEIEV
RPOB_ANGEV       QLLADGTATVGGELALGRNILVAYMPWEGYNFEDAVLISERLIYEDIYTSFHIERYEINI
RPOB_PINTH       QILADGATTVGGELSLGKNVLVAYMPWEGYNFEDAILISERLVYEDIYTSFHIVRYRIEI
RPOB_CYCTA       QILADGAATVGGELSLGKNILVAHMPWEGYNFEDAILISERLVYEDIYTSFHIERYGIVT
RPOB_ADICA       EIVADGAATVRGELALGKNILVAYMPWEGYNFEDAVLISERLIYEDIFTSLHIEKHEVEI
RPOB_HUPLU       QILADGAATEGGEPASGKNILVAYMPWEGYNFEDAVLINECLIYENVFTSIHIEKYEVEA
RPOB_CHAGL       QILADGATTIRGELSLGRNILVAYMPWEGYNFEDAVLISDRLIYDDLYTSIHIQKYELEI
RPOB_CHAVU       ELLADASSTLGGEISLGNNILVAYMPWEGYNFEDAVLINERLIYEDIYTSIHIEKYEIEV
RPOB_STAPU       QLLADGSATVGGELALGKNVLVAYMPWEGYNFEDAVLISDRLVNEDIYTSIHIQRYEISV
RPOB_ZYGCR       QLIADGSATVDGELALGKNVLVAYMPWEGYNFEDAVLINERLIYEDVYTSLHIERYEAEA
RPOB_NEPOL       DLLADGSSTSGGQIALGKNLLVAYMPWEGYNFEDAILISERLIYDDLYTSLHIERYEVET
RPOB_OSTTA       DCLADNAATAKGELALGRNILIGYMPWEGYNFEDAVLVSERLVYDDVFTSIHISRYEVST
RPOB_MESVI       DILADGSATVNGELTLGQNILVAYMPWEGYNFEDAILISEKLVYEDIYTSIHIEKYEVDA
RPOB_CHLAT       DILADGAATVGGQLTLGKNVLVAYMPWEGYNFEDAILISQRLVYDDIYTSIHIEKYEIEA
RPOB_OLTVI       DLLADNSTTVGGELSLGKNLLLAYMPWEGYNFEDAILISERLVSDDAYTSLHIERYEVEI
RPOB_BIGNA       NPLISGLSSCRNELALGKNLFVGYISWKGYNFEDAIVLNEQLVINNIYTSTHLEKFETEI
RPOB_PHATC       QILTDGPAITSSELSLGQNVLIGYMPWQGYNFEDAILINERLVYDDVFTSIHIERYKIEI
RPOB_THAPS       QMLTDGPGIISSELSLGQNVLVAYMPWQGYNFEDAILINERLVYEDIFTSIHIERYEIEI
RPOB_TRIV2       QVLADGSSTEGGELALGQNIVVAYMPWEGYNYEDAILISERLVQDDIYTSIHIEKYEIEA
RPOB_TRIEI       QVLADGSSTEGAELALGQNVLVAYMPWEGYNYEDAILISERLVYDDVYTSIHIEKFEIEA
RPOB_SYNY3       QVLADGSATEGGELALGQNILVAYMPWEGYNYEDAILISERLVYDDVYTSIHIEKFEIEA
RPOB_SYNE7       QVIADGSATEKGELALGQNILVAYMPWEGYNYEDAILISERLVYDDVYTSIHIEKFEIEA
RPOB_THEEB       QVIADGSATEGGELALGQNILVAYMPWEGYNYEDAILISERLVQEDVYTSIHIEKYEIEA
RPOB_SYNJA       QVLADGPATEGGELALGQNVLVAYMPWEGYNYEDAILISERLVYDDVFTSVHIEKYEIEA
RPOB_GLOVI       QILADGSATEGGELALGQNILVAFMPWEGYNYEDAILISERLVYDDVFTSIHVEKFEIEA
RPOB_PROM5       QVLADGSACEGGEIALGQNVLIAYMPWEGYNYEDAILVSERMVTDDLYTSVHIEKYEIEA
RPOB_GUITH       QVIADGAATEGGELALGQNILVAYLPWEGYNYEDAFLINERLVYNDVYTSVHIEKYEIEA
RPOB_RHDSA       QVIADGAATEGGELALGQNILIAYLPWEGYNYEDAFLISERLVYNDVYTSVHIEKYEIEA
RPOB_PYRYE       QTLADGASTDGGEIALGRNILVAYMPWEGYNYEDAFLISERLVYDDLYTSIHIEKYEVEC
RPOB_GRATL       QTIADGASTDGGEIALGRNIIVAYMPWEGYNYEDAFLISERLVYEDLYTSIHIERYELEC
RPOB_CYAPA       QILADDTATDKGELALGQNLLVAYMPWEGYNYEDAILINERLVYEDVYTSIHIEKYETET
RPOB_CYACA       QILADGSATDTGELALGRDVLVAYMPWEGYNYEDAFLISDRLVYEDLYTSIHIEKYEIEA
RPOB_EMIHU       QLLADGTSTETGELAVGQNILIAYMPWEGYNYEDAFVVNERLLYDDLHTSIHIEKFEIES
RPOB_EUGLO       QIIAEGIGSLNGNLCLGKNILVGYLSWEGYNFEDAIIISERLRNEDILTSIHVKKCKSFL
                   :             * :   .   :   . **:. :.      :  ::  :       

RPOB_MYCGE       LSTKNGD--EQITRDIPNVSDANK--RYLDENGIIMVGAEVKEG------DVLVGKVSPK
RPOB_MYCPN       LSTKNGD--EQITRDIPNVSDANK--RYLDENGIIMVGAEVKEG------DVLVGKVSPK
RPOB_MYCGA       LRTKNGD--EEITRDIPNISESAK--RYLDEEGVIMVGAEVKEG------DILVGKTSPK
RPOB_MYCPE       LKTKNGD--EEITRDIPNVSESSK--KYLDDEGIIMVGAEVKEG------DVLVGKISPK
RPOB_UREPA       MKTKNGD--EEITRDMPNVSDTAK--RFLDNQGIVLVGAEVHEG------DVLVGKTTPR
RPOB_ALKEH       RDTKLGT--EEITADIPNVSESAL--NRLDEAGIVHIGAEVKAG------DILVGKVTPK
RPOB_HALHL       RDTKLGS--EEITSDIPNVSESAL--SRLDESGIVYIGAEVKAG------DILVGKVTPK
RPOB_METCA       RDTKLGP--EEITADIPNVGEAAL--SKLDESGIVYIGAEVKAG------DILVGKVTPK
RPOB_XANC8       RDTKLGP--EEISADIPNVSEQAL--NRLDESGVVYIGAEVRAG------DIMVGKVTPK
RPOB_XYLFT       RDTKLGS--EEISADIPNVSEQAL--NRLDESGVVYIGAEVRAG------DILVGKVTPK
RPOB_LEGPA       RDTKLGT--EEITADIPNVGESAL--SNLDESGVVYIGAEVKAG------DILVGKVTPK
RPOB_COXBU       RDTKLGP--EEITSDIPNVGESAL--AKLDESGIVHIGAEVNAG------DILVGKVTPK
RPOB_NITOC       RDTKLGP--EEISSDIPNVSEAAL--SKLDEAGIVYIGAEVKPG------DILVGKVTPK
RPOB_AROAE       RDTKLGP--EEITRDIASLGEAQL--SRLDESGIVYIGAEVDAG------DVLVGKVTPK
RPOB_AZOSB       RDTKLGP--EEITRDIASLGEAQL--SRLDESGIVYIGAEVEAG------DVLVGKVTPK
RPOB_METFK       RDTKLGA--EEITRDISNLSERML--GRLDESGIIYIGAEVEAG------DVLVGKVTPK
RPOB_NITEC       RDTKLGT--EEVTADIPNLSERQR--ARLDESGIVYIGAEVEAG------DVLVGKVTPK
RPOB_NITMU       RDTKLGT--EEITGDISNLSEAQL--GRLDASGIVHIGAEVEAG------DVLVGKVTPK
RPOB_THIDA       RDTKLGP--EEITRDISNLAERQL--ARLDESGIIAIGAEVEAG------DVLVGKVTPK
RPOB_DECAR       RDTKLGP--EEITRDIASLGEAQL--SRLDDSGIVYIGAEVEAG------DVLVGKVTPK
RPOB_PARXL       RDTKLGP--EEITRDISNLAEVQL--GRLDESGIVYIGAEVEAG------DVLVGKVTPK
RPOB_HERAR       RDTKLGA--EEITRDISNLAENQL--ARLDESGIVYIGAEVTAG------DTLVGKVTPK
RPOB_RALSO       RDTKLGP--EEITRDISNLAEAQL--ARLDESGITYIGAEVEAG------DVMVGKVTPK
RPOB_BORA1       RDTKLGP--EEITRDISNLAETQL--NRLDESGIVYIGAEVSAD------DVLVGKVTPK
RPOB_RHOFT       RDTKLGC--EEITRDIPNLSEQQL--NRLDESGIIYVGAEVQPG------DTLVGKVTPK
RPOB_POLSJ       RDTKLGS--EEITRDIPNLSEQQL--NRLDESGIIYVGAEVQPG------DTLVGKVTPK
RPOB_VEREI       RDTKLGA--EEITRDIPNLSEQQL--NRLDESGIIYVGAEVQPG------DTLVGKVTPK
RPOB_METPP       RDTKLGS--EEITRDIPNLSEQQL--GRLDESGIVYIGAEVNPG------DVLVGKVTPK
RPOB_NEIG1       RDTKLGA--EDITRDIPNLSERMQ--NRLDESGIVYIGAEVEAG------DVLVGKVTPK
RPOB_CHRVO       RDTKLGP--EEITRDIPNLSERMA--GRLDESGIVYIGAEVEAG------DVLVGKVTPK
RPOB_ACIBT       RDTKLGA--EEITADIPNVGEAAL--SKLDESGIVYIGAEVTAG------DILVGKVTPK
RPOB_PSYCK       RDTKLGT--EEITADIPNVGEAAL--SSLDEAGIVYIGAEVDAG------DILVGKVTPK
RPOB_HAHCH       RDTKLGP--EEVTADIPNVGESAL--AKLDDSGIIYIGAEVEPG------DILVGKVTPK
RPOB_MARHV       RDTKLGS--EEITADIPNVGESAL--SKLDESGIVYIGAEVGPG------DILVGKVTPK
RPOB_SACD2       RDTKLGS--EEITADIPNVGEGAL--SKLDESGIVYVGAEVASG------DILVGKVTPK
RPOB_PSEU5       RDTKLGP--EEITADIPNVGEAAL--NKLDEAGIVYVGAEVGPG------DILVGKVTPK
RPOB_CHRSD       RDTKLGA--EEISSDIPNVGEAAL--GKLDDAGIVYIGAEVGAG------DILVGKVTPK
RPOB_ALCBS       RDTKLGP--EEITADIPNVGEAAL--SKLDESGIVYIGAEVEAG------DILVGKVTPK
RPOB_SODGM       RDTKLGP--EEITADIPNVGEAAL--SKLDESGIVYIGAEVTGG------DILVGKVTPK
RPOB_ECOLI       RDTKLGP--EEITADIPNVGEAAL--SKLDESGIVYIGAEVTGG------DILVGKVTPK
RPOB_BAUCH       RDTKLGP--EEITSDIPNVGEAAL--CKLDESGIVYIGAEVTSG------DILVGKVTPK
RPOB_BLOFL       RDTKLGP--EEITSDIPNIGETAL--SKLDEVGVVYIGAEVVGG------DILVGKITPK
RPOB_BLOPB       RDTKLGP--EEITADIPNVGETAL--SKLDESGIIYIGAEVIGG------DILVGKVTPK
RPOB_BUCAI       RDTKLGA--EEISSDIPNVGEAAL--SKLDESGIVYIGAEVTGG------DILVGKVTPK
RPOB_BUCAP       RDTKLGP--EEISSDIPNVGEAAL--SKLDESGIVYIGAEVTGG------DILVGKVTPK
RPOB_BUCBP       RDTKLGS--EEITSDIPNVGEAAL--SKLDESGIVYIGAEVNGG------DILVGKVTPK
RPOB_WIGBR       RDTKLGS--EEITSDIPNVSETSL--LKLDESGIVYIGAEVKGG------DILVGKVTPK
RPOB_BUCCC       RDTKLGI--EEITSDIPNIGESAL--SKLDTSGIIYIGADVSSG------DVLVGKVTPK
RPOB_ACTP2       RDTKLGA--EEITADIPNVGESAL--SKLDESGIVYVGAEVKGG------DILVGKVTPK
RPOB_MANSM       RDTKLGA--EEITADIPNVGETAL--SKLDESGIVYVGAEVKGG------DILVGKVTPK
RPOB_HAEI8       RDTKLGA--EEITADIPNVGESAL--SKLDESGIVYVGAEVKGG------DILVGKVTPK
RPOB_ALIF1       RDTKLGS--EEITADIPNVGEAAL--SKLDESGIVYIGAEVKGG------DILVGKVTPK
RPOB_PHOPR       RDTKLGS--EEITADIPNVGEAAL--SKLDESGIVYIGAEVKGG------DILVGKVTPK
RPOB_VIBCH       RDTKLGA--EEITADIPNVGEAAL--SKLDESGIVYIGAEVKGG------DILVGKVTPK
RPOB_AERS4       RDTKLGP--EEITADIPNVGEAAL--SKLDESGIVYVGAEVKGG------DILVGKVTPK
RPOB_COLP3       RDTKLGS--EEITADIPNVGESAL--SKLDEAGVVYIGAEVNGG------DILVGKVTPK
RPOB_PSEA6       RDTKLGP--EEISSDIPNVGESAL--GKLDESGVVYIGAEVKGG------DILVGKVTPK
RPOB_PSEHT       RDTKLGS--EEITADIPNVGESAL--GKLDESGVVYIGAEVKSG------DILVGKVTPK
RPOB_SHEAM       RDTKLGS--EEITADIPNVGESAL--SKLDESGIVYIGAEVKGG------DILVGKVTPK
RPOB_IDILO       RDTKLGA--EEITSDIPNVGESAL--GKLDESGVVYVGAEVNGG------DILVGKVTPK
RPOB_PSYIN       RETKLGS--EEISADIPNVGEAAL--SKLDESGIVYVGAEVKPG------DILVGKVTPK
RPOB_DICNV       RDTKLGP--EEISSDIPNVKESAL--AKLDTTGIVYVGAEVKFG------DILVGKVTPK
RPOB_HYDCU       RDTKLGP--EEVTSDIPNVGEAAL--SRLDESGIVYVGAEVKQG------DILVGKVTPK
RPOB_VESOH       RDTKLGP--EEITSDIPNVSESAL--SKLDEVGVVYVGARVKGG------DILVGKVTPK
RPOB_FRATO       RDTKLGP--EEITADIPNVSESSL--AKLDESGIVHIGANVEAG------DILVAKITPK
RPOB_RHIL3       RDTKLGP--EEITRDIPNVSEEAL--KNLDEAGIVYIGAEVQPG------DILVGKITPK
RPOB_RHIME       RDTKLGP--EEITRDIPNVSEEAL--KNLDEAGIVYIGAEVQPG------DILVGKITPK
RPOB_AGRFC       RDTKLGP--EEITRDIPNVSEEAL--KNLDEAGIVYIGAEVQPG------DILVGKITPK
RPOB_RHILO       RDTKLGP--EEITRDIPNVSEEAL--KNLDEAGIVYIGAEVQPG------DILVGKITPK
RPOB_CHESB       RDTKLGP--EEITRDIPNVSEEAL--KNLDEAGIVYIGAEVQPG------DILVGKITPK
RPOB_BRUSU       RDTKLGP--EEITRDIPNVSEEAL--KNLDEAGIVYIGAEVHPG------DILVGKITPK
RPOB_BARBK       RDMKLGP--EEITRDIPNVAEEAL--RNLDEAGIVYIGAEVQPG------DILVGKITPK
RPOB_RHOPB       RDTKLGP--EEITRDIPNVSEEAL--KNLDEAGIVYIGAEVRAG------DILVGKITPK
RPOB_GLUOX       RDTKLGQ--EEITRDIPNVGEEAL--RNLDEAGIVYVGAEVNPG------DILVGKVTPK
RPOB_GRABC       RDTKLGQ--EEITRDIPNVGEEAL--RNLDEAGIVYIGAEVNPG------DILVGKVTPK
RPOB_MAGSA       RDTKLGQ--EEITRDIPNVGEEAL--KNLDEAGIVYIGAEVKPG------DILVGKVTPK
RPOB_RHORT       RDTKLGQ--EEITRDIPNVGEEAL--KNLDEAGIVYIGAEVQAG------DILVGKVTPK
RPOB_CAUVC       RDTKLGP--EEITRDIPNVGEEAL--RNLDEAGIVAIGAEVQPG------DILVGKVTPK
RPOB_MARMM       RDTKLGP--EEITRDIPNVGEEAL--RNLDEAGIVAVGAEVAAG------DILVGKVTPK
RPOB_HYPNA       RDTKLGP--EEITRDIPNVGEEAL--RNLDEAGIVAVGAEVKAG------DILVGKVTPK
RPOB_RHOS1       RDTKLGP--EEITRDIPNVGEEAL--RNLDEAGIVYIGAEVQPG------DILVGKITPK
RPOB_PARDP       RDTKLGP--EEITRDIPNVGEEAL--RNLDEAGIVYIGAEVGPG------DILVGKITPK
RPOB_ROSDO       RDTKLGP--EEITRDIPNVGEEAL--RNLDEAGIVYIGADVEPG------DILVGKITPK
RPOB_JANSC       RDTKLGP--EEITRDIPNVGEEAL--RNLDEAGIVYIGAEVEPG------DILVGKITPK
RPOB_NOVAD       RDTKLGP--EDITRDIPNVGEEAL--RNLDEAGIVYIGAEVHPG------DILVGKITPK
RPOB_ERYLH       RDTKLGP--EDITRDIPNVGEEAL--RNLDEAGIVYIGAEVHPG------DILCGKITPK
RPOB_SPHAL       RDTRLGP--EDITRDIPNVGEEAL--RNLDEAGIVYIGAEVGPG------DILAGKITPK
RPOB_ZYMMO       RDTKLGP--EDITRDIPNVGEDAL--RNLDEAGIVYIGAEVQPG------DILVGKITPK
RPOB_PELUB       RDTKLGE--EEITRDIPNVNEEAL--KNLDESGIVYIGAEVKAG------DILVGKVTPK
RPOB_RICBR       RDTRLGP--EEITRDIPNVSEEAL--RHLDEVGIIYVGAEVKAG------DILVGKVTPK
RPOB_ORITB       RDTRLGP--EEITRDIPNVNDESL--RHLDEVGIVNIGAKVRTG------DILVGKVTPK
RPOB_ANAMM       RDTPLGP--EKIMRSVPDVNEESL--SHLDDVGIVNIGAEVSAS------SILVGKVTPR
RPOB_ANAPZ       RDTPLGP--EKIMRSVPDVNEESL--SHLDDVGIVNIGAEVSAG------SVLVGKVTPR
RPOB_EHRRW       RDTALGP--EKIMRSIPDVNEDSL--SHLDDVGIVNVGAEVSAG------DILVGKVTPR
RPOB_NEOSM       RDTRLGP--EEITRDVSGVAEEFL--HCLDEFGIACVGANVEAG------DVLVGKVTPK
RPOB_MAGMM       RDTKLGA--EEITRDMPNVGEDAL--RNLDESGIIYVGAEVKPG------DILVGKVTPK
RPOB_ANADE       RDTKLGK--EEITRDIPNVGEEAL--KDLDESGIIRIGAEVKPG------DILVGKITPK
RPOB_MYXXD       RDTKLGK--EEITRDIPNVGEEAL--KDLDESGIIRIGAEVKPG------DVLVGKITPK
RPOB_SYNFM       RDTKLGK--EDITRDIPNVGEEAL--KNLDESGIIRVGAYIKPN------DILVGKVTPK
RPOB_SYNAS       RDTKLGK--EDITRDIPNVGEEAL--RNLDDSGIVRMGVSVKSG------DILVGKITPK
RPOB_GEOSL       RDTKLGK--EEITSDIPNLGEEAL--KDLDESGIIRIGAEVKPG------DILVGKITPK
RPOB_PELPD       RDTKLGK--EEITSDIPNLGEEAL--KDLDESGIIRIGAEVKPG------DILVGKITPK
RPOB_PELCD       RDTKLGK--EEITNDIPNLGEDAL--KDLDESGIVRIGAEVKPG------DILVGKITPK
RPOB_BDEBA       RDTKLGK--EEITRDIANVGEEAL--KDLDSSGIIRIGAEVRPG------FILVGKVTPK
RPOB_DESPS       RDTKLGK--EEITRDIPNVSEDTL--RNLDDSGIVRVGAEIKPG------DTLVGKVTPK
RPOB_DESVV       RDTKLGP--EEITRDIPNVGEDML--RNLDGSGIIRIGASVKPD------DILVGKITPK
RPOB_DESAG       RDTKLGP--EEITRDIPNVGEDML--RNLDGSGIIRIGANVKPD------DILVGKITPK
RPOB_LAWIP       RDTKLGP--EEITRDIPNVGEEML--SNLDENGIIRIGAAVKPE------DILVGKITPK
RPOB_KORVE       RDTKLGP--EEITRDIPNVSESAL--RDLDESGVIRIGAPVKAG------DILVGKVTPK
RPOB_SOLUE       RDTKLGP--EEITRDIPNIADSFL--RNLDESGIIRIGATVKPG------DILVGKVTPK
RPOB_CAMJJ       RELKDGI--EEITKDIPNVKEEDV--AHLDESGIAKIGTHIKPG------MILVGKVSPK
RPOB_CAMFF       RELKDGV--EEITRDIPNMKEEDL--MHLDESGIVKIGTHIKPG------MILVGKVSPK
RPOB_SULDN       RELKHGV--EEITRDIPNVRDDEL--SHLDESGIIKIGTNVTGG------MILVGKVSPK
RPOB_BACV8       RETKRGM--EELTSDIPNVSEEAT--KDLDENGIVRVGARIEPG------DILIGKITPK
RPOB_PARD8       RETKRGM--EELTSDIPNVSEEAT--KDLDERGIVRVGARIEPG------DILIGKITPK
RPOB_PORGI       RETKRGL--EELTSDIPNVSEDAT--RDLDENGIVRIGAHIEPG------DILIGKITPK
RPOB_FLAPJ       RDTKLGN--EELTNDIPNVSEEAT--KDLDENGMIRIGAEVKPG------DILIGKITPK
RPOB_GRAFK       RDTKLGN--EELTNDIPNVSEEAT--KDLDEHGMIRVGAEVKPG------DILIGKITPK
RPOB_CYTH3       RDTKRGE--EELTSEIPNVSEEAV--KNLDENGIIRTGAEIKEG------DILIGKITPK
RPOB_SALRD       RDTKRGE--EELTREIPNVSEEAT--KDLDERGIVRVGAEITPG------DIIVGKITPK
RPOB_PELLD       RDTKRGE--EQFTRDIYNVSDEAL--RNLDENGIVRIGAEVKER------DILVGKITPK
RPOB_CHLPD       RDTKRGE--EQFTRDIYNVSEDAL--RNLDENGIVRIGAEVKER------DILVGKITPK
RPOB_CHLCH       RDTKRGE--EQFTRDIYNVSEEAL--RNLDENGIVRCGAEVKER------DILVGKITPK
RPOB_CHLTE       RDTKRGE--EQFTRDIYNVSEDAL--RNLDENGIVRIGAEVKER------DILVGKITPK
RPOB_CHLMU       RDTKLGK--EEITRDIPNVSEEVL--ANLGEDGIVRIGAEVKPG------DILVGKITPK
RPOB_CHLPN       RDTKLGK--EEITRDIPNVSDEVL--ANLGEDGIIRIGAEVKPG------DILVGKITPK
RPOB_PARUW       RDTKLGK--EEITRDIPNVSEETL--RNLNDDGIIRIGAEVKPG------DTLVGKITPK
RPOB_RHOBA       RETKLGR--EEFTRDIPNVSEKAL--RNLDDTGIVQTGTYVKPG------DILVGKVSPK
RPOB_TREDE       RETKLGA--EKMTCDIPNKSEKSL--DDLDSEGIIRIGSKVKPG------DILVGKVTPK
RPOB_TREPA       RETKLGS--ERMTNDIPNKSEKNL--DNLDAEGIIRIGSKVRAG------DVLIGKITPK
RPOB_BORAP       RETKLGP--EKVTGDIPNVSEKIL--NKLDENGIIRIGTYVKPG------DILVGKVTPK
RPOB_LEPBL       RETKLGP--EQITRDIPNLSDKAF--RDLDETGVIRIGAEVKPG------DILVGMVTPK
RPOB_FUSNN       RTTKLGD--EEITREIPNVSESAL--RNLDENGVIMIGSEVGPG------DILVGKTAPK
RPOB_CYAM1       RQTKLGA--EQITRQIPNVGEHAL--RQLDEHGIISVGSWVEAG------SILVGKITPK
RPOB_AQUAE       RETKVGE--EEITRQIPGVPERAL--AHLDEHGIVRVGTYVKPG------DILVGKVTPK
RPOB_DEIRA       RDTKLGP--EKITRDIPGLSEAAL--RDLDEDGIVRVGAEVKPG------DILVGKTSFK
RPOB_DEIGD       RDTKLGP--EKITRDIPGLSEAAL--RDLDEDGIVRVGAEVKPG------DILVGKTSFK
RPOB_THET8       RDTKLGP--ERITRDIPHLSEAAL--RDLDEEGVVRIGAEVKPG------DILVGRTSFK
RPOB_THEMA       RETRLGP--EEITADIPNVSKELL--KNLDENGIIRVGAYVVSDYGVGSQAILVGKVTPK
RPOB_BACCR       RDTKLGP--EEITRDIPNVGEDAL--RNLDERGIIRVGAEVKDG------DLLVGKVTPK
RPOB_BACSU       RDTKLGP--EEITRDIPNVGEDAL--RNLDDRGIIRIGAEVKDG------DLLVGKVTPK
RPOB_BACHD       RDTKLGP--EEITRDIPNVGEDAL--RNLDERGIIRVGAEVKDG------DILVGKVTPK
RPOB_GEOTN       RDTKLGP--EEITRDIPNVGEDAL--KNLDERGIVRIGAEVKDG------DLLVGKVTPK
RPOB_OCEIH       RDTKLGP--EEITRDIPNVGEDAL--KNLDEHGIIRVGAEVTDG------DILVGKVTPK
RPOB_LISIN       RDTKLGP--EEMTRDIPNVGEDAL--RDLDERGIIRVGAEVKDN------DLLVGKVTPK
RPOB_STAS1       RDTKLGP--EEITRDIPNVSDSAL--KNLDDRGIVYVGAEVNDG------DILVGKVTPK
RPOB_STRS2       RDTKLGP--EEITREIPNVGEDAL--RNLDEMGIIRIGAEVKEG------DILVGKVTPK
RPOB_LACLA       RDTKLGP--EEITREIPNVGDEAL--KNLDESGIIRIGAEVKDG------DLLVGKVTPK
RPOB_LACGA       RDTKLGP--EEITREIPNVGEDAL--KDLDEEGIVRIGAEVQDG------DILVGKVTPK
RPOB_LACAC       RDTKLGP--EEITRELPNIGEDAL--KDLDADGIVRVGAEVHDG------DILVGKVTPK
RPOB_LACDB       RDTKLGP--EEITREIPNVGEDAL--KDLDENGIIRIGAEVHDG------DILVGKVTPK
RPOB_LACPL       RDTKLGP--EEMTREIPNVGEDAL--KNLDEDGIIRIGAEVKDG------DILVGKVTPK
RPOB_LACBA       RDTKLGP--EEMTREIPNVGEDAL--KNLDEDGIIRVGAEVQDG------DILVGKVTPK
RPOB_PEDPA       RDTKLGP--EEMTREIPNIGEDAL--RNLDQDGIVRVGAEVEDG------DILVGKVTPK
RPOB_LACS1       RDTKLGP--EEITREIPNVGEDAL--KNLDEFGIIRIGAEVKDG------DILVGKVTPK
RPOB_LACSS       RDTKLGP--EEITREIPNVGEDSL--KDLDEFGIVRVGAEVKDG------DILVGKVTPK
RPOB_LACP3       RDTKLGP--EEVTREIPNVGEEAL--KDLDEFGVVRVGAEVRDG------DILVGKVTPK
RPOB_ENTFA       RDTKLGP--EEITREIPNVGEDAL--KDLDEMGIIRIGAEVQDG------DLLVGKVTPK
RPOB_LEUMM       RDTKLGP--EEMTREIPNTGEDQL--KDLDADGIIRVGAEVHDG------DILVGKVTPK
RPOB_OENOB       RDTKLGP--EEITREIPNVGEDQL--KDLDDSGIIRIGAEVEDG------DILVGKITPK
RPOB_CARHZ       RDTKLGP--EEITRDIPNVGEDAL--KDLDERGIIRIGAEVRPG------DILVGKVTPK
RPOB_MOOTA       RDTKLGP--EEITRDIPNVSEDVL--KDLDERGIIRIGAEVRPG------DILVGKVTPK
RPOB_SYMTH       RDTKLGP--EEITRDIPNVGEDVL--KDLDERGIIRIGAEVRPG------DILVGKVTPK
RPOB_DESHY       RDTKLGP--EEITRDIPNVGEDVL--KDLDERGIIRIGAEVSTG------DILVGKVTPK
RPOB_CLOAB       RDTKLGP--EEITRDIPNVGEDAL--KDIDERGIIRIGAEVRSG------DILVGKVTPK
RPOB_CLONN       RDTKLGP--EEITRDIPNVGEDAL--KNIDERGIVRIGAEVRSG------DILVGKVTPK
RPOB_CLOPS       RDTKLGP--EEITRDIPNVSEDAL--KDIDERGIIRIGAEVRSG------DILVGKVTPK
RPOB_CLOTE       RDTKLGP--EEITRDIPNVGEDAL--KDIDERGIIRIGAEVRSG------DILVGKVTPK
RPOB_HUNT2       RDTKLGP--EDITREIPNVSEDAL--KDLNSEGIIRIGAEVRAG------DILVGKVTPK
RPOB_CLOD6       RDTKLGP--EEITRDIPNVGDSAI--KNLDDRGIIRIGAEVDSG------DILVGKVTPK
RPOB_CALS4       RDTKLGP--EEITREIPNVGEDAL--KDLDERGIIRIGAEVRAG------DILVGKVTPK
RPOB_SYNWW       RDTKLGS--EEITRDIPNVSEDML--KNLDDQGVIRVGAEVRPD------DILVGKVTPK
RPOB_ONYPE       RELKKGSGQEEITREVPNVGADAI--KNLDERGIIIPGSEVKEG------DILVGKITPQ
RPOB_COREF       RDTKLGA--EEITRDIPNVSEEVL--KDLDERGIVRIGADVRDG------DILVGKVTPK
RPOB_CORDI       RDTKLGP--EEITREIPNVSEDVL--KDLDERGIVRIGADVRDG------DILVGKVTPK
RPOB_CORJK       RDTKLGP--EEITRDIPNVGEDVL--ADLDERGIVRIGADVRDG------DILVGKVTPK
RPOB2_NOCFA      RDTKLGA--EEITRDIPNVSDEVL--ADLDERGIVRIGAEVRDG------DILVGKVTPK
RPOB_RHOJR       RDTKLGA--EEITRDIPNVSDEVL--ADLDERGIIRIGAEVRDG------DVLVGKVTPK
RPOB_MYCS2       RDTKLGA--EEITRDIPNVSDEVL--ADLDERGIVRIGAEVRDG------DILVGKVTPK
RPOB1_NOCFA      RDTKLGA--EEITRDIPNVSDEVL--ADLDERGIVRIGAEVRDG------DILVGKVTPK
RPOB_SACEN       RDTKLGA--EEITRDIPNVSEDVL--ADLDERGIIRIGAEVQGG------DILVGKVTPK
RPOB_FRAAA       RDTKLGP--EEITRDIPNVAEEVL--ADLDERGIIRIGAEVSPG------DVLVGKVTPK
RPOB_STRCO       RDTKLGP--EEITRDIPNVSEEVL--ADLDERGIIRIGAEVVAG------DILVGKVTPK
RPOB_THEFY       RETKLGP--EEITREIPNVSEEVL--ADLDERGIIRIGAEVVDG------DILVGKVTPK
RPOB_ACIC1       RDTKLGP--EEITRDIPNVSEEIL--ADLDERGIIRIGADVVPG------DILVGKVTPK
RPOB_NOCSJ       RDTKLGP--EEITRDIPNVSEEML--ADLDERGIIRIGAEVTTG------DVLVGKVTPK
RPOB_ARTS2       RDTKLGA--EEITRDIPNVSEEVL--AGLDERGIIHIGAEVEAG------DILVGKVTPK
RPOB_LEIXX       RDTKLGK--EEITRDLPNVSPDLL--ADLDERGIIRIGAEVRPG------DILVGKVTPK
RPOB_CUTAK       RDTKLGA--EEITRDIPNVSEDML--ANLDENGIVRIGAEVGTG------DILVGKVTPK
RPOB_BIFAA       RETKLGA--EEITRDLPNVGEDAV--ANLDERGIIRIGAEVEAG------DILVGKVTPK
RPOB_TROWT       RDTKLGS--EEITRDLPNVSMDYI--KDLDERGIIRIGAEVGPG------DILVGKVTPK
RPOB_RUBXD       RDTKLGP--EEITRDIPHASDDVL--MNLDADGIIRIGAEVSSG------DVLVGKVTPK
RPOB_DEHMC       RDTKLGV--EEITRDIPNVGEESL--RELDEDGIIRIGAEVGPD------DILVGKITPK
RPOB_MYCMS       RNTKQGQ--EEVIREIPNMSEQAK--RHLDAEGIVAIGTEVKVG------DVLVGKVTPK
RPOB_MESFL       RNTKQGA--EEITSEIPNISDNAK--KYLDNEGIVAIGTEVKTG------DILVGKVTPK
RPOB_MYCMO       RTSKAGS--DKLTREIPNVSNFSK--RNLDEEGIVKVGSEVVAG------DILVGRVSPK
RPOB_MYCPU       RKSKAGD--DKLTADIPNASLKSR--RHLDENGIVRIGSEVVTG------DILVGRVSPK
RPOB_MYCS5       RISKSSE--DIMTRDIPNVSKYSM--RNLDEFGIIKVGSEVVAG------DVLVGRISPK
RPOB_MYCH2       RSTKAGN--DILTAEIPNASAKSR--LHLDANGIVIVGSEVDTG------DILVGRTSPK
RPOB_CITSI       HVTSQG--PERITNEIPHLEARLL--RNLDKNGIVMLGSWVETG------DILVGKLTPQ
RPOB_POPTR       HVTSQG--PERITNEIPHLEAHLL--RNLDKNGIVMLGSWVETG------DILIGKLTPQ
RPOB_AETGR       HVTTQG--PERITKEIPHLEGHLL--RNLDKNGIVMLGSWVETG------DILVGKLTPQ
RPOB_OENEH       HVTSQG--PERITNEIPHLEAHLL--RNLDKNGIVMMGSWVEAG------EILVGKLTPQ
RPOB_NYMAL       HVTSQG--PERITNEIPHLEPYLL--RNLDRNGIVMLGSWVETG------DVLVGKLTPQ
RPOB_PIPCE       HVTSQG--PERITKEIPHLETHLL--RNLDRNGIVMLGSWVETG------DILVGKLTPQ
RPOB_PHAAO       HVTSQG--PERITKEIPHLEARLL--RNLDRNGIVMLGSWIETG------DILVGKLTPQ
RPOB_DIOEL       HVTSQG--PERITKEIPHLEDHLL--RNLDRNGIVMLGSWIETG------DILVGKLTPQ
RPOB_PHAVU       HMTSYG--SERITNKIPHLEANLL--RNLDKNGIVILGSWVETG------DVLVGKLTPQ
RPOB_LOTJA       HVTSNG--PERITNKIPHLEVHLL--RNLDKNGLVILGSWVEAG------DILVGKLTPQ
RPOB_JASNU       AGT------ERITNEIPHLEAHLL--RNLDKNGIVMLGSWVETG------AILVGKLTPE
RPOB_LACSA       NQGS-----ERVTNEIPHLEVHLL--RNLDKNGIVMLGSWVETG------DILVGKLTPQ
RPOB_SACHY       DTTSQGS-AEKITKQIPHLEEHLL--RNLDRNGVVRLGSWVETG------DILVGKLTPQ
RPOB_PELHO       FMTMKG--PEKITNQIPHIDPHLL--RNLDKNGVVILGSWVEAG------DILVGKLTPE
RPOB_ANTAG       RVTSQG--PERITREIPHLDNYLL--RHLDESGLVLPGSWVETG------DVLVGKLTPQ
RPOB_MARPO       RVTSQG--PEKFTNEIPHLDDYLL--RHLDQNGIVLTGSWVETG------DVLVGKLTPQ
RPOB_PHYPA       RNTNQG--PEKITKEIPHLENSVL--RHLDKNGLVIPGSWVETG------DVLVGKLTPQ
RPOB_PSINU       RITNQG--IEEITKDIPHLDSYVL--RHLDSNGLVVLGSWVETG------DVLVGKLTPQ
RPOB_ANGEV       YTTSQG--PEKITKEIPHLDSYVL--RHLDNNGLVVPGSWVETG------DVLVGKLTPQ
RPOB_PINTH       CMTSQG--PERITREIPHLDAHLL--RHLDENGLVMLGSWIETG------DVLVGKLTPQ
RPOB_CYCTA       CMTSQG--PERITKEIPHLDAHLL--RHLDGNGLVMLGSWVETG------DVLVGKLTPQ
RPOB_ADICA       CATNQG--PERVTKQISQLDGYLL--RHLDDDGLVELGSWVEAG------DVLVGKLTPQ
RPOB_HUPLU       RITLNG--PEILTREIPHLDDYFL--RHLDENGLVLPGSWVETG------DVIVGKLTPR
RPOB_CHAGL       KINHQG--QDKITKDIPHIDKYFL--RHLDENGLVTLGSWVEAG------DVLIGKLSSQ
RPOB_CHAVU       NMTSLG--PEKITKKIPHLSEYLL--RNLDVNGLILLGSWVKTG------DVLVGKLTPR
RPOB_STAPU       QENIEG--FDIITREIPHVDKYLL--RHLDYRGIIKIGAWVEPG------DVLVGKLAPL
RPOB_ZYGCR       RETNQA--IETITKQIPHLNAHVL--RHLDETGVVSLGAWVETG------DVLVGKLTAK
RPOB_NEPOL       QHTKLG--PEEITKSIVHETDDKLPYRWLDERGIVMRGAWVEPG------DVLIGKITPK
RPOB_OSTTA       ARLREG--QEYFTNQVDRN-------QYLDEFGVVKIGTWVEAG------DVLVGKISPQ
RPOB_MESVI       RKTKLG--PEKITREIPNVNDHLL--RNLDDNGIVIPGARVESG------DILVGKVTPK
RPOB_CHLAT       RKTKLG--PEKITREVPNLGDYVL--RNLDENGIVIPGAWVEAG------DILVGKVTPK
RPOB_OLTVI       RETKFG--LEQITSQIPDEGKLS----HLDHFGIAKPGTWVEEG------DILIGKVAPM
RPOB_BIGNA       KKNKEN--SEIITRDIKNISFLNK--KNLDKNGIIKIGSRVFSD------DILVGKLLPI
RPOB_PHATC       DRNSDT--LERTTKNIPNLNPREI--RHLNDDGIVTVGTFVRPG------DILVGKVISN
RPOB_THAPS       DRTAEM--SEQTTNNIPNLSISDV--QNLNEDGIVTIGTFVKPG------DILVGKIIPK
RPOB_TRIV2       RQTKLG--PEEITREIPNVGEDAL--RQLDEQGIIRIGAWVEAG------DILVGKVTPK
RPOB_TRIEI       RQTKLG--PEEITREIPNVGEDGL--RNLDEQGIIRVGAWVQSG------DILVGKVTPK
RPOB_SYNY3       RQTKLG--PEEITREIPNVGEDAL--RNLDEHGIIRIGAWVESG------DILVGKVTPK
RPOB_SYNE7       RQTKLG--PEEITREIPNVGEDAL--RQLDENGIIRVGAWVESG------DILVGKVTPK
RPOB_THEEB       RQTKLG--PEEITREVPNVSEEAL--RQLDENGIIRIGAFVEAG------DILVGKVTPK
RPOB_SYNJA       RQTKLG--PEEITREIPNVGEDAL--RNLDENGIVRIGAWVEAG------DILVGKVTPK
RPOB_GLOVI       RQTKLG--PEEITREIPNVGEDSL--RNLDERGIVRIGAWMEAG------DILVGKVTPK
RPOB_PROM5       RQTKLG--PEEITREIPNISEESL--NNLDEMGIIRTGAFVESG------DILVGKVTPK
RPOB_GUITH       RQTKLG--SEEITRELPNVGEAAL--RKLDENGIIVIGSWVEAG------DILIGKVTPK
RPOB_RHDSA       RQTKLG--SEEITRELPNIGEYSL--RKLDDNGIIVIGSWVEVG------DILVGKVTPK
RPOB_PYRYE       RQTKLG--PEEITREIPNVSDNSL--KDLDRNGIVVGGSWVEAG------DILVGKITPK
RPOB_GRATL       RQTKLG--SEEITRDIPNVSEASI--GLLDKNGIISIGSWVDAG------DILVGKVTPK
RPOB_CYAPA       RQTKLG--IEEITREIPNVNEYSL--RNLDEKGIVSVGSWIKGG------DILVGKVAPK
RPOB_CYACA       RQTKLG--PEEITRNIPNVGENSL--KQLDENGIVVVSSFVESG------SILVGKVTPK
RPOB_EMIHU       RQTKLG--AEEITRDLPNVNEKSL--SKLDENGIIHIGSWVEPG------DILVGKLTPK
RPOB_EUGLO       INHKEKK--EEITKNIPDIKLKNV--KNLNNNGIIKIGSKINGK------EILIGIIKKR
                          :    .:            :.  *:   .  :           : .     

RPOB_MYCGE       GQVE---VSPEEKLFKAIFPESVQNVRDSSLKVSHGGDG-IVSAVKRFSIAN--------
RPOB_MYCPN       GQVE---VSPEEKLFKAIFPESVQNVRDSSLKLPHGGDG-IVSCVKRFSIAN--------
RPOB_MYCGA       GQVE---LTPEEKLIQAILGDKVKQVRESSLKVPNGGDG-IVAGIKRFSIAN--------
RPOB_MYCPE       GQVE---LTSEEKLLQAIFGDKSKNHKETSLKVPHGGEG-TVAMVKRFKVED--------
RPOB_UREPA       GNVE---TAPEDRLLQTIFGDKSKTVKDSSLKVKHGQEG-IVAAVKRIKSSDE-------
RPOB_ALKEH       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVPTGMDG-KVIDVQVFTRDGVEKDSRAL
RPOB_HALHL       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVPTGMDG-TVIDVQVFTRDGVEKDERAR
RPOB_METCA       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVPSGMDG-TVIDVQVFTRDGVKKDERAR
RPOB_XANC8       GESQ---LTPEEKLLRAIFGEKASDVKDSSLRVPPGMDG-TVIDVQVFTRDGIEKDKRAR
RPOB_XYLFT       GESQ---LTPEEKLLRAIFGEKASDVKDSSLRVPPGMDG-TVIDVQVFTRDGIEKDKRAH
RPOB_LEGPA       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPSGMNG-TVIDVQVFTRDGLEKDARAK
RPOB_COXBU       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVTPGITG-TVIDVRIFTREGIKKDERTL
RPOB_NITOC       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVSSGMQG-TVIDVQVFTRDGVEKDTRAL
RPOB_AROAE       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVSSGMNG-TVIDVQVFTREGIERDKRAQ
RPOB_AZOSB       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVPSGMTG-TVIDVQVFTREGIERDKRAQ
RPOB_METFK       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVPSGMSG-TVIDVQVFTREGIERDARAQ
RPOB_NITEC       SETQ---LTPEEKLLRAIFGEKASDVKDTSLHVPAGISG-TVIDVQIFTREGVDRDKRSK
RPOB_NITMU       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVPSGISG-TVIDVQVFTREGIERDKRAQ
RPOB_THIDA       GETQ---LTPEEKLLRAIFGEKASDVKDTSLKVPSGMSG-VVIDVQVFTREGIERDKRAQ
RPOB_DECAR       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVPSGIAG-TVIDVQVFTREGIERDKRAQ
RPOB_PARXL       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVPSGMSG-TVIDVQVFTREGIQRDKRAQ
RPOB_HERAR       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVPSGMVG-TVIDVQVFTREGIPRDKRAQ
RPOB_RALSO       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVPSGMSG-TVIDVQVFTREGVTRDKRAQ
RPOB_BORA1       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVPSGMTG-TVIDVQVFTREGIVRDKRAQ
RPOB_RHOFT       GETT---LTPEEKLLRAIFGEKASDVKDTSLRVDQGSQG-TVIDVQVFTREGIVRDRRAQ
RPOB_POLSJ       GETT---LTPEEKLLRAIFGEKASDVKDTSLRVSQGSQG-TVIDVQVFTREGIVRDKRAQ
RPOB_VEREI       GETT---LTPEEKLLRAIFGEKASDVKDTSLRVEQGSQG-TVIDVQVFTREGIARDKRAQ
RPOB_METPP       GETT---LTPEEKLLRAIFGEKASDVKDTSLRVDQGTNG-TVIDVQVFTREGIQRDKRAQ
RPOB_NEIG1       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRMPTGMSG-TVIDVQVFTREGIQRDKRAQ
RPOB_CHRVO       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVPTGTVG-TVIDVQVFTREGIERDKRAQ
RPOB_ACIBT       GETQ---LTPEEKLLRAIFGEKAADVKDSSLRVPSGTKG-TVIDVQVFTRDGLEKDDRAL
RPOB_PSYCK       GETQ---LTPEEKLLRAIFGEKAADVKDTSLRVPTSSKG-TVIDVQVFTRDGVEKDARAR
RPOB_HAHCH       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVSTGMRG-TVIDVQVFTRDGVEKDQRAK
RPOB_MARHV       GETQ---LTPEEKLLRAIFGEKASDVKDTSQRVPTGTRG-TVIDVQVFTRDGIEKDARAL
RPOB_SACD2       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVPSSVKG-TVIDVQVFTRDGLEKDQRSR
RPOB_PSEU5       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVPTGTKG-TVIDVQVFIRDGVERDSRAL
RPOB_CHRSD       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRAPTGMKG-TVIDVQVFTRDGVEKDSRAL
RPOB_ALCBS       GETQ---LTPEEKLLRAIFGEKASDVKDTSQRVSSGVKG-TIIDVQVFTRDGVEKDERAR
RPOB_SODGM       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPNGVSG-TVIDVQVFTRDGVEKDKRAL
RPOB_ECOLI       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPNGVSG-TVIDVQVFTRDGVEKDKRAL
RPOB_BAUCH       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPNGYSG-TVIDVQIFTRDGVKKDKRTL
RPOB_BLOFL       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPNGICG-TVIDVQIFTRDGIKKDKRAL
RPOB_BLOPB       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPNGVCG-TVIDVQIFTRDGINKDKRSL
RPOB_BUCAI       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPNGVSG-TVIDVQIFTRDGVKKDKRAL
RPOB_BUCAP       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPNGVSG-TVIDVQIFTRDGVKKDKRAL
RPOB_BUCBP       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPNGVLG-TVIDVQIFTRDGVKKDKRAL
RPOB_WIGBR       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPNGVSG-TVIDVEIFTRDGVKKDKRAL
RPOB_BUCCC       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPNGTNG-TVIDVQIFTRDGVKKDKRTI
RPOB_ACTP2       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPNGTSG-TVIDVQVFTRDGVEKDKRAL
RPOB_MANSM       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPNSVSG-TVIDVQVFTRDGVEKDKRAL
RPOB_HAEI8       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPNGTSG-TVIDVQVFTRDGVEKDKRAL
RPOB_ALIF1       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPNSVSG-TIIDVQVFTRDGVEKDKRAL
RPOB_PHOPR       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPNSVSG-TIIDVQVFTRDGVEKDKRAL
RPOB_VIBCH       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVPNSVAG-TVIDVQVFTRDGVEKDKRAL
RPOB_AERS4       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPNGVYG-TVVDVQVFTRDGVEKDKRAK
RPOB_COLP3       GETQ---LTPEEKLLRAIFGEKAADVKDSSLRVPNSVKG-TIIDVQIFTRDGVEKDARAV
RPOB_PSEA6       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVPNSVRG-TVIDVQVFTRDGVEKDKRAL
RPOB_PSEHT       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPNSVTG-TVIDVQVFTRDGVEKDKRAL
RPOB_SHEAM       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPNSVTG-TVIDVQVFTRDGVEKDKRAI
RPOB_IDILO       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVPNGVNG-TVIDVQVFTRDGVEKDKRAV
RPOB_PSYIN       GETQ---LTPEEKLLRAIFGEKASDVKDSSLRVAASTYA-TVIDVQVFTRDGVEKDKRAL
RPOB_DICNV       GERS---QSPEEKLLRAIFGEKASDVKDSSLRVPTGMDG-TVVDVRVYTRDGIEKDERAK
RPOB_HYDCU       GETQ---LTPEEKLLRAIFGEKASDVKDTSLRVSKGVEG-TVIDVQVFTREGVKKDARAL
RPOB_VESOH       SETV---LSPEEKLLRAIFGEKANNVKDSSLRIGASKSG-VVIDVQVFTRDRVEKDIRAL
RPOB_FRATO       AEQQ---LTPEERLLRAIFNEKASNVVDSSLRMPSGTSG-TVINVQVFENDKGGKSKRAL
RPOB_RHIL3       GESP---MTPEEKLLRAIFGEKASDVRDTSMRMPPGTYG-TIVEVRVFNRHGVEKDERAM
RPOB_RHIME       GESP---MTPEEKLLRAIFGEKASDVRDTSMRMPPGTFG-TVVEVRVFNRHGVEKDERAM
RPOB_AGRFC       GESP---MTPEEKLLRAIFGEKASDVRDTSMRMPPGTFG-TIVEVRVFNRHGVEKDERAM
RPOB_RHILO       GESP---MTPEEKLLRAIFGEKASDVRDTSMRMPPGTFG-TVVEVRVFNRHGVEKDERAM
RPOB_CHESB       GESP---MTPEEKLLRAIFGEKASDVRDTSMRMPPGTYG-TVVEVRVFNRHGVEKDERAM
RPOB_BRUSU       GESP---MTPEEKLLRAIFGEKASDVRDTSMRMPPGTYG-TVVEVRVFNRHGVEKDERAM
RPOB_BARBK       GESP---MTPEEKLLRAIFGEKASDVRDTSMRMPPGTFG-TVVEVRVFNRHGVEKDERAM
RPOB_RHOPB       GESP---MTPEEKLLRAIFGEKASDVRDTSLRVPPGVQG-TIVEVRVFNRHGVDKDERAL
RPOB_GLUOX       GESP---MTPEEKLLRAIFGEKASDVRDTSLKLPPGTTG-TIVDVRVFSRRGVDKDERAM
RPOB_GRABC       GESP---MTPEEKLLRAIFGEKASDVRDTSLKLPPGTTG-TIVDVRVFSRRGVDKDERAM
RPOB_MAGSA       GESP---MTPEEKLLRAIFGEKASDVRDTSLRLPPGVSG-TIVEVRVFSRRGVEKDERAL
RPOB_RHORT       GESP---MTPEEKLLRAIFGEKASDVRDTSLRIPPGVTG-TVVEVRVFNRRGVEKDERAL
RPOB_CAUVC       GESP---MTPEEKLLRAIFGEKASDVRDTSLRLPPGVAG-TIVDVRVFNRHGVDKDERAL
RPOB_MARMM       GESP---MTPEEKLLRAIFGEKASDVRDTSLRMPSGATG-TVVEVRVFNRHGVDKDERAI
RPOB_HYPNA       GESP---MTPEEKLLRAIFGEKASDVRDTSLRVPPGDAG-TVVDVRIFNRHGIDKDQRAL
RPOB_RHOS1       GESP---MTPEEKLLRAIFGEKASDVRDTSLRLPPGAYG-TIVEVRVFNRHGVDKDERAL
RPOB_PARDP       GESP---MTPEEKLLRAIFGEKASDVRDTSLRLPPGAYG-TIVEVRVFNRHGVDKDERAL
RPOB_ROSDO       GESP---MTPEEKLLRAIFGEKASDVRDTSLRVKPGDFG-TVVEVRVFNRHGVEKDERAL
RPOB_JANSC       GESP---MTPEEKLLRAIFGEKASDVRDTSLRVKPGDYG-TIVEVRVFNRHGVEKDERAL
RPOB_NOVAD       GESP---MTPEEKLLRAIFGEKASDVRDTSLRLPPGVAG-TIVDVRVFNRHGIEIDDRTR
RPOB_ERYLH       GESP---MTPEEKLLRAIFGEKASDVRDTSLRLPPGVAG-TVVEVRVFNRHGIEVDDRTR
RPOB_SPHAL       GESP---MTPEEKLLRAIFGEKASDVRDTSLRLPPGVSG-TVVEVRVFNRHGIDKDERAI
RPOB_ZYMMO       GESP---MTPEEKLLRAIFGEKASDVRDTSLRLPPGVAG-TIVDVRVFNRHGVDKDERAM
RPOB_PELUB       GDSA---SGPEEKLLRSIFGEKAIDVTDTSLKMSRGSSG-TVVDVRVFNRHGIEKDERSI
RPOB_RICBR       SESP---ITPEEKLLRAIFGEKAFDVKDSSLHVPSGVSG-TVVEVRVFSRRGVEKDQRAI
RPOB_ORITB       SESP---VTPEEKLLRAIFGEKASEVKDSSLYVPPGITG-TVIDVRVFSRRGIDKDERTL
RPOB_ANAMM       PPVS---LPPETKLLVTIFGEKVFDCVDSSLYLPPDVEG-TVIDVHVFVRRGVEENDRSL
RPOB_ANAPZ       PPVS---LPPETKLLVTIFGEKVFDCVDSSLYLPPDVEG-TVIDVHVFVRRGVEENDRSL
RPOB_EHRRW       PPVS---LPPETKLLVTIFGEKVFDCVDSSLYLPIDVEG-TVVDVHVFVRRGVEENDRSL
RPOB_NEOSM       SSSP---VTPEEKLLRAIFGEKAIDVKDSSLYLPPGVSG-CVVDVKVLQRRGIEKVGRAL
RPOB_MAGMM       GETQ---LTPEEKLLRAIFGEKASDVRDTSLRLPPGVAG-TVVDVRVFSRRGLEKDDRAK
RPOB_ANADE       GETQ---LSPEEKLLRAIFGEKAGDVRDSSLRVPPGVSG-TVINAKVFSRKGVEKDERAK
RPOB_MYXXD       GETQ---LSPEEKLLRAIFGEKAGDVRDSSLRVPPGVVG-TVINAKVFSRKGVEKDERAK
RPOB_SYNFM       GESQ---LTPEEKLLRAIFGEKASDVKDTSLRVPPGVEG-IIIDAKVFSRKGVEKDERTK
RPOB_SYNAS       GETQ---LSSEEKLLRAIFGEKASDVRDTSLRVPPGVEG-TVIDAKVFTRKGAEKDHRSQ
RPOB_GEOSL       GETQ---LSPEEKLLRAIFGEKAGDVRDTSLRVPPGVEG-TVIGAKIFSRKGADKDSRTE
RPOB_PELPD       GETQ---LSPEEKLLRAIFGEKAGDVRDTSLTVPPGVEG-TVIGAKVFSRKGADKDTRTE
RPOB_PELCD       GETQ---LSPEEKLLRAIFGEKAGDVRDTSLRLPPGVEG-VVIGARVFSRKGSDKDSRTE
RPOB_BDEBA       GETQ---LSPEEKLLRAIFGEKAGDVRDTSLRAPSGVYG-TVIDAQVYSREGADRDERLS
RPOB_DESPS       GETV---LSPEEKLLRAIFGEKAQDVKDSSLRVPPGVTG-VVIDAKVFSRKGVDKDERSL
RPOB_DESVV       GETQ---LTPEEKLLRAIFGDKARDVKNTSLKVPPGIEG-TIIDVKVFNRRSGEKDERTR
RPOB_DESAG       GETQ---LTPEEKLLRAIFGEKARDVKNTSLKVPPGIEG-TVIDVKLFNRRSGEKDERTR
RPOB_LAWIP       GETQ---LTPEEKLLRAIFGDKARDVKNTSLKVPPGIEG-TVIDVKVFNRRSGEKDDRTR
RPOB_KORVE       GETQ---LTPEEKLLRAIFGEKAGDVRDASLTCPPGIEG-VVVDVKIFSRKGQEKDERAK
RPOB_SOLUE       GETQ---LTPEEKLLRAIFGEKAGDVKDASLYCPPGIEG-TIVDCKIFSRKGQEKDERSK
RPOB_CAMJJ       GEVK---PTPEERLLRAIFGEKAGHVVNKSLYATASLEG-VVVDVKIFTKKGYEKDDRAI
RPOB_CAMFF       GEVK---PTPEERLLRAIFGEKAGHVVNKSLYAGASLEG-VVIDVKIFTKKGYEKDARSF
RPOB_SULDN       GEVK---PTPEERLLRAIFGEKAGHVINKSLYCPPSMEG-VVVDVKIFTKKGYDKDARTL
RPOB_BACV8       GESD---PSPEEKLLRAIFGDKAGDVKDASLKASPSLRG-VVIDKKLFSRVIKSRSEKNA
RPOB_PARD8       GESD---PSPEEKLLRAIFGDKAGDVKDASLKATPSLRG-VVIETALFSKAVKKRKSRLT
RPOB_PORGI       GESD---PTPEEKLLRAIFGDKAGDVKDASLKATPSLRG-VVIDTKLFSKAAK-KKSRTS
RPOB_FLAPJ       GESD---PTPEEKLLRAIFGDKAGDVKDASLKASPSLHG-VVLDKKLFARAVKDKRKRTQ
RPOB_GRAFK       GESD---PTPEEKLLRAIFGDKAGDVKDASLKASPSLSG-VVINKKLFARAIKDKRKRAQ
RPOB_CYTH3       GESD---PTPEEKLLRAIFGDKAGDVKDASMKAPPSLRG-VVIDTKLFSRPKKDKDLRIK
RPOB_SALRD       GETD---PTPEEKLLRAIFGDKAGDVKDASLKAKPGMEGGVVIDTRLFSRRELDPASKKM
RPOB_PELLD       GESD---PTPEEKLLRAIFGDKSSDVKDASMHVPAGMKG-IVIKTKLFS---RKKKVGMD
RPOB_CHLPD       GESD---PTPEEKLLRAIFGDKSSDVKDASMHVPAGMKG-IVIKTKLFS---RKKKVGLD
RPOB_CHLCH       GESD---PTPEEKLLRAIFGDKSSDVKDASMHVPAGMKG-IIIKTKLFS---RKKKIGLD
RPOB_CHLTE       GESD---PTPEEKLLRAIFGDKSSDVKDASMHVPAGMKG-IVIKTKLFS---RKKKIGMD
RPOB_CHLMU       SETE---LAPEERLLRAIFGEKAADVKDASLTVPPGTEG-VVMDVKVFSRKDRLSKSDDE
RPOB_CHLPN       SETE---LAPEERLLRAIFGEKAADVKDASLTVPPGTEG-VVMDVKVFSRKDRLSKSDDE
RPOB_PARUW       SETE---LAPEERLLRAIFGDKASDVKDASLIAPPGTEG-VVMDVKVFSRRDRLSKTDDE
RPOB_RHOBA       SKTE---LTPEEKLLHAIFGRAGEDVKNDSLEVPSGIEG-IVIDTQKFSRRMSLGEDER-
RPOB_TREDE       SESD---TTPEFKLLNSIFGEKAKEVRDTSLRVPHGTEG-TVIDVQRLKRD---------
RPOB_TREPA       SESE---TTPEFRLLNSIFGEKAKEVRDSSLRVPHGVEG-TVIDVQRLRRS---------
RPOB_BORAP       SEGD---ITPEFRLLTSIFGEKAKDVKNNSLKVPHGTEG-TVIDVQRITKE---------
RPOB_LEPBL       GETD---LTPEYKLLHSIFGEKAKDVRDSSLRMPNGFEG-TVIDIKRFSRE---------
RPOB_FUSNN       GETE---PPAEEKLLRAIFGEKARDVRDTSLTMPHGSKG-VVVDILELSRE---------
RPOB_CYAM1       GESD---QPPEGKLLRAIFGEKNQHVKDSSLRMPNGSRG-RVIHVRILSRD---------
RPOB_AQUAE       GETR---LTPEEKLLQAIFGEKTRDVKDASLRCPPGVEG-IVIDVQVFTRKGTGKKDMLA
RPOB_DEIRA       GESE---PTPEERLLRSIFGEKAREVKDTSLRVQSGQGG-IVVKTVRFRRG---------
RPOB_DEIGD       GESE---PTPEERLLRSIFGEKAREVKDTSLRVQSGQGG-IVVKTVRFRRG---------
RPOB_THET8       GESE---PTPEERLLRSIFGEKARDVKDTSLRVPPGEGG-IVVRTVRLRRG---------
RPOB_THEMA       GEGD---TTPEEKIIRSVFGERGRDVKDTSLRLPHGVEG-RVIRVDVYDQN---------
RPOB_BACCR       GVTE---LTAEERLLHAIFGEKAREVRDTSLRVPHGGGG-IILDVKVFNR----------
RPOB_BACSU       GVTE---LTAEERLLHAIFGEKAREVRDTSLRVPHGGGG-IIHDVKVFNR----------
RPOB_BACHD       GVTE---LTAEERLLHAIFGEKAREVRDTSLRAPHGGDG-IVLDVKIFNR----------
RPOB_GEOTN       GMTE---LTAEERLLHAIFGEKAREVRDTSLRVPHGGGG-IVLDVKVFNR----------
RPOB_OCEIH       GVTE---LSAEERLLHAIFGEKAREVRDTSLRVPHGGGG-IVLDVKIFNR----------
RPOB_LISIN       GVTE---LTAEERLLHAIFGEKAREVRDTSLRVPHGGGG-IVLDVKIFTR----------
RPOB_STAS1       GVTE---LTAEERLLHAIFGEKAREVRDTSLRVPHGAGG-IVLDVKVFNR----------
RPOB_STRS2       GEKD---LSAEERLLHAIFGDKSREVRDTSLRVPHGADG-VVRDVKIFTR----------
RPOB_LACLA       GETD---PTPEERLLRAIFGEKAREVRDTSLRVPHGGGG-IVHDVRVFTR----------
RPOB_LACGA       GVTE---LSAEERLLHAIFGEKAREVRDTSLRVPHGGGG-IVQNVQVFTR----------
RPOB_LACAC       GVTE---LSAEERLLHAIFGEKAREVRDTSLRVPHGGGG-IVQDVKVYTR----------
RPOB_LACDB       GITE---LSAEERLLHAIFGEKAREVRDTSLRVPHGGGG-VVQDVQVFTR----------
RPOB_LACPL       GVTE---LSAEERLLHAIFGEKAREVRDTSLRVPHGGGG-IIQDVKIFTR----------
RPOB_LACBA       GVTE---LSAEERLLHAIFGEKAREVRDTSLKVPHGGGG-IIQDVKIFTR----------
RPOB_PEDPA       GVTE---LSAEERLLHAIFGEKAREVRDTSLRVPHGGGG-IVQDVKIFTR----------
RPOB_LACS1       GVTE---LSAEERLLHAIFGEKAREVRDTSLRVPHGAGG-IVQDVKIFTR----------
RPOB_LACSS       GVTE---LSAEERLLHAIFGEKAREVRDTSLKVPHGGGG-IIQDVKIFTR----------
RPOB_LACP3       GVTE---LSAEERLLHAIFGEKAREVRDTSLRVPHGGGG-IIQDVKIFTR----------
RPOB_ENTFA       GVTE---LSAEERLLHAIFGEKAREVRDTSLRVPHGGGG-IVHDVKIFTR----------
RPOB_LEUMM       GVTE---LSAEERLLHAIFGEKAREVRDTSLRVPHGGGG-VVQNVRIYTP----------
RPOB_OENOB       GVTE---LSAEERLLHAIFGEKAREVRDTSLRVPHGGGG-IIQDVEIFTR----------
RPOB_CARHZ       GETE---LTAEERLLRAIFGEKAREVRDTSLRVPHGESG-KVVDVKVFSR----------
RPOB_MOOTA       GETE---LTAEERLLRAIFGEKAREVRDTSLRVPHGESG-IVVDVKVFSR----------
RPOB_SYMTH       GETE---LTAEERLLRAIFGEKAREVRDTSLRVPHGESG-IVVDVKVFTR----------
RPOB_DESHY       GETE---LTAEERLLRAIFGEKAREVRDTSLRVPHGEAG-KIVDVKVFTR----------
RPOB_CLOAB       GETE---LTAEERLLRAIFGEKAREVRDTSLRVPHGEAG-IIVDVKIFTR----------
RPOB_CLONN       GETE---LTAEERLLRAIFGEKAREVRDTSLRVPHGEAG-IIVDVKVFTR----------
RPOB_CLOPS       GETE---LTAEERLLRAIFGEKAREVRDTSLRVPHGEAG-IIVDVKVFTR----------
RPOB_CLOTE       GETE---LTAEERLLRAIFGEKAREVRDTSLRVPHGEAG-IIVDVKVFTR----------
RPOB_HUNT2       GETE---LTAEERLLRAIFGEKAREVRDTSLRVPHGESG-IVVDVKIFTR----------
RPOB_CLOD6       GETE---LTAEERLLRAIFGEKAREVRDTSLKVPHGESG-IIVDVKVFTR----------
RPOB_CALS4       GETE---LTAEERLLRAIFGEKAREVRDTSLRVPHGESG-IVVDVKVYSR----------
RPOB_SYNWW       GETE---LTPEERLLRAIFGEKAREVRDSSLRVPHGEAG-KVVAVKRFSR----------
RPOB_ONYPE       GNIE---PSPSEKLIQIVIGEKAREYKDSSLRVPFGEGG-IVQSVHYFSR----------
RPOB_COREF       GETE---LTPEERLLRAIFGEKAREVRDTSMKVPHGETG-KVIGVRRFSR----------
RPOB_CORDI       GETE---LTPEERLLRAIFGEKAREVRDTSMKVPHGETG-KVIGVRRFSR----------
RPOB_CORJK       GETE---LTPEERLLRAIFGEKAREVRDTSMKVPHGETG-KVIGVRVFSR----------
RPOB2_NOCFA      GETE---LTPEERLLRAIFGEKAREVRDTSLKVPHGESG-KVIGIRVFSR----------
RPOB_RHOJR       GETE---LTPEERLLRAIFGEKAREVRDTSLKVPHGETG-KVIGIRVFSR----------
RPOB_MYCS2       GETE---LTPEERLLRAIFGEKAREVRDTSLKVPHGESG-KVIGIRVFSR----------
RPOB1_NOCFA      GETE---LTPEERLLRAIFGEKAREVRDTSLKVPHGESG-KVIGIRVFSR----------
RPOB_SACEN       GETE---LTPEERLLRAIFGEKAREVRDTSLKVPHGETG-KVIGVRVFNR----------
RPOB_FRAAA       GETE---LTPEERLLRAIFGEKAREVRDTSLKVPHGESG-KVIGVRVFSR----------
RPOB_STRCO       GETE---LTPEERLLRAIFGEKAREVRDTSLKVPHGEIG-KVIGVRVFDR----------
RPOB_THEFY       GETE---LTPEERLLRAIFGEKAREVRDTSLKVPHGESG-KVIGVRVFSR----------
RPOB_ACIC1       GETE---LTPEERLLRAIFGEKAREVRDTSLKVPHGESG-KVIDVKVFTR----------
RPOB_NOCSJ       GETE---LTPEERLLRAIFGEKAREVRDTSMKVPHGESG-TVIGVRVFDR----------
RPOB_ARTS2       GETE---LTPEERLLRAIFGEKSREVRDTSLKVPHGESG-TVIGVRVFDR----------
RPOB_LEIXX       GETE---LSAEERLLRAIFNEKSREVRDTSLKVPHGEEG-TIIGVKVFDAQ---------
RPOB_CUTAK       GETE---LTPEERLLRAIFGEKAREVRDTSLKVPHGEEG-TVIGVRIFDT----------
RPOB_BIFAA       GETE---LTPEERLLRAIFGEKSREVRDTSLRVPHGETG-TVIAVKEITREDA-------
RPOB_TROWT       GETE---LSAEERLLRAIFNEKSMEVRDTSLKVPHGQQG-TVIDVKLFDAV---------
RPOB_RUBXD       GESE---PTPEEKLLRAIFGEKAREVKDSSLKVPHGEGG-VVIDVKRFSR----------
RPOB_DEHMC       GETE---LSAEEKLLRAIFGEKAREVKDTSLRMPHGEWG-KVINVRIFSR----------
RPOB_MYCMS       GQVQ---LSPEDKLLHAIFGEKSRNVKDNSLRVPNGGEG-IVQSIKRFKAKSALNPDGIE
RPOB_MESFL       GQTQ---LSPEDKLLHAIFGEKSRSVKDNSLKVPNGGEG-IVQSVKRFKAKSAANPDGID
RPOB_MYCMO       GEEN---PSPEEKLLAAIFQKKPSTDKDTSLKVKHGHAG-TVLDVQVLSRASGDV-----
RPOB_MYCPU       GDEN---ISPAEKLLNGIFNQKISNEKDTSLKVKNGHQG-TVIDVEILSRENGNV-----
RPOB_MYCS5       GEEN---PSQEEKLLNAIFNQRPQNYKDTSLKVKNGHNG-TVIHVEVLSRENGDI-----
RPOB_MYCH2       GEDN---PTAEEKLMAAIWGKKALAQKDTSLRVKNGEGG-TVIDVQILSRDQGDN-----
RPOB_CITSI       AAKE-SSYAPEDRLLRAILGIQVSTSKETCLKLPIGGRG-RVIDVRWVQK----------
RPOB_POPTR       LAKE-SSYAPEDRLLRAILGIQVSTSKETCLKLPTGGRG-RVIDVRWIQK----------
RPOB_AETGR       VAKE-SSYAPEDRLLRAILGIQVSTSKETCLKLPIGGRG-RVIDVGWVQK----------
RPOB_OENEH       MAEEESSYAPEERLLRAILGIQISTSKETCLKLPIGGRG-RVIDVRWIQK----------
RPOB_NYMAL       TAKE-SSYAPEDRLLRAILGIQVSTAKETCLKLPIGGRG-RVIDVRWGQK----------
RPOB_PIPCE       TAKE-SSYAPEDRLLRAILGIQVSTSKETCLKLPIGGRG-RVIDVRWIQK----------
RPOB_PHAAO       TASE-SSYAPEDRLLRAILGIQVSTSKETSLRLPIGGRG-RVIDVRWIHR----------
RPOB_DIOEL       TATE-SSYAPEDRLLRAILGIQVSTAKETSLKLSIGGRG-RVIDVRWIQK----------
RPOB_PHAVU       MAKE-SSYSPEDRLLRAILGIQVSTSKETCLKLPIGGRG-RVIDVRWIQK----------
RPOB_LOTJA       MAKE-SSYAPEDRLLRAILGIQVSTSKETCLKLPIGGRG-RVIDVRWLHK----------
RPOB_JASNU       VVKE----SPANRLVYDIVGIQVSTSKDTCLKLPIGGRG-RVIDVRWIQK----------
RPOB_LACSA       MVKE-SSYAPEDRLLRTILGMRVYTSKETCLKLPIGGRG-RVIDVRWVQSS---------
RPOB_SACHY       IASE-SSYIAEAGLLRAIFGLEVSTSKETSLKLPIGGRG-RVIDVKWIQR----------
RPOB_PELHO       LVEL----SPEKRLIEALFDAPIGTTRQSCLKLPIWGRG-RVIDVRWIHK----------
RPOB_ANTAG       ET-EESLRAPEGKLLQAIFGIQVVTAKETCLKVPLGGRG-RVIDIKWIYQ----------
RPOB_MARPO       ET-EENLRAPEGKLLQAIFGIQVATSKETCLKVPPGGRG-RVIDIRLISQ----------
RPOB_PHYPA       ET-EESLRAPEGKLLQAIFGIQVTNAKETCLKVPLNGKG-RVIDVIWISK----------
RPOB_PSINU       E---DSLRAPEGKLLQAIFGIQVADTKESCLKVPIGGQG-RVIDARWVYK----------
RPOB_ANGEV       EA-ENSLRVPEGKLLQAISGIQLANTRESCLKVPIGGRG-RVIDVRWIYD----------
RPOB_PINTH       TI-EESLCTPEGRLLQTIFGIEVSTARENCLRAPIGGRG-RVIDVRWINR----------
RPOB_CYCTA       PA-EESLRAPEGRLLQAIFGIQVSSARESCLRVPIGGRG-RVIDVRWIHK----------
RPOB_ADICA       EGAS-SSRVPEGRLLQAIFGIQLVNARESCLRVPIGGRG-RVIDVRWVYP----------
RPOB_HUPLU       DPEE-SLKIPEGNLLQAIFGIDITATRETCLKVPPGGKG-QVIDVRSVYP----------
RPOB_CHAGL       ERED-SLKVPEGKLLQAIFGLQIGNSRDTSLKLPAGGEG-RVIDIQWIFQ----------
RPOB_CHAVU       EPGE-SLRLPEGRLLHAIFGIKASSFFETCLKVAPGAEG-RVIDVRWVESA---------
RPOB_STAPU       EAPH-LLRSPEGKLLQAIFGVQAITTRESCLKLPAGGTG-RVIDVRWIEQ----------
RPOB_ZYGCR       QSEG-LLHTPESKLLQDILGVQAFGTQDTCLKVPTRGEG-RVIDVRWITR----------
RPOB_NEPOL       EEKE---LTPELRLVYAIFGKRPKGFRDTSLRVPQGVRG-RVVDVRM-------------
RPOB_OSTTA       PDSD---NDPESRLLRAIFGGVARNTKTTSYCLSSGVSG-RILDVRCEFKRQT-------
RPOB_MESVI       EDLD---QHPEGKLLRAIFGEKARDVRDSSLRVPNGVSG-TVVNVRRLTGKE--------
RPOB_CHLAT       EDLD---QHPEGKLLRAIFSEKARDVRDTSLRVPNGVRG-RVVDVRRLKGSE--------
RPOB_OLTVI       PQKN---LSRYEKLLYDVVGKKISTTRDTSLRVPRGVSG-RVIHVEILNAEN--------
RPOB_BIGNA       ETRI---LSPYRKLLYEILQKQNDHYRNTSLRVPKYKRG-RITFVDYIKDKGK-------
RPOB_PHATC       NTSE---QLPESKLLRAIFGAKAKGVKDNSYRMSDGEYG-RVIETVTFNRRT--------
RPOB_THAPS       DDSE---QLPESKLLRAIFGAKAKGVRDTSFRMPEGEYG-RVIETLTFNRRT--------
RPOB_TRIV2       GESD---QPPEEKLLRAIFGEKARDVRDNSLRVPNGEKG-RVVDVRLFTREQG-------
RPOB_TRIEI       GESD---QPPEEKLLRAIFGEKARDVRDNSLRVPNGEKG-RIVDVRVFTREKG-------
RPOB_SYNY3       GEAD---QPPEEKLLRAIFGEKARDVRDNSLRVPNGEKG-RVVDVRVFTREKG-------
RPOB_SYNE7       GESD---QPPEEKLLRAIFGEKARDVRDNSLRVPNGEKG-RVVDVRLFTREQG-------
RPOB_THEEB       GESD---QPPEEKLLRAIFGEKARDVRDNSLRVPNGEKG-RVVDVRVFTREQG-------
RPOB_SYNJA       GESD---QPPEERLLRAIFGEKARDVRDNSLRVPNGERG-RVVDVRIFTREQG-------
RPOB_GLOVI       GESD---QPPEEKLLRAIFGEKARDVRDNSLRVPNGEKG-RVVDVRVFTREQG-------
RPOB_PROM5       GESD---QPPEEKLLRAIFGEKARDVRDNSLRVPKTEKG-RVLDVRIYTREQG-------
RPOB_GUITH       GESD---QPPEGKLLRAIFGEKARDVRDTSLRVPNGGRG-RILDVRIFTREKG-------
RPOB_RHDSA       GESD---QPPEGKLLRAIFGEKARDVRDTSLRVPNGGRG-RVLDVRIFTREKG-------
RPOB_PYRYE       GEAD---QLPEGKLLRAIFGEKARDVRDTSLRLPNAAKG-RVVKVRVFTRQKG-------
RPOB_GRATL       GESD---QLPEGKLLRAIFGEKARDVRDTSLRLPNATKG-RVVNVKIFKRQKG-------
RPOB_CYAPA       AESD---QPPEGKLLKAIFGEKNRDVRDTSLRMPSGEKG-RIVDVRIFIREFG-------
RPOB_CYACA       GESD---QPPESKLLQAIFGEKNKDVKDTSLRLPNGTRG-RVVDVRIFSREKG-------
RPOB_EMIHU       GESD---YLPEGKLLRAIFGEKSRDVRNTSLKLHHGVNG-RVLDVKIFSRANQ-------
RPOB_EUGLO       LINY------EVELIYEILSEYER--KNISVLSPKNLVG-IVTNTKIHKIK---------
                              :.  :           .        .  :                  

RPOB_MYCGE       ------------------------------------------------------------
RPOB_MYCPN       ------------------------------------------------------------
RPOB_MYCGA       ------------------------------------------------------------
RPOB_MYCPE       ------------------------------------------------------------
RPOB_UREPA       ------------------------------------------------------------
RPOB_ALKEH       -AIEQAELAAIRKDLRDQERIFEDDAFSRLERALVGQVAEGGP-SGLARGAEVTAD----
RPOB_HALHL       -AIEREEIARVRKDLDDEARIFEDDAYARLEKLLVGKVAEGGP-KGLGSGAEVTEA----
RPOB_METCA       -QIEEAEIERVRKDLNDQLRIIEKDFYQRAEQMVLGKVADMGP-GGLKRGATITRE----
RPOB_XANC8       -QIEESEIKRVKKDFDDQFRILEAAIYARLRSQIVGKVANGGP-N-LKKGDNVTDA----
RPOB_XYLFT       -QIEEYEIKRVKKDFDDQFRILEGAIYARLRSQIVGKVVNSGV-D-IKKGEVITDP----
RPOB_LEGPA       -SIEEEHLARVRKDLIDERRIREEDIYHRVSHLLLDKVATGGP-GSLKPGSKITQD----
RPOB_COXBU       -EIEKAELSKVEKDLNDELRVREDALFENLEKLLTGRVAAGGP-NKLAKGTKITKS----
RPOB_NITOC       -EIEEMELAKIKKDLRDEFRIVETDIYQRLEKVLVGKTVEGGP-AELKAGTQITQN----
RPOB_AROAE       -SIIDDMLRSFKTDLADQMRIVERDAFARIRRLIVGQKANGGP-KKLLKGTAITGE----
RPOB_AZOSB       -SIIDDQLRSFKTDLADQMRIVERDAFARIQRMIVGQKANGGP-KKLAKGAAITAE----
RPOB_METFK       -QIIDDQLADYKQDLADQMRIVEDDAFGRIRRLIEGKVATGGP-QKLKKGETVTAE----
RPOB_NITEC       -QIIADELGRFKKDLADQMRIVEADAFQRAKRLLAGKVAAGGP-KKLAKNSTITQE----
RPOB_NITMU       -QIIDDELKRYKKDLADQMRIVEADAFVRIERLLIGKIATGGP-KKLAKGATLTKE----
RPOB_THIDA       -SIIDTQLAEYKKDLTDRMRIVEDDTFARLEKLLHLKVVNGGP-KKLAKGSKISKE----
RPOB_DECAR       -AIIDEHLRHYKLDLADQMRIVERDAFARVERLITGKKANGGP-KKLAKGTVIDKV----
RPOB_PARXL       -QIIDDELKRYRLDLNDQLRIVEGDAFQRLARMLTGKVANGGP-KKLAKGTKIEQA----
RPOB_HERAR       -QIIDDELQRYRLDLNDQLRIVEGDAFQRLEKMLVGKVVNGGP-KKIAKGTKITAE----
RPOB_RALSO       -SIIDEELKRYRLDLNDQLRIVEGDAFQRLERLLVGKVVNGGP-KKLAKGTALTKE----
RPOB_BORA1       -SIIDDELRRYRQDLNDQLRIVENDQFDRIEKLLVGKTVNGGP-RKLAKGATVTKA----
RPOB_RHOFT       -QIIDDELKRFRLDLNDQLRLVEADSFDRIEKLLVGKVANGGP-QKLAKGTTIDKA----
RPOB_POLSJ       -QIIDDELKRFRLDLNDQLRIVEADAFDRIEKLLNGKVANGGP-KKLAKGTKIDKA----
RPOB_VEREI       -QIIDDELKRFRLDLNDQLRIVEADAFERIEKLLLGRVANGGP-HKLLKGAKIDKP----
RPOB_METPP       -QIIDDELKRFRLDLNDQLRIVEADAFDRIEKLLAGKTANGGP-NKLAKGTPIDKA----
RPOB_NEIG1       -SIIDSELKRYRLDLNDQLRIFDNDAFDRIERMIVGQKANGGP-MKLTKGSEITTE----
RPOB_CHRVO       -SIIDAELKRYRLDLNDQLRIFDNDAFSRIERLIVGKAANGGP-KRLAKGTVIDQE----
RPOB_ACIBT       -AIEKAQLDSYRKDLKEEYKIFEEAARERVIRLLKGQESN-GG-GSTKRGDKLSED----
RPOB_PSYCK       -AIEKSQLDSYRKDLKEELRIFEEAARGRIGNLLDGQKVS-GG-SGLKAGTVMALA----
RPOB_HAHCH       -EIEQTELNKFRKDLNDEYKIVEGATFERLRSALLGQSVI-GG-PGLKKGDTLTEV----
RPOB_MARHV       -SIEKEQLDKYRKDLKDEYRIVEGATFERLMAALKGQEVI-SG-PGLKKGAKLEEA----
RPOB_SACD2       -DIEKAQLDQIRKDLNEEYRIVQGATFERLRAALVGNTAM-TG-KGVVKGQPVTDE----
RPOB_PSEU5       -AIEKMQLDEIRKDLNEEFRIVEGATFERLRSALVGATAE-GG-AGLKKGVVITDE----
RPOB_CHRSD       -SIEQSQLDEVRKDLQETYRIAEEATFERLKRALIGQPVN-GG-PKLKKGDTLDEA----
RPOB_ALCBS       -QIEQAALEQFRKDLKDEYRILELDILERLRAVMVGKKVN-GG-AGFKRGTEMTGE----
RPOB_SODGM       -EIEEMQLKQAKKDLTEELQIFEAGLFARIRDVLISG--------------GIEAE----
RPOB_ECOLI       -EIEEMQLKQAKKDLSEELQILEAGLFSRIRAVLVAG--------------GVEAE----
RPOB_BAUCH       -EIEEMQLQQAKKDLTEERRIFEAALFTRIRHVLGSDIT------------NIDIV----
RPOB_BLOFL       -NIELTKLNQIKKDLGEELKIFESALFDRVYALLISS--------------GVKKE----
RPOB_BLOPB       -IIESEKLKQVKKDLSEELQIFESALFDRVCDVLMTS--------------GIDKK----
RPOB_BUCAI       -EIEDMQLKKIKQDLTEEFKIFESSLFTHIKKTFISL--------------DIETK----
RPOB_BUCAP       -EIENMQLKKAKKDLTEEFKIFELSLFSRIKKTLVSF--------------NIKED----
RPOB_BUCBP       -EIEEMQLKQAKKDLTEEQKVFELGLFTQIKSTLINS--------------GMNID----
RPOB_WIGBR       -EIEYMQIKEAKKDIYEELEIFKSSLKIQIEYFLKEN--------------NIEYD----
RPOB_BUCCC       -EIEEMLLKKAKKDLTEELKIFELNIINRINKILLTL--------------KTKIN----
RPOB_ACTP2       -EIEEMQLKEAKKDLTEELEILEAGLFTRVRNLLIEG--------------GVSEA----
RPOB_MANSM       -EIEEMQLKEAKKDIAEELEILEAGLFSRVRNLLIDG--------------GVDAK----
RPOB_HAEI8       -EIEEMQLREAKKDLTEELEILEAGLFARVRNLLISS--------------GADAA----
RPOB_ALIF1       -EIEQMQLKEAKKDITEEFQILEGGLLARVRTLLVAAGVSEVK-----------------
RPOB_PHOPR       -EIEEMQLKEAKKDITEEFQILEGGLLARVRTLLLSI--------------GYSEE----
RPOB_VIBCH       -EIEQMQLKEAKKDLTEEFQILEGGLLARVRSVLLAG--------------GYTEA----
RPOB_AERS4       -EIEEMQLKEAKKDLTEEFKILEDGIFGRSRNLLLAA--------------GYSED----
RPOB_COLP3       -EIEQMQLKEVKKDLGDELSILEDGIYARTKKLLLSA--------------GLNES----
RPOB_PSEA6       -EIEGMQLRQVKKDLSDEFNILADGIFARAKNLLIKS--------------GIEES----
RPOB_PSEHT       -EVEEMQLRDAKKDFNEEFRILEAGVLDRARKLLIAA--------------GFDED----
RPOB_SHEAM       -EIEEMHIAQARKDLSEEFKILEEGVLSRARNLLLAG--------------GYTQA----
RPOB_IDILO       -AIEEMQLAKVKKDLTEEFKILEEGIYNRARNLLLSN--------------GFDEA----
RPOB_PSYIN       -EIEEMQLKAAKKDLTEKFKILENAIYEKALAILVGA--------------GQDEA----
RPOB_DICNV       -AIEKMEIDSIAKDIKDQLRIFSADIHDRAARLLLGQAIKKAP-KR-KSGDTVDQA----
RPOB_HYDCU       -AIQEDELQKVRKDIDEQYKILEEDTIDRIQPMLIGQKLVD--------GTEITAD----
RPOB_VESOH       -SIDAERLERIKKDIDDEFSIIDGDIFRRIRLKLLGNVLSKAI-GDIRIGERLSIK----
RPOB_FRATO       -KIEKELIDKARKDFDEEFAVIESVVKSSIEQEVVGAKIQ-KA-KGLKKGAILTKE----
RPOB_RHIL3       -AIEREEIERLAKDRDDEQAILDRNVYGRLIEMLRGQASIAGP-KGFKKGSELSNA----
RPOB_RHIME       -AIEREEIERLAKDRDDEQAILDRNVYARLVDMLRGHVAVAGP-KGFKKGTELSNV----
RPOB_AGRFC       -AIEREEIERLAKDRDDEQAILDRNVYGRLIDMLRGHVSIAGP-KGFKKGVELSNA----
RPOB_RHILO       -AIEREEIERLAKDRDDEQAILDRNVYARLSDVLVGKEAIAGP-KGFKKGSTLSKD----
RPOB_CHESB       -AIEREEIERLAKDRDDEQSILDRNVYARLSEMLIGKEAIAGP-KGFKKGGALTKE----
RPOB_BRUSU       -AIEREEIERLAKDRDDEQAILDRNVYGRLADMIDGKVAAAGP-KGFKKGTTITRE----
RPOB_BARBK       -EIEREEIERLAKDRDDEQSILDRNVYARLAGMLKDKSAIRGP-KGFEKGQKIDST----
RPOB_RHOPB       -AIEREEIERLAKDRDDEQAILDRNVYGRLADLLENRQGIAGP-KGFKKDTKITRA----
RPOB_GLUOX       -AIERAEIERLTKDRDDERGIQERSFYNRLRERLIGQTAGAGF-KGIRSGTPITEE----
RPOB_GRABC       -AIERAEIERLAKDRDDERGIQERAFLNRLREKLMGHPASGGF-KGIKAGTIITDE----
RPOB_MAGSA       -AIERAEIERLAKDRDDERHILERSFFARLKALIIGKKVVSGP-KGIKAGTVLADA----
RPOB_RHORT       -AIERQEIESLAKDRDDERAILEGSFARRLKELLIGQKVVGGP-RGMATGGVISED----
RPOB_CAUVC       -AIERAEIDRLGKDRDDEFAILNRNISGRLKELLIGKVALSGP-KGLSRG-EITAE----
RPOB_MARMM       -SIEREEIERLGKDRDDELAILERNIYQRLGDLLLGKTAVSGP-RGFAKG-KVSQD----
RPOB_HYPNA       -QIEREQIEKLQEDKEDEQSILERNTYSRLRDILIGKDAATGP-KGFKAG-KIAEA----
RPOB_RHOS1       -QIEREEVERLARDRDDELAILERNIYSRLRTLIMGKTAVKGP-KGIRAGSEINED----
RPOB_PARDP       -QIEREEVERLARDRDDELAILERNIYARLKSLIMGKEVVKGP-KGIRAGAVVDED----
RPOB_ROSDO       -QIEREEVERLARDRDDEMAILDRNIYARLKSTILGKVAVKGP-KGVSANAEITED----
RPOB_JANSC       -QIEREEVERLARDRDDELVILERNIYARLRGMIMGKTAVKGP-KGVKPNTVIDED----
RPOB_NOVAD       -AIQNEEIERLAKDREDERAILNRATFNRLKDMLLGQVAAAAP-KGIKKGVEIDEQ----
RPOB_ERYLH       -AIQQEEIERLRKDSQDERTILNRATYNRLRDMLLGQTASAAP-KGVKKGVKIDEA----
RPOB_SPHAL       -AIEREEIERLKQDADDERAILNRATFSSLKDLLVGQATSAVP-KGLKKGDIVTEE----
RPOB_ZYMMO       -AIEREEIERLTKDREDERAILNRATYAQLQEKLLGQTVAAAPYKHIVKGARIDIE----
RPOB_PELUB       -TIERAEIDTVQQDKIVEEEILERSIKQRANQILSGASLTKKI-KDLDEGTKLDLE----
RPOB_RICBR       -AIEKQQIEKLAKDRDDELEIIEHFVFSWLEKLLVGQVSINGP-KTVKTGQTITSE----
RPOB_ORITB       -AIEKQKIRKLVKDYEDELAVIQHFTIVRVKELLVGQVAACSL-DSIIIGDKLDEA----
RPOB_ANAMM       -LIKQSEISSFVKERDYEIDVVSEYFHDELRKLLRNA-------GVKVKGYSDLDS----
RPOB_ANAPZ       -LIKQSEVNSFRKERDYEIDVVSEYFYDELKKLLCSA-------DLPLNGHADVES----
RPOB_EHRRW       -LIKQNEINGFIKERDYEIDVVSEYFYDELKRVLVNT-------NTEYN-NQNIED----
RPOB_NEOSM       -LIEKQAIDAEKTRRDHELAVLTNYIYSLLKEMLVGKVALSTL-APISKGDLITEE----
RPOB_MAGMM       -LIDQDEIALLRKDMAAERRIIERDADERIRNLMNGKPVRSAP--GLQPGDHISQS----
RPOB_ANADE       -AIEEMEEAKLLKDQNDEIRIIQDSAFQKIRRLLLGKEVTARLVDDKG-EQLLKKGDV--
RPOB_MYXXD       -QIESMEEAKLLKDQNDEIKVLQDSAFGRIRGLVRTKEVQGKLVDDKG-KILLKKGDI--
RPOB_SYNFM       -TIEDQEISRLMKDQRDELEIIFKSTVKRLAKLLENQVSDSAIKDGK--KVYIKKGEV--
RPOB_SYNAS       -YIEDEAIAMLQKDREDEIRIITEAVKKEVGTLLQGKQSGAKIVDPKRKKIYLKKGDI--
RPOB_GEOSL       -MIERMEEDKLRKDEQDEIRIIRNSAVGKLKKLLVGKSAAVKVEDKSG-RTVIAKGAA--
RPOB_PELPD       -LIEKAEEEKLRKDEQDEIRIIRQSAEGKLHRLLIGKSLSVKLEDGEG-NLILAKGKE--
RPOB_PELCD       -YIEKTEIEKLLKDQHDEIRIIRESTHGKLESLLVGQTSASALFDAAG-KELLGQGEK--
RPOB_BDEBA       -LIIEEKKRKLEKDLAVEQNVIKNNAISKLRDILVGKITTGVLLNEDGSQKLLNKGQE--
RPOB_DESPS       -MIEDLEIERLEGDKRDELRSLKNGVCRELGELIAGNTALGDILDSKG-ELLISSGDK--
RPOB_DESVV       -NIEDYETARIDKKEQDHVRALGDALRDRLADTLVGKQIAVTLPGKRKGEVLAEAGAP--
RPOB_DESAG       -NIEDYELARLDQKEKDHIRALTETTREKLAPVVVGKQLAYGLAGQKKGEVIAEAGQT--
RPOB_LAWIP       -LIEDYEISLMDSKEQNYIKSITQRMKEKILPLINGKQLGTTILGKGKGEVLAEENSA--
RPOB_KORVE       -QIEGTQIAKLEKNLADEIRILTDERLKRLEGLLGAKVVQADLHDERTNKRLLTKDAV--
RPOB_SOLUE       -AIEESQIQRLQRNLQDEIRILTDERAKRLGTLLDGKKLLADLHDEKTNKRLLSKDTE--
RPOB_CAMJJ       -KSYDKEKMALEKEHHDRLLMMDREEMLRVCALLSKAPLNSDQKIGDKNYKKGQTAD---
RPOB_CAMFF       -KAYEDEKNILEKEHHDRLLMLDREEMLRVTALLSKNPLESELEIGKNSYKKGDKIK---
RPOB_SULDN       -ELEKEERDYLEREHYDRLLMIDKEEMLRVTKLLTKEPLINDIKIGNTSYKAGDIIN---
RPOB_BACV8       ---DKAILPKLNDEFEEKAAKLKDILIEKLLVLTNGKVSQGVK--DYLGTEVIAKGA--K
RPOB_PARD8       ---DKAILPKLDEEYEEKMASLKTLLVDKLLVLTNGKVSQGVK--DYMNTEIIAKGA--K
RPOB_PORGI       ---TKEAVSKLDETYAKRQQQLHERLIDKLTELTKGKTCCGVK--DYLNVELIKAGS--K
RPOB_FLAPJ       ---DKDALSDLEMEFEVKFVELKDKLVDKLFTIVNGKTSQGVM--NDLGEEVLPKGK--K
RPOB_GRAFK       ---DKEDVAALEKKYDAKFANLKADLVEKLFTIIGGKTAQGVQ--NDLGEEVMPKGK--K
RPOB_CYTH3       ---SKKQVETIKGKYSKDLLALREQMIEKLAALLDGQTSQGVK--HKFGDEVISKGV--K
RPOB_SALRD       ---EEKRLENIESDHERKLADLNERFWEKFFALVEDATSAGLE--DREGEVLLTEGA--D
RPOB_PELLD       ---VKEKLELIDARFERREIELRKSFEKWLRQMLQGKKVKGLT--SDKGKVLADEGA--A
RPOB_CHLPD       ---IKEKIEILEKKYDYKEYDLRKKFLKRLKQLLEGKTSTGIY--SDKGKLLVAEDA--V
RPOB_CHLCH       ---IKEKIELLDKQFAAKEYDLRKRFAKWLKHFLDGKTSTGVY--NDKGKVVVPEGT--V
RPOB_CHLTE       ---VKERMEAIDKQFDLKEADLRSRFAKWMKQYLNGKKSVAIT--SDKGKVLVPEGT--V
RPOB_CHLMU       LVEEAVHLKDLQKEYKSQLAQLKMEHREKLGALLLNEKAPAAIIHRRSADILVQEGA--V
RPOB_CHLPN       LVEEAVHLKDLQKGYKNQVATLKTEYREKLGALLLNEKAPAAIIHRRTAEIVVHEGL--L
RPOB_PARUW       LVEEASKLKDIQREYKSNQAQLRTEKHERVGALLLNETAPGNIVHRRTAEIIVDEGD--L
RPOB_RHOBA       --------KAFERELKQHETEGNEEIASTFESLIRDMEEASGVKLKDSTGTPLADGQDPK
RPOB_TREDE       ------------------------------------------------------------
RPOB_TREPA       ------------------------------------------------------------
RPOB_BORAP       ------------------------------------------------------------
RPOB_LEPBL       ------------------------------------------------------------
RPOB_FUSNN       ------------------------------------------------------------
RPOB_CYAM1       ------------------------------------------------------------
RPOB_AQUAE       EKVEREELEALEQELEKKKNLIITGRDKVLKGLVLGRKVEKDAKVGRKTVKKGTVIDE--
RPOB_DEIRA       ------------------------------------------------------------
RPOB_DEIGD       ------------------------------------------------------------
RPOB_THET8       ------------------------------------------------------------
RPOB_THEMA       ------------------------------------------------------------
RPOB_BACCR       ------------------------------------------------------------
RPOB_BACSU       ------------------------------------------------------------
RPOB_BACHD       ------------------------------------------------------------
RPOB_GEOTN       ------------------------------------------------------------
RPOB_OCEIH       ------------------------------------------------------------
RPOB_LISIN       ------------------------------------------------------------
RPOB_STAS1       ------------------------------------------------------------
RPOB_STRS2       ------------------------------------------------------------
RPOB_LACLA       ------------------------------------------------------------
RPOB_LACGA       ------------------------------------------------------------
RPOB_LACAC       ------------------------------------------------------------
RPOB_LACDB       ------------------------------------------------------------
RPOB_LACPL       ------------------------------------------------------------
RPOB_LACBA       ------------------------------------------------------------
RPOB_PEDPA       ------------------------------------------------------------
RPOB_LACS1       ------------------------------------------------------------
RPOB_LACSS       ------------------------------------------------------------
RPOB_LACP3       ------------------------------------------------------------
RPOB_ENTFA       ------------------------------------------------------------
RPOB_LEUMM       ------------------------------------------------------------
RPOB_OENOB       ------------------------------------------------------------
RPOB_CARHZ       ------------------------------------------------------------
RPOB_MOOTA       ------------------------------------------------------------
RPOB_SYMTH       ------------------------------------------------------------
RPOB_DESHY       ------------------------------------------------------------
RPOB_CLOAB       ------------------------------------------------------------
RPOB_CLONN       ------------------------------------------------------------
RPOB_CLOPS       ------------------------------------------------------------
RPOB_CLOTE       ------------------------------------------------------------
RPOB_HUNT2       ------------------------------------------------------------
RPOB_CLOD6       ------------------------------------------------------------
RPOB_CALS4       ------------------------------------------------------------
RPOB_SYNWW       ------------------------------------------------------------
RPOB_ONYPE       ------------------------------------------------------------
RPOB_COREF       ------------------------------------------------------------
RPOB_CORDI       ------------------------------------------------------------
RPOB_CORJK       ------------------------------------------------------------
RPOB2_NOCFA      ------------------------------------------------------------
RPOB_RHOJR       ------------------------------------------------------------
RPOB_MYCS2       ------------------------------------------------------------
RPOB1_NOCFA      ------------------------------------------------------------
RPOB_SACEN       ------------------------------------------------------------
RPOB_FRAAA       ------------------------------------------------------------
RPOB_STRCO       ------------------------------------------------------------
RPOB_THEFY       ------------------------------------------------------------
RPOB_ACIC1       ------------------------------------------------------------
RPOB_NOCSJ       ------------------------------------------------------------
RPOB_ARTS2       ------------------------------------------------------------
RPOB_LEIXX       ------------------------------------------------------------
RPOB_CUTAK       ------------------------------------------------------------
RPOB_BIFAA       ------------------------------------------------------------
RPOB_TROWT       ------------------------------------------------------------
RPOB_RUBXD       ------------------------------------------------------------
RPOB_DEHMC       ------------------------------------------------------------
RPOB_MYCMS       ------------------------------------------------------------
RPOB_MESFL       ------------------------------------------------------------
RPOB_MYCMO       ------------------------------------------------------------
RPOB_MYCPU       ------------------------------------------------------------
RPOB_MYCS5       ------------------------------------------------------------
RPOB_MYCH2       ------------------------------------------------------------
RPOB_CITSI       ------------------------------------------------------------
RPOB_POPTR       ------------------------------------------------------------
RPOB_AETGR       ------------------------------------------------------------
RPOB_OENEH       ------------------------------------------------------------
RPOB_NYMAL       ------------------------------------------------------------
RPOB_PIPCE       ------------------------------------------------------------
RPOB_PHAAO       ------------------------------------------------------------
RPOB_DIOEL       ------------------------------------------------------------
RPOB_PHAVU       ------------------------------------------------------------
RPOB_LOTJA       ------------------------------------------------------------
RPOB_JASNU       ------------------------------------------------------------
RPOB_LACSA       ------------------------------------------------------------
RPOB_SACHY       ------------------------------------------------------------
RPOB_PELHO       ------------------------------------------------------------
RPOB_ANTAG       ------------------------------------------------------------
RPOB_MARPO       ------------------------------------------------------------
RPOB_PHYPA       ------------------------------------------------------------
RPOB_PSINU       ------------------------------------------------------------
RPOB_ANGEV       ------------------------------------------------------------
RPOB_PINTH       ------------------------------------------------------------
RPOB_CYCTA       ------------------------------------------------------------
RPOB_ADICA       ------------------------------------------------------------
RPOB_HUPLU       ------------------------------------------------------------
RPOB_CHAGL       ------------------------------------------------------------
RPOB_CHAVU       ------------------------------------------------------------
RPOB_STAPU       ------------------------------------------------------------
RPOB_ZYGCR       ------------------------------------------------------------
RPOB_NEPOL       ------------------------------------------------------------
RPOB_OSTTA       ------------------------------------------------------------
RPOB_MESVI       ------------------------------------------------------------
RPOB_CHLAT       ------------------------------------------------------------
RPOB_OLTVI       ------------------------------------------------------------
RPOB_BIGNA       ------------------------------------------------------------
RPOB_PHATC       ------------------------------------------------------------
RPOB_THAPS       ------------------------------------------------------------
RPOB_TRIV2       ------------------------------------------------------------
RPOB_TRIEI       ------------------------------------------------------------
RPOB_SYNY3       ------------------------------------------------------------
RPOB_SYNE7       ------------------------------------------------------------
RPOB_THEEB       ------------------------------------------------------------
RPOB_SYNJA       ------------------------------------------------------------
RPOB_GLOVI       ------------------------------------------------------------
RPOB_PROM5       ------------------------------------------------------------
RPOB_GUITH       ------------------------------------------------------------
RPOB_RHDSA       ------------------------------------------------------------
RPOB_PYRYE       ------------------------------------------------------------
RPOB_GRATL       ------------------------------------------------------------
RPOB_CYAPA       ------------------------------------------------------------
RPOB_CYACA       ------------------------------------------------------------
RPOB_EMIHU       ------------------------------------------------------------
RPOB_EUGLO       ------------------------------------------------------------
                                                                             

RPOB_MYCGE       ------------------------------------------------------------
RPOB_MYCPN       ------------------------------------------------------------
RPOB_MYCGA       ------------------------------------------------------------
RPOB_MYCPE       ------------------------------------------------------------
RPOB_UREPA       ------------------------------------------------------------
RPOB_ALKEH       ----YLANL--------------------DRKRWFEIRMR--DEEANRQLEAVRAQLEAQ
RPOB_HALHL       ----YLQDL--------------------PRERWFEIRMR--DEAVNQQLEAVRHQLETQ
RPOB_METCA       ----YLDSI--------------------KPAQWLEIRLQ--DEDVNLQIEAIAEQIAQQ
RPOB_XANC8       ----YLDGL--------------------KKSDWFQLRMK--DDDAADAIERAQKQIQAH
RPOB_XYLFT       ----YLDGL--------------------KKSDWFALRMK--DEVAVEAIDRAQKQIQAY
RPOB_LEGPA       ----YLDKV--------------------EREKWFDIRIE--DDAVSQQLEQLSKQLELL
RPOB_COXBU       ----YLADL--------------------PRQKWFEIRLQ--DDAATKRLEASHEHFKEL
RPOB_NITOC       ----YLADL--------------------PRERWFEIRLR--SEEAGRQLESVAGQLKEQ
RPOB_AROAE       ----YLDSL--------------------EFYHWFDIRMA--DEELAAQLEAIREGLEKT
RPOB_AZOSB       ----YLETL--------------------EFYHWFDIRMA--DEELAIQLEAVREGLEKT
RPOB_METFK       ----YLDGL--------------------ARYDWFDIRLS--DEDVARQLEQLRDSLSQA
RPOB_NITEC       ----YLESV--------------------EKHHWFDIRLI--DENTSLQLEQIKDSLVQK
RPOB_NITMU       ----YLESI--------------------DPHHWFDIRLA--DEGASVQLEQIEEGLAQK
RPOB_THIDA       ----YLDSL--------------------NRHDWFDIRLA--DDEASRQVESLKDSLTQK
RPOB_DECAR       ----YLDSM--------------------DPHHWFDIRLA--DDEAAQQLEQVKDGLEQA
RPOB_PARXL       ----YLEDL--------------------DHYHWFDIRLA--DEEAAAQLEAIKDSIEQK
RPOB_HERAR       ----YLADL--------------------DKYHWFDIRPS--DDTSANALEAIKESIAEK
RPOB_RALSO       ----YLADL--------------------DKWHWFDIRPS--DDDVATQLEAVKEAIEQK
RPOB_BORA1       ----YLADL--------------------DRWQWFDIRLS--DEPHAVVLEQAKESLEQK
RPOB_RHOFT       ----YLTSV--------------------EKHHWFDIRPA--EDDVAAQLESIKNSMEQT
RPOB_POLSJ       ----YLADV--------------------EKYHWFDIRPA--DDEVASQLESIKNAMEQT
RPOB_VEREI       ----YLSSV--------------------EKFHWFDIRPA--QDEVAAQLELIKDALEQT
RPOB_METPP       ----YLASV--------------------DKYHWFDIRPA--DDDIANQLESIKNSLEQT
RPOB_NEIG1       ----YLAGLP-------------------SRHDWFDIRLT--DEDLAKQLELIKLSLQQK
RPOB_CHRVO       ----YLAGLP-------------------TKHDWFDIRMA--DEDIAKQLELIKESLAQK
RPOB_ACIBT       ----LLSGL--------------------ELVDLLEIQPA--DEAIAERLTQIQVFLKEK
RPOB_PSYCK       ----DMKDM--------------------SLETLLDIQPV--EEEISERLTQIAEYLVDK
RPOB_HAHCH       ----HFNAF--------------------EKEEWFKLNMA--DEQLNELLEKAEGQLQER
RPOB_MARHV       ----YLAEL--------------------PRADWFKLRMK--DEALNELLEKSEQGLEDR
RPOB_SACD2       ----MLDEL--------------------SHDDWFKIRMN--DDVLNEQIDAAEVALAER
RPOB_PSEU5       ----ILDGL--------------------EHGQWFKLRMA--EDALNEQLEKAQAYLSDR
RPOB_CHRSD       ----YLDEL--------------------PRSQWFKLRMQ--DESLNELLAQADEQLENR
RPOB_ALCBS       ----ILDGL--------------------DAEKWFELRPA--DDDVAEQLERAQQYLEQH
RPOB_SODGM       ----KLDKL--------------------TRERWLELGLA--DEEKQNQLEQLAEQYDEL
RPOB_ECOLI       ----KLDKL--------------------PRDRWLELGLT--DEEKQNQLEQLAEQYDEL
RPOB_BAUCH       ----KILKL--------------------KREDWSQFNIK--DNNKYCQLEQLAEQYYEL
RPOB_BLOFL       ----SLLDM--------------------NRCAWLNLKLK--DITKQNQLLQLSHQYLDL
RPOB_BLOPB       ----KLFET--------------------SRNAWLDLVLS--DPEKQYQLSQLTKQYFDL
RPOB_BUCAI       ----QLDTL--------------------PFEKWFSVDIK--QKDKKKEIEKLAKQHHEL
RPOB_BUCAP       ----FLNKL--------------------PYEKWFKIDIQ--DRNKKKEIEKLLQQHNQL
RPOB_BUCBP       ----QLNKI--------------------PKSELFKVKVT--NNLYQKKIHKLFLKYEEL
RPOB_WIGBR       ----SLSEL--------------------LKGNIKNLIFK--NNNLNNIFEELINKFLRL
RPOB_BUCCC       ----CIVAN--------------------SLNEYFKKKIKY-PKKIKKKIHTLKIQYKQL
RPOB_ACTP2       ----ELDKV--------------------AREKWLEQTLD--DEAKQNQLEQLAEQHEEL
RPOB_MANSM       ----ELDRL--------------------DRTKWLEQTLN--DEAKQNQLEQLAEQYEEL
RPOB_HAEI8       ----QLDKV--------------------DRTKWLEQTIA--DEEKQNQLEQLAEQYEEL
RPOB_ALIF1       ---------------------------LDAMDRKQWLEITLDDEAQQNQLEQLAEQYDEL
RPOB_PHOPR       ----KIASM--------------------DRERLFALTLD--DESLQNQLEQLAEQYDEL
RPOB_VIBCH       ----KLGSI--------------------ERKKWLEQTLE--NEELQNQLEQLAEQYDEL
RPOB_AERS4       ----RLNKL--------------------DRTKWFELAIE--DEAKQIELEQIAEQHIEL
RPOB_COLP3       ----DLTSM--------------------SRDKWLTQNLA--DEGQQAELEQIAEQFDNI
RPOB_PSEA6       ----RLESA--------------------QREKWFDLTLT--DEDAQTELDQIAEQFVEI
RPOB_PSEHT       ----KLALL--------------------NAEKLLTQSLA--EEDKQAELEQLAAQYDEL
RPOB_SHEAM       ----QLDAI--------------------PRKELLTQVID--DETKQTELEQLAEQHEEL
RPOB_IDILO       ----KLASV--------------------DRSSWLTQDLG--NEDAQAQLEQIAEQYQQI
RPOB_PSYIN       ----RLLQM--------------------PRAQWLEVQID--DETKQSYLDQIITQYDEV
RPOB_DICNV       ----LLDET--------------------TPEQWFDFRMQ--DEAINEKLDAMKQLLEDK
RPOB_HYDCU       ----FLASQ--------------------DSSKWFGLNVA--DDALSSHLESLEKQLVAK
RPOB_VESOH       ----LMKKF--------------------DNKDIAKFKVE--NATVNKEVAVLVKQAKAK
RPOB_FRATO       ----FLATL--------------------PLSKWLEISFE--DEKLEEKVQNAREYYEEA
RPOB_RHIL3       ----VVS-EY-------------------PRSQWWMFAVE--DEKVQSELEALRGQYDES
RPOB_RHIME       ----VIS-EY-------------------PRSQWWMFAIE--DEKAQGEIEALRAQYDES
RPOB_AGRFC       ----VVS-EY-------------------PRSQWWMFAVE--DEKAQSELEALRGQYDES
RPOB_RHILO       ----TLD-EY-------------------PRSQWWQFAVE--NEKLQSELEALRGQYDDS
RPOB_CHESB       ----LLG-EY-------------------PRSQWWQFAVE--DEKLQSELEALRAQYDES
RPOB_BRUSU       ----LMT-EY-------------------PRSQWWQFAVE--DEKLQGELEALRSQYDDS
RPOB_BARBK       ----VLN-NY-------------------PRSQWWQFAVD--DEKVQNKIEALCNQYDES
RPOB_RHOPB       ----VIE-EY-------------------PKSQWWLFASP--NDKLMAEIEAMRKQYDES
RPOB_GLUOX       ----VLD-EH-------------------HRATWASITVT--SDEVMAELEKLRGEFKEA
RPOB_GRABC       ----VLA-EH-------------------PRGAWRNISVQ--DDAVVADIELLKREFDAA
RPOB_MAGSA       ----NMD-EL-------------------HPSTWRNIAID--DDAVMADAEALKRAFDQQ
RPOB_RHORT       ----LLS-GY-------------------TAAQWRQIAVE--NDETATEIEGLKKAYEES
RPOB_CAUVC       ----GLA-QV-------------------ASGLWWQIALE--DEKAMGELESLRRLFDEN
RPOB_MARMM       ----ALD-ET-------------------PRSGWWRIGLD--DEKAMAEVEALQKQYDDS
RPOB_HYPNA       ----ALE-EL-------------------TQRQWWEIELK--SEKAQAELQALREQFDAS
RPOB_RHOS1       ----LLS-TL-------------------SRGQWWQLALG--EEADAKEVEALHEQFEAQ
RPOB_PARDP       ----LLG-QL-------------------SRGQWWQLAVA--DEDTAKEVEALNQQFDAQ
RPOB_ROSDO       ----LLQ-ML-------------------PRVQWWQLALK--DEGDAQVVEALNEQYEIQ
RPOB_JANSC       ----LLDGQL-------------------SRGQWWQLALE--DEKDAAHIEALNQQFDTQ
RPOB_NOVAD       ----VLA-DV-------------------ERHEWWKFAVA--DDARQQQLEAVKAQYDTA
RPOB_ERYLH       ----LLE-GI-------------------DRHEWFKFAVA--DDNRQQQIEAVKSQYDEA
RPOB_SPHAL       ----MLV-GL-------------------DRADWWKLAVV--DDKAQTALEAIKAQYDDA
RPOB_ZYMMO       ----TLA-SV-------------------EPHKWFKFAVE--DDARQAELEAIKNQYDSA
RPOB_PELUB       ----IIN-KI-------------------NINDVFKITVG--NVNDEASIAQLKDQYNQA
RPOB_RICBR       ----ILK-GL-------------------SKGQLWQFTVE--DANVMNEIEQLKGHYDGK
RPOB_ORITB       ----MLN-KL-------------------TNEQLLKLKAD--NSSIMDEISEIKCHYETT
RPOB_ANAMM       ----FFA-EA-------------------SDDTLWSTGLA--DAKVAAKVKDMRERFDSI
RPOB_ANAPZ       ----LLA-AK-------------------SLEALWEIGLS--NPKISAKVADMKGKFDEL
RPOB_EHRRW       ----YLK-SI-------------------PQKSWWDIKLS--DESVLSQISDLKEKFDSM
RPOB_NEOSM       ----ALE-KI-------------------DRENWWKISVD--G---ISSIKLLRQRFVDR
RPOB_MAGMM       ----WLD-KS-------------------PSSHLRDVVLD--DDAITQQIEGIRHHVEKA
RPOB_ANADE       -LDDALLDTV-------------------PQRYWGEIAVAG-D--VQDLARKIIDNFEEQ
RPOB_MYXXD       -LDDELLSTV-------------------PYKYWGEISVGD-P--LDSRLRDILRNLEET
RPOB_SYNFM       -FTEEILLNL-------------------PSGHWDQLTVAK-DPTVSMEIENILANYREQ
RPOB_SYNAS       -ITPEILSEI-------------------PLHLWKEITVAD-DEETERAVGQMMANLYDK
RPOB_GEOSL       -ITEEALDAI-------------------PLDRWDEISVSG-EAGVDEKVSAILQTLQQQ
RPOB_PELPD       -ITAEALKSL-------------------SINDMGAISVSD-DGQTDDNVSKVIDTLNRQ
RPOB_PELCD       -ITSEVLAEV-------------------PFARWREISLLD-ASENEEKLSAIMTSLAQR
RPOB_BDEBA       -ITEADLETV-------------------PFELLNYIPLE---QDLEFQVNKIIDNARNQ
RPOB_DESPS       -IEVVHAIAI-------------------GFHRLKDIDFSG-MADCTDRMDAAYERYQKQ
RPOB_DESVV       -MTRELLDAL-------------------PVKRLAGLFKSR-E--VDEMVDTALEDYDRQ
RPOB_DESAG       -LTAEMLEGL-------------------PVKKLSGLFKSK-D--TNEAVQQALESYDRQ
RPOB_LAWIP       -ITPELLDSL-------------------PLKKLEGAFKSK-E--LNETITEMLSQYEKQ
RPOB_KORVE       -LDRETIERI-------------------STRNLKRIKYADKDPRVNEQIDEIEEMTSRQ
RPOB_SOLUE       -LTRELIEKM-------------------KSRDLKRMRLANKDPRLNEQIDEIEEMTSRQ
RPOB_CAMJJ       ----ISELEK-------------------INRFTLTTLIKAYSKEIQKEYDDLKNHFQNE
RPOB_CAMFF       ----RSDLDN-------------------VNRFTLNTYVKCFSKEIQKTYEDMKAYFQNE
RPOB_SULDN       ----GEDLVE-------------------VNRFAMNAIIKSFSEEIQSEYNKTKNYFQKE
RPOB_BACV8       FTKRDLESL---------------------DYTIIQLSKWTADAHKNDMIRDLVMNYLKK
RPOB_PARD8       FTRKSLEEL---------------------DYNSIQVSKWTADAQKNELIKQVILNYLKK
RPOB_PORGI       FAKKDLEAL---------------------DFNVIQLSDWTNDAHTNELIKAVAVNYLKH
RPOB_FLAPJ       YTQKMLYAVE--------------------DFAHLTRGQWVADDETNKMVNDLIHNYKIK
RPOB_GRAFK       YTLKMLNAVD--------------------DYTHLTTGTWTTDDHLNELVADLLHNYKIK
RPOB_CYTH3       FSRKNIEANVFPDKNPYRDESNYNVQEEANLLGDLIIDNWTSDKKINENVLRLVKNYLTK
RPOB_SALRD       FEEDAFDEVD--------------------PSDLSTRAEFTEDEELNDQISTLLRNYKSR
RPOB_PELLD       FDDALLAKFS----------------SQPFLESIDFTLGVTGTKKVDEAVIRLVKEFRFK
RPOB_CHLPD       YDDSVLERFT----------------AIPFLESIDFVKGVTQSEKVNENVMLLVKEFRLK
RPOB_CHLCH       FEESVLAKFA----------------TAQFLESVDLSRGVVSSDKTNKNVTRLIKEFRFL
RPOB_CHLTE       IDEALLAKFN----------------GLPFLESIDLSKGIVSGAKTNENVVRLIREYRLK
RPOB_CHLMU       FDQETIELLE----------------------RESLVDLLMAPCDMYDVLKDILSNYETA
RPOB_CHLPN       FDQETIERIE----------------------QEDLVDLLMPNCEMYEVLKGLLSDYETA
RPOB_PARUW       ITQDLIEALE----------------------KESVEDLLMPENDIYTTLRQILHDYEIA
RPOB_RHOBA       FVAERATSFR----------------------LELVLEQIEDEEKRKAAEKVHQTQWQNV
RPOB_TREDE       ------------------------------------------------------------
RPOB_TREPA       ------------------------------------------------------------
RPOB_BORAP       ------------------------------------------------------------
RPOB_LEPBL       ------------------------------------------------------------
RPOB_FUSNN       ------------------------------------------------------------
RPOB_CYAM1       ------------------------------------------------------------
RPOB_AQUAE       ---KVFEEFV--------------------NYILGRPENFFEDEDLIRKIREIAERTRTQ
RPOB_DEIRA       ------------------------------------------------------------
RPOB_DEIGD       ------------------------------------------------------------
RPOB_THET8       ------------------------------------------------------------
RPOB_THEMA       ------------------------------------------------------------
RPOB_BACCR       ------------------------------------------------------------
RPOB_BACSU       ------------------------------------------------------------
RPOB_BACHD       ------------------------------------------------------------
RPOB_GEOTN       ------------------------------------------------------------
RPOB_OCEIH       ------------------------------------------------------------
RPOB_LISIN       ------------------------------------------------------------
RPOB_STAS1       ------------------------------------------------------------
RPOB_STRS2       ------------------------------------------------------------
RPOB_LACLA       ------------------------------------------------------------
RPOB_LACGA       ------------------------------------------------------------
RPOB_LACAC       ------------------------------------------------------------
RPOB_LACDB       ------------------------------------------------------------
RPOB_LACPL       ------------------------------------------------------------
RPOB_LACBA       ------------------------------------------------------------
RPOB_PEDPA       ------------------------------------------------------------
RPOB_LACS1       ------------------------------------------------------------
RPOB_LACSS       ------------------------------------------------------------
RPOB_LACP3       ------------------------------------------------------------
RPOB_ENTFA       ------------------------------------------------------------
RPOB_LEUMM       ------------------------------------------------------------
RPOB_OENOB       ------------------------------------------------------------
RPOB_CARHZ       ------------------------------------------------------------
RPOB_MOOTA       ------------------------------------------------------------
RPOB_SYMTH       ------------------------------------------------------------
RPOB_DESHY       ------------------------------------------------------------
RPOB_CLOAB       ------------------------------------------------------------
RPOB_CLONN       ------------------------------------------------------------
RPOB_CLOPS       ------------------------------------------------------------
RPOB_CLOTE       ------------------------------------------------------------
RPOB_HUNT2       ------------------------------------------------------------
RPOB_CLOD6       ------------------------------------------------------------
RPOB_CALS4       ------------------------------------------------------------
RPOB_SYNWW       ------------------------------------------------------------
RPOB_ONYPE       ------------------------------------------------------------
RPOB_COREF       ------------------------------------------------------------
RPOB_CORDI       ------------------------------------------------------------
RPOB_CORJK       ------------------------------------------------------------
RPOB2_NOCFA      ------------------------------------------------------------
RPOB_RHOJR       ------------------------------------------------------------
RPOB_MYCS2       ------------------------------------------------------------
RPOB1_NOCFA      ------------------------------------------------------------
RPOB_SACEN       ------------------------------------------------------------
RPOB_FRAAA       ------------------------------------------------------------
RPOB_STRCO       ------------------------------------------------------------
RPOB_THEFY       ------------------------------------------------------------
RPOB_ACIC1       ------------------------------------------------------------
RPOB_NOCSJ       ------------------------------------------------------------
RPOB_ARTS2       ------------------------------------------------------------
RPOB_LEIXX       ------------------------------------------------------------
RPOB_CUTAK       ------------------------------------------------------------
RPOB_BIFAA       ------------------------------------------------------------
RPOB_TROWT       ------------------------------------------------------------
RPOB_RUBXD       ------------------------------------------------------------
RPOB_DEHMC       ------------------------------------------------------------
RPOB_MYCMS       ------------------------------------------------------------
RPOB_MESFL       ------------------------------------------------------------
RPOB_MYCMO       ------------------------------------------------------------
RPOB_MYCPU       ------------------------------------------------------------
RPOB_MYCS5       ------------------------------------------------------------
RPOB_MYCH2       ------------------------------------------------------------
RPOB_CITSI       ------------------------------------------------------------
RPOB_POPTR       ------------------------------------------------------------
RPOB_AETGR       ------------------------------------------------------------
RPOB_OENEH       ------------------------------------------------------------
RPOB_NYMAL       ------------------------------------------------------------
RPOB_PIPCE       ------------------------------------------------------------
RPOB_PHAAO       ------------------------------------------------------------
RPOB_DIOEL       ------------------------------------------------------------
RPOB_PHAVU       ------------------------------------------------------------
RPOB_LOTJA       ------------------------------------------------------------
RPOB_JASNU       ------------------------------------------------------------
RPOB_LACSA       ------------------------------------------------------------
RPOB_SACHY       ------------------------------------------------------------
RPOB_PELHO       ------------------------------------------------------------
RPOB_ANTAG       ------------------------------------------------------------
RPOB_MARPO       ------------------------------------------------------------
RPOB_PHYPA       ------------------------------------------------------------
RPOB_PSINU       ------------------------------------------------------------
RPOB_ANGEV       ------------------------------------------------------------
RPOB_PINTH       ------------------------------------------------------------
RPOB_CYCTA       ------------------------------------------------------------
RPOB_ADICA       ------------------------------------------------------------
RPOB_HUPLU       ------------------------------------------------------------
RPOB_CHAGL       ------------------------------------------------------------
RPOB_CHAVU       ------------------------------------------------------------
RPOB_STAPU       ------------------------------------------------------------
RPOB_ZYGCR       ------------------------------------------------------------
RPOB_NEPOL       ------------------------------------------------------------
RPOB_OSTTA       ------------------------------------------------------------
RPOB_MESVI       ------------------------------------------------------------
RPOB_CHLAT       ------------------------------------------------------------
RPOB_OLTVI       ------------------------------------------------------------
RPOB_BIGNA       ------------------------------------------------------------
RPOB_PHATC       ------------------------------------------------------------
RPOB_THAPS       ------------------------------------------------------------
RPOB_TRIV2       ------------------------------------------------------------
RPOB_TRIEI       ------------------------------------------------------------
RPOB_SYNY3       ------------------------------------------------------------
RPOB_SYNE7       ------------------------------------------------------------
RPOB_THEEB       ------------------------------------------------------------
RPOB_SYNJA       ------------------------------------------------------------
RPOB_GLOVI       ------------------------------------------------------------
RPOB_PROM5       ------------------------------------------------------------
RPOB_GUITH       ------------------------------------------------------------
RPOB_RHDSA       ------------------------------------------------------------
RPOB_PYRYE       ------------------------------------------------------------
RPOB_GRATL       ------------------------------------------------------------
RPOB_CYAPA       ------------------------------------------------------------
RPOB_CYACA       ------------------------------------------------------------
RPOB_EMIHU       ------------------------------------------------------------
RPOB_EUGLO       ------------------------------------------------------------
                                                                             

RPOB_MYCGE       ------------------GDELNDGVIEMIKVYVVQKRKIQIGDKLAGRHGNKGVISKVV
RPOB_MYCPN       ------------------GNELNDGVIEMIKVYVVQKRKIQIGDKLAGRHGNKGVISKVV
RPOB_MYCGA       ------------------GDELEDDVLELVKVYVVQKRKIQIGDKVAGRHGNKGIISKIV
RPOB_MYCPE       ------------------DYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIV
RPOB_UREPA       -----------------NGSELPDDVIEIIKVYIVQKRKIQVGDKMAGRHGNKGIVSKVV
RPOB_ALKEH       RDSLERHFEEKKGKITAGD-DLAPGVVKMVKVYLAVRRRLQPGDKMAGRHGNKGVISMIV
RPOB_HALHL       RDRFERRFQEKKEKITAGD-DLSPGVLKTVKVHLAVKRRLQPGDKFAGRHGNKGVISMIV
RPOB_METCA       REEIAKRLEEKRRKITMGD-DLAPGVLKMVKVYLAVKRRIQPGDKMAGRHGNKGVISRIV
RPOB_XANC8       EKEFEARFADKRGKITQGD-DLAPGVLKMVKVFLAVKRRIQPGDKMAGRHGNKGVVSNVV
RPOB_XYLFT       QKEFDQRFSDKRSKITQGD-DLAPGVLKMVKVFLAVKRCIQCGDKMAGRHGNKGVISNVV
RPOB_LEGPA       TKEMEKRFNDSRKKIIQGD-DLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISIVV
RPOB_COXBU       RETRDAKLKDSRQKLTQGG-DLAPGVIKIVKVYLAVKRRIQPGDKMAGRHGNKGVISTIV
RPOB_NITOC       RVAMDEKFQQQRAKLTSGH-DLPPGVQKMVKVYLAVKRRVQPGDKMAGRHGNKGVISTIV
RPOB_AROAE       RKDFDQAFEIKKKKLTQGD-ELPPGVQKMVKVYLAVKRRLQPGDKMAGRHGNKGVVSRIV
RPOB_AZOSB       RKDFEQAFEIKKKKLTQGD-ELPPDVQKMVKVYLAVKRRLQPGDKMAGRHGNKGVVSKIV
RPOB_METFK       RIEFDSKFEEKKRKLTQGD-ELPPGVQKMVKVYLAVKRRIQPGDKMAGRHGNKGVVSKIV
RPOB_NITEC       RKLFDLAFEEKQRKLSQGD-ELPPGVQKMVKVYIAVKRRLQSGDKMAGRHGNKGVISKIV
RPOB_NITMU       RKAFDAAFEEKKKKLTQGD-ELPPGVQKMVKVYVAVKRRLQPGDKMAGRHGNKGVISKIV
RPOB_THIDA       RVEFDAMFEEKKQKLTAGD-ELPPGVQKMVKVYLAVKRRLQPGDKMAGRHGNKGVVSKIV
RPOB_DECAR       RKDFDIAFEGKRKKLTQGD-ELPPGVQKMVKVYVAVKRRLQPGDKMAGRHGNKGVVSRIL
RPOB_PARXL       RHQFDLAFEEKRKKLTQGD-ELPPGVLKMVKVYLAVKRRLQPGDKMAGRHGNKGVVSKIV
RPOB_HERAR       RHQFDLAFEEKRKKLTQGD-ELPPGVQKMVKVYLAVKRRLQPGDKMAGRHGNKGVVSRIL
RPOB_RALSO       RHDFDLAFEEKRKKLTQGD-ELPPGVIKMVKVYLAVKRRLQPGDKMAGRHGNKGVVSKIT
RPOB_BORA1       RHQFDLAFEEKRKKLTQGD-ELPPGVLKMIKVYLAVKRRLQPGDKMAGRHGNKGVVSRIT
RPOB_RHOFT       RHSFDLAFEEKRKKLTQGD-ELPAGVLKMVKVYLAVKRHLQPGDKMAGRHGNKGVVSKIV
RPOB_POLSJ       RHSFDLAFEEKRKKLTQGD-ELPAGVLKMVKVYLAVKRRLQPGDKMAGRHGNKGVVSKIV
RPOB_VEREI       RHSFDLAFEEKKKKLTQGD-ELPAGVLKMVKVYLAVKRRLQPGDKMAGRHGNKGVVSKIV
RPOB_METPP       RHSFDLAFEEKRKKLTQGD-ELPAGVLKMVKVYLAVKRRLQPGDKMAGRHGNKGVVSKIV
RPOB_NEIG1       REEADELYEIKKKKLTQGD-ELQPGVQKMVKVFIAIKRRLQAGDKMAGRHGNKGVVSRIL
RPOB_CHRVO       REEFDLKFEDKKRKLTQGD-ELPPGVQKMVKVYLAVKRRLQAGDKMAGRHGNKGVVSRIL
RPOB_ACIBT       SAEIDEKFAEKKRKLATGD-ELTTGVLKVVKVYLAVKRRIQPGDKMAGRHGNKGVVSNIL
RPOB_PSYCK       QKDIDVKFAEKKRKLTAGD-DLQHGVQKIVKVYLAVKRRIQPGDKMAGRHGNKGVVSRIM
RPOB_HAHCH       RKSIEDRYEDKKRKLQSGD-DLAPGVLKIVKVYVAVKRRIQPGDKMAGRHGNKGVISAIK
RPOB_MARHV       KKEHEARFDDKKGKLQQGD-DLAPGVLKIVKVYLAIKRRIQPGDKMAGRHGNKGVISAVM
RPOB_SACD2       RKELDDRFEDKKGKLETGD-DLAPGVLKIVKVYLAIKRRIQPGDKMAGRHGNKGVISVIM
RPOB_PSEU5       RQLLDDKFEDKKRKLQQGD-DLAPGVLKIVKVYLAIKRRIQPGDKMAGRHGNKGVVSVIM
RPOB_CHRSD       RKEMDERFEDKKRKLTQGD-DLAPGVLKIVKVYLAVKRRIQSGDKMAGRHGNKGVISSIM
RPOB_ALCBS       KKEQDERYKDKQAKISGGD-DLAHGVLKVVKVYLAIKRRIQPGDKMAGRHGNKGVISVIM
RPOB_SODGM       KHEFEKKLEAKRRKITQGD-DLAPGVLKIVKVYLAVKRQIQPGDKMAGRHGNKGVISKIN
RPOB_ECOLI       KHEFEKKLEAKRRKITQGD-DLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
RPOB_BAUCH       NKVFANKLEEKRRKITQGD-DLSPGVLKIVKVYIAVKRQIQPGDKMAGRHGNKGVISKIN
RPOB_BLOFL       KRIFEEKISIQYQKITQGD-ELAPGILKVVKVYLAVKRQIQPGDKMAGRHGNKGVISKIN
RPOB_BLOPB       KRMFEKKLEIQHRKITQGD-ELAPGILKIVKVYLAVKRQIQPGDKMAGRHGNKGVISKIN
RPOB_BUCAI       KEEFNKKIEIKRQKITQGD-DLAPGVLKIVKVYLAVKRQIQPGDKMAGRHGNKGVISKIN
RPOB_BUCAP       KKEFEKKIEVKRRKITQGD-DLAPGVLKIVKVYLAVKRQIQPGDKMAGRHGNKGVISKIN
RPOB_BUCBP       KKCFNKKLETTRNKITQGD-DLAPGVLKIVKVYLAVKRHIQPGDKMAGRHGNKGVISKIN
RPOB_WIGBR       KEEFEKKLEIKIKKITQGD-DLAPGVLKIVKVYLAVKRQIQPGDKMAGRHGNKGVISKIN
RPOB_BUCCC       QKKFKKKIKEKTKKIIQGD-ELAPGILKIVKIFLAVKRKIQPGDKMAGRHGNKGVVSKIN
RPOB_ACTP2       RKEFERKLEIKRNKIIQGD-DLAPGVLKVVKVYLAVRRQIQPGDKMAGRHGNKGVISKIN
RPOB_MANSM       RKDFEHKLEVKRGKIIQGD-DLAPGVLKVVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
RPOB_HAEI8       RKEFEHKLEVKRKKIIKGD-DLAPGVLKVVKVYLAVKRQIQPGDKMAGRHGNKGVISKIN
RPOB_ALIF1       KAEFDKKFETKRRKITQGD-DLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
RPOB_PHOPR       KAEFDKKFETKRRKITQGD-DLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIC
RPOB_VIBCH       KADFDKKFEAKRRKITQGD-DLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
RPOB_AERS4       KADFDKKFENKRRKIIQGD-DLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIC
RPOB_COLP3       KEDFDKKFEVKRRKITQGD-DLQPGVLKIVKVYLAVKRHIQPGDKMAGRHGNKGVISNVV
RPOB_PSEA6       KADFDKKFEIKRRKITQGD-DLQPGVLKIVKVYLAVKRQIQPGDKMAGRHGNKGVISTIK
RPOB_PSEHT       KAEYDKKFENKRRKITQGD-DLAPGVLKIVKVYLAVKRCIQPGDKMAGRHGNKGVISTIV
RPOB_SHEAM       KADFDKKFEHKRRKITQGD-DLAPGVLKIVKVYLAVKRTIQPGDKMAGRHGNKGVISKIC
RPOB_IDILO       RDDFDTKFETKRRKITQGD-DLAPGVLKIVKVYLAVRRSIQPGDKLAGRHGNKGVISTII
RPOB_PSYIN       KADYDKEFDIKRRKITQGD-DLAPGVQKIVKVYLAVRRRLQPGDKMAGRHGNKGVISNIV
RPOB_DICNV       HKELQDYYEEKKAKFSQGD-DLAPGVLKMVKVYLAVKRRLQPGDKMAGRHGNKGVVSLVV
RPOB_HYDCU       KEELNGVFEEKKKKLTQGD-DLQPGVSKMVKVYVAVKRRIQPGDKMAGRHGNKGVISRIC
RPOB_VESOH       KVEFEKFFKKEKAKINEGA-ELPPGVMKMVKVYVATRKTLQVGDKMAGRHGNKGVISRVS
RPOB_FRATO       KIAIDAKFEAKKKSITQSN-ELSPGVLKTVKVFVAIKKRIQPGDKMAGRHGNKGVVSRVL
RPOB_RHIL3       KSRLEQRFMDKVEKVQRGD-EMPPGVMKMVKVFVAVKRKIQPGDKMAGRHGNKGVVSRIV
RPOB_RHIME       KSRLEQRFMDKVEKVQRGD-EMPPGVMKMVKVFVAVKRKIQPGDKMAGRHGNKGVVSRIV
RPOB_AGRFC       KSRLEQRFMDKVEKVQRGD-EMPPGVMKMVKVFVAVKRKIQPGDKMAGRHGNKGVVSRIV
RPOB_RHILO       KKALEQRFMDKVEKVQRGD-EMPPGVMKMVKVFVAVKRKMQPGDKMAGRHGNKGVVSRIV
RPOB_CHESB       KNALQQRFMDKVEKVQRGD-EMPPGVMKMVKVFVAVKRKMQPGDKMAGRHGNKGVVSRIV
RPOB_BRUSU       KKLLEARFMDKVEKVQRGD-EMPPGVMKMVKVFVAVKRKIQPGDKMAGRHGNKGVVSRIL
RPOB_BARBK       KEALQRRFMDKVEKVQRGD-EMPPGVMKMVKVFVAVKRKIQPGDKMAGRHGNKGVVSRIL
RPOB_RHOPB       KKGLEQRFLDKVEKLQRGD-ELPPGVMKMVKVFVAVKRKIQPGDKMAGRHGNKGVVSKIV
RPOB_GLUOX       TRRIDARFDSKVEKLQRGD-ELPPGVMKMVKVFVAVKRKLQPGDKMAGRHGNKGVVSRVV
RPOB_GRABC       VAKIQARFEGKVEKLQRGD-ELPPGVMKMVKVFVAVKRKLQPGDKMAGRHGNKGVVSRVV
RPOB_MAGSA       VDKLQERFENKVEKLQRGD-ELPPGVMKMVKVFVAVKRKLQPGDKMAGRHGNKGVISRIV
RPOB_RHORT       IAKIQERFENKVEKLQRGD-ELPPGVLKMVKVFVAVKRKLQPGDKMAGRHGNKGVISKIN
RPOB_CAUVC       RKRLDRRFEDKVDKLQRGD-ELPPGVMKMVKVFVAVKRKLQPGDKMAGRHGNKGVISRIL
RPOB_MARMM       KARLDRRFEDKVDKLQRGD-EMPPGVMKMVKVFVAVKRKLQPGDKMAGRHGNKGVISKIN
RPOB_HYPNA       IRELEARFNDKVEKVQRGD-DLPPGVMKVVKVFLAVKRKLQPGDKMAGRHGNKGVISKIN
RPOB_RHOS1       KRALDHRFEDKVEKVRRGD-DLPPGVMKMVKVFVAVKRKLQPGDKMAGRHGNKGVISKVV
RPOB_PARDP       KRALDNRFDDKVEKVRQGD-DLPPGVMKMVKVFVAVKRKLQAGDKMAGRHGNKGVVSKVV
RPOB_ROSDO       KRTLDARFEDKVEKVRRGD-DLPPGVMKMVKVFVAVKRKLQPGDKMAGRHGNKGVISKVV
RPOB_JANSC       KRALDHRFEDKVEKVRRGD-DLPPGVMKMVKVFIAVKRKLQPGDKMAGRHGNKGVISKVV
RPOB_NOVAD       VKAIQEKFEDRKEKLERGD-ELAPGVLKMVKVFVAVKRKLQPGDKMAGRHGNKGIISRIL
RPOB_ERYLH       AKGIDDKFEDRKEKLERGD-ELAPGVLKMVKVFVAVKRKLQPGDKMAGRHGNKGVISRIL
RPOB_SPHAL       IKRINAKYEDRVEKLQRGD-ELAPGVLKMVKVFVAVKRKLQPGDKMAGRHGNKGVISRIL
RPOB_ZYMMO       DEAIRKRFEDRVEKAQRGD-ELPPGVLKMVKVFVAVKRKLQPGDKMAGRHGNKGVISRIL
RPOB_PELUB       KQDIQERFEDKVLKIRSGD-DLLPSVMKMVKVFVAIKRRLRPGDKMSGRHGNKGVVSKIV
RPOB_RICBR       KEALNKRFATKVEKLQSGD-DLPQGALKVVKVFIATKHKLQPGDKMAGRHGNKGVISRIV
RPOB_ORITB       RAQLTSQLNSKIEKIQCGD-DLPQGALRVVKVFIAIKHRLQPGDKMAGRHGNKGVVSKVV
RPOB_ANAMM       VGEAHRKFEQKVDKLNYGY-DLPQGVLTIVKVFVAVKHNLQPGDKMAGRHGNKGVISRIV
RPOB_ANAPZ       ITEAHSKFDQKIDKLNYGY-DLPQGVLTIVKVFVAVKHNLQPGDKMAGRHGNKGVISRIV
RPOB_EHRRW       IENAHSKFDQKIDKLNYGY-DLPQGVLCIVKVFVAVKHNLQPGDKMAGRHGNKGVISRIV
RPOB_NEOSM       FDEINKTYEENFEKIRGDD-DLAQGVLMVVKVFVAVKHTLQPGDKMSGRHGNKGVISRIV
RPOB_MAGMM       ADRLKKRFESKVEKLERGD-DLPPGVLKMVKVYIAVKRKLQPGDKMAGRHGNKGVISKIN
RPOB_ANADE       KELVKLLFGEKIGRLKKGD-ELPPGVIKMVKVYVAIKRKLAVGDKMAGRHGNKGVVSRVL
RPOB_MYXXD       KEAVKLAFGEKIARIKKGD-ELPPGVIKMVKVYVAIKRKLAVGDKMAGRHGNKGVVSRIL
RPOB_SYNFM       VQLVKSLFEEKIGKLKRGD-ELPPGVIKMVKVYVAVKRKLQVGDKMAGRHGNKGVVSRIL
RPOB_SYNAS       IEVVEAYFNEKTEKLKASD-ELPPGVIKMVKVYIAIKRKLQAGDKMAGRHGNKGVLSRIL
RPOB_GEOSL       IDIIRYVFDDKVQKLKRGD-DLPPGVIKMVKVYIAIKRKLQVGDKMAGRHGNKGVVSRIL
RPOB_PELPD       IELIQSVFEDKIQKLRRGD-DLPPGVIKMVKVYIAIKRKLQVGDKMAGRHGNKGVVSRIL
RPOB_PELCD       EELIKAVFADKIEKIKRGD-DLPPGVIKMVKVYIAIKRKLSVGDKMAGRHGNKGVLSRVL
RPOB_BDEBA       LDAVKLVFNEKIDRLRKGD-ELPPGVIKMVKVYVAIKRKMQVGDKFAGRHGNKGVVSKVL
RPOB_DESPS       AEVIAQRYDGIIERQKKGD-DLPPGVVKMVKVYVATKRKLSVGDKMAGRHGNKGVVSRIL
RPOB_DESVV       VAFLKGIYDSKREKVTEGD-DLPPGVIKMVKVHIAVKRKLNVGDKMAGRHGNKGVVSCIL
RPOB_DESAG       IEFINAMYESKREKVTEGD-DLPPGVIKMAKVHIAVKRKLNVGDKMAGRHGNKGVVSCIL
RPOB_LAWIP       INYIKTIYDSKRGKVTEGD-DLPPGVIRMVKVHIAVKRKLAVGDKMAGRHGNKGVVSCIL
RPOB_KORVE       IDVLRKIVREKIEKLQKGD-ELPPGVIKLVKVYIAMKRKLSVGDKMAGRHGNKGVIARIL
RPOB_SOLUE       IAVLEKITDEKIAKLRKGD-ELPPGVIKLVKVYIAMKRKLSVGDKMAGRHGNKGVIARIL
RPOB_CAMJJ       KKKLKAEHDEKLEILEKDD-ILPSGVIKLVKVYIATKRKLKVGDKMAGRHGNKGIVSTIV
RPOB_CAMFF       KKKLKDEHDAKLEILEKDD-ILPSGVVKLVKVYLATKRKLKVGDKMAGRHGNKGIVSNIV
RPOB_SULDN       KRLFRDEHEEKLNILEKDD-ILPNGVVKHVKIYIATKRQLKVGDKMAGRHGNKGIVSTIV
RPOB_BACV8       YKELDAELKRKKFAITIGD-ELPAGIIQMAKVYIAKKRKIGVGDKMAGRHGNKGIVSRVV
RPOB_PARD8       YKELDAELRRKKFDLTIGD-ELPTGIVQMAKVYIAKKRKIQVGDKMAGRHGNKGIVSKIV
RPOB_PORGI       SKEIEAELRRRKLDETIGD-ELPAGIVQMAKVYIAKKRKIQVGDKMAGRHGNKGIVSKIV
RPOB_FLAPJ       LNDLQGALRREKFTITVGD-ELPAGILKLAKVYIAKKRKLKVGDKMAGRHGNKGIVARIV
RPOB_GRAFK       ENDLQGNLRREKFTVSVGD-ELPSGILKLAKVYIAKKRKLKVGDKMAGRHGNKGIVARIV
RPOB_CYTH3       RNETAGKFKRERFTLEVGD-ELPAGIVQLAKVYIAKKRKLKVGDKMAGRHGNKGVVARIV
RPOB_SALRD       RRDIEGTTKRQKHQVEMGD-ELPSGVVQMAKVYVARKKKIEVGDKMAGRHGNKGVIAKIA
RPOB_PELLD       LKDLADERDNEKYKVNVGD-ELPPGIEELAKVYIAQKRKIQVGDKMAGRHGNKGVVGKIL
RPOB_CHLPD       LKDLNDERDNEKYKLNVGD-ELPPGIEELAKVYIAQKRKIQVGDKMAGRHGNKGVVGKIL
RPOB_CHLCH       LKDIADERENEKYKVNVGD-ELPPGIEELAKVYIAQKRKIQVGDKMAGRHGNKGVVGKIL
RPOB_CHLTE       LKDLSDERENEKYKINVGD-ELPPGIEELAKVYIAQKRKIQVGDKMAGRHGNKGVVGKIL
RPOB_CHLMU       VQRLEVNYKTEAEHIKEGDADLDHGVIRQVKVYVASKRKLQVGDKMAGRHGNKGVVSKIV
RPOB_CHLPN       LQRLEINYKTEVEHIREGDADLDHGVIRQVKVYVASKRKLQVGDKMAGRHGNKGVVSKIV
RPOB_PARUW       LQTVETQYKTQLEFMRKGDTDLDPGVIRQVKVYVASKRKLQVGDKMAGRHGNKGVVSKIV
RPOB_RHOBA       EQAIDERDR-KLNSMKRGD-ELRSGVLQMVKIYIATKRTISVGDKMAGRHGNKGVIAKIL
RPOB_TREDE       ----------------QGD-DLSPGVDEVVKVLIATKRKLREGDKMAGRHGNKGLVARIL
RPOB_TREPA       ----------------EGD-DLNPGVSEVVKVLIATKRKLREGDKMAGRHGNKGIVARIL
RPOB_BORAP       ----------------DVG-NLSPGVEEILKVYVAKKRKLKEGDKMAGRHGNKGVVAKIL
RPOB_LEPBL       ----------------NQD-ELPAGVEEMVKVFVARKRKLLVGDKMAGRHGNKGVVARVM
RPOB_FUSNN       ----------------NGD-ELKAGVNKSIRVLVAEKRKITVGDKMSGRHGNKGVVSRVL
RPOB_CYAM1       ----------------QGD-ELPAGVNISVRVSVAVKRVIQVGDKMAGRHGNKGIVARIL
RPOB_AQUAE       IEMLNKVYEEKKETLLKRR-DLPPGVITLVKVFIANKRKIKVGDKMAGRHGNKGVISVVL
RPOB_DEIRA       ----------------DEGVDLKPGVREMVRVYVAQKRQLQVGDKVANRHGNKGVVSKIV
RPOB_DEIGD       ----------------DEGVDLKPGVREMVRVYVAQKRQLQVGDKVANRHGNKGVVSKIL
RPOB