CLUSTAL format seed alignment for MF_01322

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RPOC_DEIRA      ---------------------MKDFNKVRIAIASPEKIREW-SFGEVEKPETINYRTLKP
RPOC_THET8      --------------------MKKEVRKVRIALASPEKIRSW-SYGEVEKPETINYRTLKP
RPOC_TREPA      --------------MKDI----RDFDSLQIKLASPDTIRAW-SYGEVKKPETINYRTLRP
RPOC_BORAP      --------------MKEI----KDFEKIKIKIASPDQIRNW-SYGEVKKSETINYRTLRP
RPOC_LEPIC      --------------MRSH----NDFESITIRLASPERIKEW-SYGEVKKPETINYRTLKP
RPOC_FUSNN      ---------------MGI----RNFEKIRIKLASPEKILEW-SHGEVTKPETINYRTLNP
RPOC_CALS4      --------------MFKL----KNFEAIKIGLASPEKIREW-SRGEVKKPETINYRTLKP
RPOC_SYMTH      --------------MLDV----NFFDSIQIGLASPERIRQW-SRGEVKKPETINYRTLRP
RPOC_LACSS      --------------MIDV----NKFESMQIGLASSDKIRSW-SYGEVKKPETINYRTLKP
RPOC_LEUMM      -------------MAIDV----NKFESMQIALASPDKIRSW-SYGEVKKPETINYRTLKP
RPOC_STRMU      --------------MVDV----NRFKSMQITLASPNKVRSW-SYGEVKKPETINYRTLKP
RPOC_STRP7      --------------MVDV----NRFKSMQITLASPSKVRSW-SYGEVKKPETINYRTLKP
RPOC_STAS1      --------------MIDV----NNFHYMKIGLASPEKIRSW-SFGEVKKPETINYRTLKP
RPOC_ARTS2      --------------MSSE----SSFGLMQIGLATAEDIRGW-SYGEVKKPETINYRTLKP
RPOC_LEIXX      --------------MLDA----TTFDELRIGLATADDIRRW-SYGEVKKPETINYRTLKP
RPOC_CORJK      --------------MLDV----NFFDELRIGLATADDIRRW-SRGEVKKPETINYRTLKP
RPOC_CUTAK      --------------MLDT----NYYDRLQIGLATADQIRAW-SHGEVKKPETINYRTLKP
RPOC_BIFLO      --------------MLDV----NAFDKIRIGLATADDIRGW-SHGEVKKPETINYRTLKP
RPOC_TROWT      ----------------MS----TSFKEIRVSMATTEDIRRW-SYGVVKKPETINYRTLKP
RPOC_RUBXD      --------MQALERDIDI----NRLEKISIGLASADEIREW-SRGEVTKPETINYRTLRP
RPOC_DEHMC      --------------MNEV----NDFDAIRISLASPDQIRSW-SYGEVTKPETINYRTLKP
RPOC_ECOLI      ----MKDLLKFLKAQTKT----EEFDAIKIALASPDMIRSW-SFGEVKKPETINYRTFKP
RPOC_BUCCC      ----MKDILKLFKKNKKV----EEFDSIKISLASPEVIRSW-SFGEVKKPETINYRTLNP
RPOC_PSEHT      ----MKDLLKFLKQQNKT----EEFDAIRIGLASPDMVRSW-SYGEVKKPETINYRTFKP
RPOC_ALCBS      ----MKDLLNLLKSQGQV----TEFDKIRIALAPPDLIRSW-SFGEVKKPETINYRTFKP
RPOC_METCA      ----MKDLINFLKRQTQS----EEFDAIRISLASPDMIRSW-SYGEVKKPETINYRTFKP
RPOC_XYLFT      ----MKDLLNLFNQQRQT----LDFDAIKIGLASPALIRSW-SFGEVKKPETINYRTFKP
RPOC_COXBU      ----MRDLVKQLKSEKHT----AEFDALRIKLASPEEVRSW-SYGEVKKPETINYRTFKP
RPOC_PSYCK      ---------MQSPTSNGN----HEFDSIQITLASPDVIKSW-SHGEVKKPETINYRTFKP
RPOC_HYDCU      ----MKDLLGFLKKQNVS----SDFDTIKVTLASPEKIRSW-SFGEVKKPETINYRTFKP
RPOC_BURM1      ----MKALLDLFKQVQQE----EVFDAIKIGLASPDKIRSW-SFGEVKKPETINYRTFKP
RPOC_NITMU      ----MKALLDLFKQVTQK----EEFDSIKIGLASPEKIRSW-SYGEVKKPETINYRTFKP
RPOC_FRATT      ------MNNGILHQNYNS----KKFDIIKISLASPEVIRSW-SHGEVKKPETINYRTFKP
RPOC_SYNAS      ----MEDVFSYFEKPKDP----IRFNAIKISIASPDKILSW-SYGEVKKPETINYRTFKP
RPOC_PELCD      ----MEDIFSLFERPKDP----LSFNAIRLSLVSPEKIRER-SFGEVKKPETINYRTFKP
RPOC_DESPS      ----MEELFNFFQKPKGP----VKFNKVKISLASPEQIIDW-SHGEVKKPETINYRTFKP
RPOC_BDEBA      ----MRDLLNFFDKPKDP----LSFDAVRVSLASPEMIREW-SFGEVKKPETINYRTFKP
RPOC_LAWIP      --MSLDELFTVRSTATANATQIRNLKAIQISIASPENIREW-SYGEVKKPETINYRTFKP
RPOC_CAUVC      -----MNQEV-LNIFNPVQAA-PTFDQIRISLASPEKIRSW-SFGEIKKPETINYRTFKP
RPOC_RHOPB      -----MNQEI-MNLFNPTTPA-QVFDQIRISIASPEKILSW-SYGEIKKPETINYRTFKP
RPOC_RHOS4      -----MNQELSTNPFNPVAPV-KTFDEIKISLASPERILSW-SYGEIKKPETINYRTFKP
RPOC_ZYMMO      -----MNELA--NFANPLAST-EHFDHIQISLASPERIRSW-SFGEIKKPETINYRTFKP
RPOC_GLUOX      -----MNELM--KILGQTGQS-VTFDQIKIQLASSEQVRSW-SYGEIKKPETINYRTFKP
RPOC_RICBR      -----MSVVNFYGQLSNT----QQFDQIRINIASPEQVRSW-SFGEVIKPETINYRTFKP
RPOC_ORITB      ----MVDITDFFKKTNKADSS-QAFNQVRINIASPEQIRSW-SYGEVTKPETINYRTFKP
RPOC_NEOSM      ----MGDFRSFRQNGGSS----VDFDGIKISLASADKIRSL-SYGEVTKPETINYRTFKP
RPOC_EHRRW      -----MKMLDLYGYTSIA----QSFDKICISIASPESIRAM-SYGEIKDISTTNYRTFKV
RPOC_SULDN      ----MSKLVPIEVTEDRRP---TDIKQIQFRLASPEKVMSW-SHGEVKKPETINYRTLKP
RPOC_SULNB      MSKFLENLTPIDLNSDDRP---KDIAALQLKVASPEKVLSW-SYGEVKKPETINYRTLKP
RPOC_GRAFK      ----------MARNN--DKNTVQRFNQISIGLASPESILAE-SRGEVLKPETINYRTHKP
RPOC_PORGI      ----------MAFRK--ENKIKNNFSKIRITLASPEEILEN-SFGEVLKPETINYRTYKP
RPOC_CYTH3      ----------MAFRK--NKKLNNDFTKVTISLASPESILEG-SHGEVTQPETINYRTYKP
RPOC_SALRD      ----------MPYGN--SKEIETDFDSITISLASPEDILER-SYGEVMKPETINYRSFKP
RPOC_CHLTE      ----------MIFSQG-SSPLKGDFSKIKFSIASPESILAH-SRGEVLKPETINYRTFKP
RPOC_RHOBA      ----------MSIGETSNYDRINDYASVRISLARPQDIKAW-SFGEVKKPETINYRTYRP
RPOC_PARUW      ----------MSERN----QQDGQFDKLTIKIASDDVIRNEWSRGEIKKPETINYRTFKP
RPOC_AQUAE      --------------MSEARRGIFPFSKIKLMLASPEDIRSW-SHGEVKRPETLNYRTLKP
RPOC_CARRP      -------------------MIKSIFKKVSIKMASSSKILSW-SFGEVTHSNFINFKNLKP
RPOC_THEMA      ---------------MPMSSFKRKIKAIQIKIASPEVIRSW-SGGEVKKPETINYRTFKP
RPOC_MYCPE      ---------------MNSK--SSRITSIQIGLASPEKIREW-SNGEVTKSETINYKSLKP
RPOC_MYCGA      ----------MDKLNKKNK--NKRIRGLQISIASAEEMRSW-SHGEVKKPETINYKSLKP
RPOC_UREPA      -----------------MS--QKGIKSLTISIASPEQILNW-SKGEITKPETINYKSLKP
RPOC_MYCPN      ----------MTKRNKKNNKLYKNIKAIKLSIASNDTILNW-SEGEVTKAETINYKSLKP
RPOC_MYCMO      --------MNKILKGDNQNWAEYEIDSISLALATDEDVLNW-SNGEVTKPETVNYKTYKP
RPOC_MYCPU      --------MPKTRKYSTVD--EEKILKVSLSLATKEDVLEW-SHGEVTKPETINYKSYKP
RPOC_MYCH2      --------MNTKVSRQYAKISENSIQKISLALATPEDVLEW-SRGEVHRPETINYKTFKP
RPOC_MYCS5      --------MSNTFSKNNVK----KIKQISLSLATNEDVLSW-SNGVVSKPETINYKTYKP
                                           : . :.    :    * * :   .  *::. . 

RPOC_DEIRA      EREGLFDERIFGPIKDYECA-CGKYKRQRYEG------KVCERCGVEVTSSKVRRYRMGH
RPOC_THET8      ERDGLFDERIFGPIKDYECA-CGKYKRQRFEG------KVCERCGVEVTKSIVRRYRMGH
RPOC_TREPA      EREGLFCERIFGTTKEWECF-CGKFKSIRYRG------VICDRCGVEVTHFKVRRERMGH
RPOC_BORAP      EKDGLFCERIFGTTKEWECY-CGKFKSVRYKG------IICDRCNVEVTHFKVRRERMGH
RPOC_LEPIC      EKDGLFCEKIFGTTKDWECY-CGKFKSIRYKG------VVCDKCGVEVTHSKVRRERMGH
RPOC_FUSNN      ERDGLFCEIIFGPTKDWECS-CGKYKRMRYKG------LVCEKCGVEVTRAKVRRERMGH
RPOC_CALS4      ERDGLFCERIFGPTKDWECH-CGKYKRVKYKG------VVCDRCGVEVTRSKVRRERMGH
RPOC_SYMTH      ERDGLFCERIFGPTRDWECH-CGKYKRVRYKG------IVCDRCGVEVTRAKVRRERMGH
RPOC_LACSS      ERDGLFDERIFGPTKDWECA-CGKYKRIRYKG------IVCDRCGVEVTRSKVRRERMGH
RPOC_LEUMM      EKDGLFDERIFGPTKDYECA-CGKYKRIRYKG------IVCDRCGVEVTSSKVRRERMGH
RPOC_STRMU      EREGLFDEVIFGPTKDWECA-CGKYKRIRYKG------IVCDRCGVEVTRAKVRRERMGH
RPOC_STRP7      EREGLFDEVIFGPTKDWECA-CGKYKRIRYRG------IVCDRCGVEVTRTKVRRERMGH
RPOC_STAS1      EKDGLFCERIFGPTKDWECS-CGKYKRVRYKG------MVCDRCGVEVTKSKVRRERMGH
RPOC_ARTS2      EKDGLFCEKIFGPSRDWECY-CGKYKRVRFKG------IICERCGVEVTRAKVRRERMGH
RPOC_LEIXX      EKDGLFGEQIFGPSRDWECS-CGKYKRVRFKG------IVCERCGVEVTKSSVRRERMGH
RPOC_CORJK      EKDGLFCERIFGPTRDWECG-CGKYKRVRYKG------IICERCGVEVTKSKVRRERMGH
RPOC_CUTAK      ERDGLFCEKIFGPTRDWECY-CGKYKRVRFKG------IICERCGVEVTRSNVRRERMGH
RPOC_BIFLO      EKDGLFGEQIFGPTRDWECA-CGKYKRVRFKG------IVCERCGVEVTRSRVRRERMGH
RPOC_TROWT      EKDGLFGEQIFGPTRDWECG-CGKYKRSRYRG------VVCERCGVEVTQSSVRRERMGH
RPOC_RUBXD      EKDGLFDERIFGPTKDWECY-CGKYKRIRFKG------IICERCGVEVTRARVRRDRMGH
RPOC_DEHMC      ERDGLFCERIFGPIKDFECA-CGKYKRIRYKG------IICDKCGVEIARAKVRRERMGH
RPOC_ECOLI      ERDGLFCARIFGPVKDYECL-CGKYKRLKHRG------VICEKCGVEVTQTKVRRERMGH
RPOC_BUCCC      ERDGLFCARIFGPIKDYECL-CGKYKRLKHRG------VICEKCGVEVTQSKVRRDRMGH
RPOC_PSEHT      ERDGLFCARIFGPVKDYECL-CGKYKRLKHRG------VICEKCGVEVTLTKVRRDRMGH
RPOC_ALCBS      ERDGLFCARIFGPIKDYECL-CGKYKRLKHRG------VICEKCGVEVTLSKVRRERMGH
RPOC_METCA      ERDGLFCAKIFGPVSDYECL-CGKYKRLKHRG------VICEKCGVEVTLSKVRRERMGH
RPOC_XYLFT      ERDGLFCAAIFGPIKDYECL-CGKYKRMKHRG------VVCEKCGTEVTLAKVRRERMGC
RPOC_COXBU      EREGLFCAKIFGPIKDYECL-CGKYKRLKHRG------VICEKCGVEVTLAKVRRERMGH
RPOC_PSYCK      ERDGLFCAKIFGPVKDFECL-CGKYKRRKFQG------VICEKCGVEVTTAKVRRDRMGH
RPOC_HYDCU      ERDGLFCAKIFGPIRDYECL-CGKYKRLKHRG------VICEKCGVEVTQSKVRRERMGH
RPOC_BURM1      ERDGLFCAKIFGPIKDYECL-CGKYKRLKHRG------VICEKCGVEVTLAKVRRERMGH
RPOC_NITMU      ERDGLFCAKIFGPVKDYECL-CGKYKRLKHRG------VICEKCGVEVTLSKVRRERMGH
RPOC_FRATT      ERDGLFCAKIFGPIKDYECL-CGKYKRLKHRG------VVCERCGVEVEQAKVRRERMGH
RPOC_SYNAS      ERDGLFCAKIFGPVKDYECL-CGRYKRMKHRG------VVCEKCGVEVIKSKVRRERMGH
RPOC_PELCD      ERDGLFCAKIFGPTKDYECN-CGKYKRMKHRG------IVCEKCGVEVIPSKVRRERLGH
RPOC_DESPS      ERDGLFCAKVFGPVKDFECN-CGKYKRMKHRG------VVCEKCGVEVIQSKVRRERLGH
RPOC_BDEBA      ERDGLFCAKIFGPIKDYECL-CGKYKRMKYRG------VVCEKCGVEVTQTKVRRERLGH
RPOC_LAWIP      ERDGLFCAKIFGPVKDYECN-CGKYKRMKHRG------IVCEKCGVEVIASKVRRERMGH
RPOC_CAUVC      ERDGLFCARIFGPTKDYECL-CGKYKRMKYKG------IICEKCGVEVTLARVRRERMGH
RPOC_RHOPB      ERDGLFCARIFGPIKDYECL-CGKYKRMKYKG------IICEKCSVEVTLSRVRRERMGH
RPOC_RHOS4      ERDGLFCARIFGPIKDYECL-CGKYKRMKYRG------VVCEKCGVEVTLQKVRRERMGH
RPOC_ZYMMO      ERDGLFCARIFGPIKDYECL-CGKYKRMKYKG------IVCEKCGVEVTVSKVRRERMGH
RPOC_GLUOX      ERDGLFCARIFGPIKDYECL-CGKYKRMKFRG------IVCEKCGVEVTLAKVRRERMGH
RPOC_RICBR      EKDGLFCARIFGPVKDYECL-CGKYKRMKNRG------ITCEKCGVEVTVSRVRRERMGH
RPOC_ORITB      EKDGLFCAKIFGPVKDYECL-CGKYKRMKYRG------IVCEKCGVEVTTSKVRRERMGH
RPOC_NEOSM      EKNGLFCAKIFGPTKSYECL-CGKYKKIKYSG------VICERCGVEVTSSRVRRERMGH
RPOC_EHRRW      EKGGLFCPKIFGPVNDDECL-CGKYRKKRYRG------VICEKCGVEVTSSKVRRERMGH
RPOC_SULDN      ERDGLFCAKIFGPVRDYECL-CGKYKKMRYKG------VVCEKCGVEVTSTKVRRIRMGH
RPOC_SULNB      ERDGLFCAKIFGPIRDYECL-CGKYKKMRYKG------VVCEKCGVEVTSSKVRRNRMGH
RPOC_GRAFK      ERDGLFCERIFGPVKDYECA-CGKYKRIRYKG------IVCDRCGVEVTEKKVRRDRVGH
RPOC_PORGI      ERDGLFCERIFGPVKDFECH-CGKYKRIRYRG------IVCDRCGVEVTEKKVRRERMGH
RPOC_CYTH3      EMGGLFCERIFGPVKDWECH-CGKYKRIRYKG------IICDRCGVEVTEKKVRRERMGH
RPOC_SALRD      EMGGLFCEKIFGPVKDYECH-CGKYKRIRYKG------IICDRCGVEVTRKAVRRERMGH
RPOC_CHLTE      ERDGLMCEKIFGPTKDWECY-CGKYKRVRYKG------IICDRCGVEVTTKSVRRERMGH
RPOC_RHOBA      EKDGLFCERIFGPEKDWECA-CGKYRGMKYKG------MICDRCGVKVTHSRVRRKRMGH
RPOC_PARUW      EKGGLFCEKIFGPTRDWECA-CGKYKKIKHKG------IVCDRCGVEVTLSKVRRERMAH
RPOC_AQUAE      EKDGLFCAKIFGPIKDYECL-CGKYRGKRYEG------KICEKCGVEVTTSYVRRQRFGH
RPOC_CARRP      EPNGLFCLKIFS---DFELC-CLKKK------------CFCHNDKFLNLKKAHTGYKVGH
RPOC_THEMA      ERDGLFCERIFGPVKDYECA-CGKYKGKKYEG------TVCERCGVRVESREARRKRMGH
RPOC_MYCPE      EKDGLFDEAIFGPVKDYECA-CGKYKKIKFRG------KICEKCGVEITESIVRRERVGH
RPOC_MYCGA      ETDGLFDEAIFGPVKDFECA-CGKYKKIKHRG------RTCEKCGVEITESIVRRERMGH
RPOC_UREPA      EPNGLFDESIFGPSKDYECY-CGKYRKVKHKG------KICERCHVEITESIVRRERMGH
RPOC_MYCPN      EPGGLFDEAIFGPVKDYECA-CGKFKKIKYRG------VRCDRCGVWVTESIVRRERMGH
RPOC_MYCMO      EKHGLFDELIFGPTTDYKCPICGKKYKISNEGSTCGNTEECKREKPEILPKISRRSRMGH
RPOC_MYCPU      ERHGLFDELIFGPATDYKCPICGKKYKKSNEGLTCNNTPQCEIEKPEILPKISRRSRMGH
RPOC_MYCH2      ERGGLFDELIFGPLVDYKCSVCGRKYRKSNENQLCIATKECKIRGSRILSKMARRYSMGH
RPOC_MYCS5      EKDGLFDEIIFGPVTDFKCPICFTKYKKSDENTICKRTTSCEKIQPKILPKISRRSRMGH
                *  **:   :*.   . :   *                  *.               .. 

RPOC_DEIRA      IDLATPAAHIWYVKDSPSKIGTLLDLS-------------AGQLEKVLYFSSFIVTKPFN
RPOC_THET8      IELATPAAHIWFVKDVPSKIGTLLDLS-------------ATELEQVLYFSKYIVLDPKG
RPOC_TREPA      IELATPVSHIWYYRCVPSRMGLLLDLQ-------------VIALRSVLYYEKYIVIEPGD
RPOC_BORAP      IELAAPVAHIWYYKYIPSRIGLLLDIT-------------ASSLNSILYYEKYVVIEPGD
RPOC_LEPIC      IELAAPVSHIWYYRSVPSRMGLLLDMT-------------VNQLKSVLYFEKYVIIDPAD
RPOC_FUSNN      ITLASPVSHIWYSKGSPNKMSLIIGIS-------------SKELESVLYFARYIVTSSQE
RPOC_CALS4      IELAAPVAHIWYVKGIPSRMGLLLDMS-------------PRALEKVLYFVSYVVIDPGD
RPOC_SYMTH      IELAAPVSHIWYFKGIPSRMGLILDIS-------------PRALEKVLYFAAYIVTDPGD
RPOC_LACSS      IELAAPVTHIWYFKGIPSRMGLVLDMS-------------PRALEEVIYFASYVVIDPGD
RPOC_LEUMM      IELAAPVTHIWYFKGIPSRMGLVLDMS-------------PRSLEEIIYFASYVVIEPGD
RPOC_STRMU      IELKAPVSHIWYFKGIPSRMGLTLDMS-------------PRALEEVIYFAAYVVIDPKE
RPOC_STRP7      IELKAPVSHIWYFKGIPSRMGLTLDMS-------------PRALEEVIYFAAYVVIDPKD
RPOC_STAS1      IELAAPVSHIWYFKGIPSRMGLLLDMS-------------PRALEEVIYFASYVVVNPGP
RPOC_ARTS2      IELAAPVTHIWYFKGVPSRLGYLLDLA-------------PKDLEKVIYFAAYMITSVDT
RPOC_LEIXX      IELAAPVTHIWYFKGVPSRLGYLLDMA-------------PKDLEKVIYFAAYMVIDVDE
RPOC_CORJK      IELAAPVTHIWYFKGVPSRLGYLLDLA-------------PKDLEKIIYFAANIITSVDE
RPOC_CUTAK      IELVAPVTHIWYFKGVPSRLGYLLDIA-------------PKDLEKVIYFAAYMITAVDD
RPOC_BIFLO      IELAAPVTHIWFFKGVPSRLGYLLNVT-------------PKDLERVIYFASYMVTEVNE
RPOC_TROWT      IELAAPVTHIWYFKGVPSRLGYLLDIA-------------PKDLDKVIYFAAYMVVSLDE
RPOC_RUBXD      IELAAPVAHVWFVKGVPSRMGYLLDIS-------------PKDLDRVLYFASSIVTWVDR
RPOC_DEHMC      IELACPVGHIWFTRGIPSRVGLLLNLS-------------TRSLERIIYYSHFIITAVND
RPOC_ECOLI      IELASPTAHIWFLKSLPSRIGLLLDMP-------------LRDIERVLYFESYVVIEGGM
RPOC_BUCCC      IELAAPIAHIWFLKSLPSRIGLLLDMP-------------LRDIERVLYFESYVITDPGI
RPOC_PSEHT      IDLASPVAHIWFLKSLPSRIGLMLDMT-------------LRDIERVLYFESFVVTEPGM
RPOC_ALCBS      IELASPTAHIWFLKSLPSRIGLMLDMT-------------LRDIERVLYFESFVVTEPGM
RPOC_METCA      IELASPVAHIWFLKSLPSRIALLLDMQ-------------LREIERVLYFESYVVIDPGM
RPOC_XYLFT      IELASPVAHIWFLKSLPSRIGLMLDMT-------------LRDIERVLYFEAYVVTEPGL
RPOC_COXBU      IELASPVAHIWYLKSLPSRIGLLLDVT-------------LRDIERILYFEAYVVVDPGM
RPOC_PSYCK      IDLASPVAHIWFLKSLPSRIGLLLDMT-------------LRDIERVLYFESYIVTEPGL
RPOC_HYDCU      IDLATSVAHIWFLKSLPSRIGLMLDMT-------------LKEIEAVLYFEAFMVVDPGL
RPOC_BURM1      IELASPVAHIWFLKSLPSRLGMVLDMT-------------LRDIERVLYFEAYVVIDPGM
RPOC_NITMU      IELASPVAHIWFLKSLPSRLGMVLDMT-------------LRDIERVLYFEAYVVTDPGL
RPOC_FRATT      IDLVCPVVHIWYLKSLPSRIGLFLDMP-------------LKNVEKVLYFESYIVTDPGM
RPOC_SYNAS      ITLATPVAHIWFLKSLPSRIGNVLDLT-------------LKELERILYFESWIVLDPRN
RPOC_PELCD      IDLACPVAHIWFLKSLPSRIATLLDMT-------------LKEVERVLYFEAYLVLDAGD
RPOC_DESPS      ISLAAPVAHIWFLKSLPSKIGAVLDMT-------------LKQLEKVLYFENYAVTQSEV
RPOC_BDEBA      IELATPVAHIWFLRSLPSRIGNLLNLS-------------LKDVEKVLYCEAHVVIDPME
RPOC_LAWIP      IELAAPVAHIWFLKTLPSKIGTLLDMA-------------MADLEKVLYFDSYIVLDPGS
RPOC_CAUVC      IELASPVAHIWFLKSLPSRIAMMLDMP-------------LKDIERVLYFEYYIVTEPGL
RPOC_RHOPB      IELAAPVAHIWFLKSLPSRIGLLLDMT-------------LKDLERILYFEYYVVLEPGL
RPOC_RHOS4      IELAAPVAHIWFLKSLPSRIGLMLDMT-------------LRDLERILYFENYVVIEPGL
RPOC_ZYMMO      IELAAPVAHIWFLKSLPSRIGLLLDMQ-------------LKQLERVLYFESYIVIEPGL
RPOC_GLUOX      IELASPVAHIWFLKSLPSRIATMLDLP-------------LKDVEPVLYFEKFLVLDKGV
RPOC_RICBR      IELAAPVAHIWFLKSLPSRISTLLDMT-------------MRDIEKILYFENYVVVDPGL
RPOC_ORITB      IELASPIAHIWFVRSLPSRISILLDMN-------------LKDLERVIYFEAYIVMDPGL
RPOC_NEOSM      IELASPVAHIWFLKSLPSKICILLDLT-------------LKNVEKVLYFELYIVIDPGV
RPOC_EHRRW      IELVSPVAHVWFLKSLPSRIGALLDMP-------------LKLIESILYSGDFVVIDPIA
RPOC_SULDN      IELVTPVAHIWYVSSLPSRIGTLLGIK-------------MKDLERVLYYEAYIVESGGE
RPOC_SULNB      IDLIAPVAHIWYVSSLPSRIGTLLGVK-------------MKDLERVLYYEAYIVKTPGE
RPOC_GRAFK      INLVVPVAHIWYFRSLPNKIGYLLGLP-------------SKKLDMIIYYERYVVIQAGN
RPOC_PORGI      IHLVVPVAHIWYFRSLPNKIGYLLGLP-------------TKKLDAIIYYERYVVIQPGV
RPOC_CYTH3      IELVVPVAHIWYFRSLPNKIGYMLGLP-------------TKKLDQIIYYERYVVIQSGV
RPOC_SALRD      ISLSVPVVHIWYFKTLPNKIGHLLGLK-------------SKDLEKVIYYENYIVIQPGT
RPOC_CHLTE      ISLAVPVVHTWFFRSVPSKIGALLDLS-------------TKELERIIYYEVYVVINPGE
RPOC_RHOBA      IELAAPVVHIWFFKAMPSRLGNLLAMK-------------TSSLEKVIYFQDYVVTDPKD
RPOC_PARUW      IDLAVPVVHIWFFKTMPSRIGNVLGMT-------------SADLERVIYYEEYVVINPGQ
RPOC_AQUAE      IELAAPVVHIWFLKSTPSKIGTLLNLT-------------SRDVERVAYFESYLVIEYPN
RPOC_CARRP      IKLFYPAVHIWYIKSSHSNISNILNLS-------------YKILEKIINFKLKVVIKSYD
RPOC_THEMA      IELAAPAVHIWYLESIPSVLGTLLNMS-------------TSDLENIIYYGSRRVIERAF
RPOC_MYCPE      IELAAPIAHIWMTKELPCPSKISLVLD-----------ISYKEIEQVVYFVNYIVLDEGN
RPOC_MYCGA      IDLAVPVAHIWMTKELPSPSKISLVLD-----------VSYKEVEEVVYFVNYIILNPGN
RPOC_UREPA      IELAAPVAHIWFTKELPSPSKISLLLD-----------ITYKEVDQVVYFVNYIVLDEGN
RPOC_MYCPN      IALVSPVAHIWMSKELPSPSKISLVLN-----------ISYKEVEQVLYFVNYIVLDTGK
RPOC_MYCMO      IRLHAPIVHFWFFKVDNSIISKLLGLKSENSNK----YYSKKEIEALIYYTSHIVVESGG
RPOC_MYCPU      IALQTPVVHFWFFKIDNSIISKLLVLRVGESNE----YVSKNDLENIIYYKSHIVLDNGG
RPOC_MYCH2      IALNAPILHFWFFKIDHSIIAKLLGLKVFEGNSKVPTTITKTAIENLIYYKSHIVLETGG
RPOC_MYCS5      IALNNPVVHFWFFKINHSTISKLLGLKVAGSNK----PVTKSDLEKIIYYKSHIVLETGG
                * *  .  * *            : :                 :  :       :     

RPOC_DEIRA      AQKDG--------------------------------RPLKRGELLSDDEYRELRFGRQE
RPOC_THET8      AILNG--------------------------------VPVEKRQLLTDEEYRELRYGKQE
RPOC_TREPA      -------------------------------------TDLKKNQLLTETE----------
RPOC_BORAP      -------------------------------------TDLKKMQLLNEDE----------
RPOC_LEPIC      -------------------------------------SGRNRGELIDEEE----------
RPOC_FUSNN      -------------------------------------STVEVGKILTEKE----------
RPOC_CALS4      -------------------------------------TPLTKKQLLSEKE----------
RPOC_SYMTH      -------------------------------------TPLMEKQLLTENE----------
RPOC_LACSS      -------------------------------------TALEKKQLMTERE----------
RPOC_LEUMM      -------------------------------------APVEKKQMMTERE----------
RPOC_STRMU      -------------------------------------TPLEAKSLLTERE----------
RPOC_STRP7      -------------------------------------TPLEHKSIMTERE----------
RPOC_STAS1      -------------------------------------TGLEKKTLLSEAE----------
RPOC_ARTS2      DSRHEELP------------------------NLQVEHDIEKKQLVDNRDSDIATIARDL
RPOC_LEIXX      EGRHADMP------------------------GLENELRLESKTLSDQRDARVAERLQRL
RPOC_CORJK      EGRHNDQS------------------------TLEAEMLLEKKEVEQERDAELADRAKTL
RPOC_CUTAK      EARHRDLP------------------------SLEAKVQTERSRLEQRRDSELEARRVKL
RPOC_BIFLO      DERHNDLP------------------------GLQDEFDSEIKRLEQRRDSDIEARAKKV
RPOC_TROWT      EGRKEDLQ------------------------DLENELRLDIKQLRDACDASIASAVSEL
RPOC_RUBXD      EGRANDID------------------------RLRQQVEEEIRQIEQDRDEEITAAQALL
RPOC_DEHMC      DAREKAIK------------------------DLEVISSQRVADKGSEVDTRVAQMEAE-
RPOC_ECOLI      TNLE-------------------------------------RQQILTEEQ----------
RPOC_BUCCC      TNLE-------------------------------------KYQVLSEDQ----------
RPOC_PSEHT      TTLE-------------------------------------RGQLLGEEE----------
RPOC_ALCBS      TTLE-------------------------------------RGQLLTDEE----------
RPOC_METCA      TPLT-------------------------------------RGQLLGEEE----------
RPOC_XYLFT      TPLE-------------------------------------RRQLLTEEQ----------
RPOC_COXBU      TDLE-------------------------------------PRQLLSEEA----------
RPOC_PSYCK      TSLE-------------------------------------KYQLLDDED----------
RPOC_HYDCU      TPLE-------------------------------------PWQLLSEEE----------
RPOC_BURM1      TPLK-------------------------------------ARQIMTEED----------
RPOC_NITMU      TPLQ-------------------------------------RCQLLTDDD----------
RPOC_FRATT      TPLE-------------------------------------KKQLLTDEE----------
RPOC_SYNAS      TPLR-------------------------------------KKDLLSDEE----------
RPOC_PELCD      TPLF-------------------------------------RGQLLTEDK----------
RPOC_DESPS      EELP-------------------------------------LGTLLTEEK----------
RPOC_BDEBA      TTLE-------------------------------------EGQVLTEEA----------
RPOC_LAWIP      TNLT-------------------------------------KMQVISEDQ----------
RPOC_CAUVC      TPLK-------------------------------------QHQLLSEDD----------
RPOC_RHOPB      TALK-------------------------------------DRQLLSEEE----------
RPOC_RHOS4      TDLT-------------------------------------YGQLMTEEE----------
RPOC_ZYMMO      TPLK-------------------------------------KFQLLTEDE----------
RPOC_GLUOX      CESDQID--------------------------SYKNGKKRDQYLLDEIR----------
RPOC_RICBR      SILQ-------------------------------------KGELLTEEE----------
RPOC_ORITB      SPLH-------------------------------------KGDLLTEEM----------
RPOC_NEOSM      TTFT-------------------------------------KNELITDEA----------
RPOC_EHRRW      TPLS-------------------------------------KGEVISESA----------
RPOC_SULDN      AYYD-----------------------------AEAKTPVLKYDVLNEEQ----------
RPOC_SULNB      ASYD-----------------------------NEGLNPVQKYDVLNEEQ----------
RPOC_GRAFK      AKNEE-------------------------------GEPLKKMDFLTEEE----------
RPOC_PORGI      A------------------------------------EGLSQLDLLSEEE----------
RPOC_CYTH3      KSE----------------------------------DGINYLDFLTEDE----------
RPOC_SALRD      AER----------------------------------LGVEENQLLTEEE----------
RPOC_CHLTE      PGEK---------------------------------QGIKKFDRLTEEQ----------
RPOC_RHOBA      T-------------------------------------DLEMLQLLTEEE----------
RPOC_PARUW      T-------------------------------------DLERKQLLNDTE----------
RPOC_AQUAE      EEEEEKFEKDEHT----------------IPLNDGISTKWVKLHVVNEEE----------
RPOC_CARRP      IKIKK-------------------------------------------------------
RPOC_THEMA      IVTDPKDTPFSQGDVIYETEYRIYRKKWDFDVEQAFVVKNPKSPVLSDIDGEVTLKTEKS
RPOC_MYCPE      GKFPK--NFNFKE-----------------------VIDLSSQKSSKETRSKLRKTLREI
RPOC_MYCGA      SKNP---VFKFKE-----------------------VVDLSG-KGSKSARIKLRKVLREI
RPOC_UREPA      NVYDGKSIFNKKE-----------------------VLDLTSPKNSIRSRNKLRRTLRNI
RPOC_MYCPN      IKDPKIMPFKFKE-----------------------VLDLAG-KGSLTTRQKMRRVIGYI
RPOC_MYCMO      LNSLPKHTVIYSD-----------------------NAAIIYRDALEEIRSKYDRSIPEQ
RPOC_MYCPU      LKSLPKNKIININ-----------------------NAAQIYKDALIELR-ELNLNDADA
RPOC_MYCH2      LKSLEQNKIIDIS-----------------------EAGLIYKNALIEII-EFYPPGSEE
RPOC_MYCS5      LKSLQKNTIIDIN-----------------------DAADIYAGALEEIL-EFNKDNKDG
                                                                            

RPOC_DEIRA      TYTIPNSVEDVEIRDGEYVTRGQILGGNVVSKMDGLAQYRFPRRAVIAYSEGVEASLPLP
RPOC_THET8      TYPLPPGVDALVK-DGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLP
RPOC_TREPA      ------------------------------------------------------------
RPOC_BORAP      ------------------------------------------------------------
RPOC_LEPIC      ------------------------------------------------------------
RPOC_FUSNN      ------------------------------------------------------------
RPOC_CALS4      ------------------------------------------------------------
RPOC_SYMTH      ------------------------------------------------------------
RPOC_LACSS      ------------------------------------------------------------
RPOC_LEUMM      ------------------------------------------------------------
RPOC_STRMU      ------------------------------------------------------------
RPOC_STRP7      ------------------------------------------------------------
RPOC_STAS1      ------------------------------------------------------------
RPOC_ARTS2      ENELARLEGEG---------------AKAADKKKARDSADRQMANVRKRADADIERLEQV
RPOC_LEIXX      ETDLAALEEEG---------------AKADQKRRVKDTAEKEMGQLRKSFDEDIARLERV
RPOC_CORJK      EDDLAELEAAG---------------AKNDAKKKVQNAADREMRHIRERAEREIDRLDEI
RPOC_CUTAK      EEDMAQLEADG---------------AKADVRRKVKDGAEKELKHIETRAQRQIDRLDAV
RPOC_BIFLO      EEDLAALEEAGE--------------AKGPARTKLRNGAERDMAAIRTRYNDQIARVDAV
RPOC_TROWT      ERTITELQDAK---------------TSASRINKVRSEAENKMANIRREYDDKIEHLERV
RPOC_RUBXD      TKRISVIKGESSPDELTEDYADVPEEEREEAIARARREAEETIEDIKRSMDEQIELIRRA
RPOC_DEHMC      -----------------------------DATVEAINQIRRDFSTEREQMEEDIQLLIDQ
RPOC_ECOLI      ------------------------------------------------------------
RPOC_BUCCC      ------------------------------------------------------------
RPOC_PSEHT      ------------------------------------------------------------
RPOC_ALCBS      ------------------------------------------------------------
RPOC_METCA      ------------------------------------------------------------
RPOC_XYLFT      ------------------------------------------------------------
RPOC_COXBU      ------------------------------------------------------------
RPOC_PSYCK      ------------------------------------------------------------
RPOC_HYDCU      ------------------------------------------------------------
RPOC_BURM1      ------------------------------------------------------------
RPOC_NITMU      ------------------------------------------------------------
RPOC_FRATT      ------------------------------------------------------------
RPOC_SYNAS      ------------------------------------------------------------
RPOC_PELCD      ------------------------------------------------------------
RPOC_DESPS      ------------------------------------------------------------
RPOC_BDEBA      ------------------------------------------------------------
RPOC_LAWIP      ------------------------------------------------------------
RPOC_CAUVC      ------------------------------------------------------------
RPOC_RHOPB      ------------------------------------------------------------
RPOC_RHOS4      ------------------------------------------------------------
RPOC_ZYMMO      ------------------------------------------------------------
RPOC_GLUOX      ------------------------------------------------------------
RPOC_RICBR      ------------------------------------------------------------
RPOC_ORITB      ------------------------------------------------------------
RPOC_NEOSM      ------------------------------------------------------------
RPOC_EHRRW      ------------------------------------------------------------
RPOC_SULDN      ------------------------------------------------------------
RPOC_SULNB      ------------------------------------------------------------
RPOC_GRAFK      ------------------------------------------------------------
RPOC_PORGI      ------------------------------------------------------------
RPOC_CYTH3      ------------------------------------------------------------
RPOC_SALRD      ------------------------------------------------------------
RPOC_CHLTE      ------------------------------------------------------------
RPOC_RHOBA      ------------------------------------------------------------
RPOC_PARUW      ------------------------------------------------------------
RPOC_AQUAE      ------------------------------------------------------------
RPOC_CARRP      ------------------------------------------------------------
RPOC_THEMA      ITGREITWIIVKNITRATHTVLPGMILVVKDGQEVEKGQDLTKEMTIDPVYAPFDGHVEI
RPOC_MYCPE      YESIDVEA----------------------------------------------------
RPOC_MYCGA      KDKHQAD-----------------------------------------------------
RPOC_UREPA      QERIEDELNHERE-----------------------------------------------
RPOC_MYCPN      FRNLIKN-----------------------------------------------------
RPOC_MYCMO      NEIIEEIS----------------------------------------------------
RPOC_MYCPU      LEIIDGTI----------------------------------------------------
RPOC_MYCH2      HNALAESI----------------------------------------------------
RPOC_MYCS5      YEEILDTL----------------------------------------------------
                                                                            

RPOC_DEIRA      ADTLVEQETFRAGEILAELEQDVQITAPVAGTVFMHDLGEDSVMIELREGVEANDSDEEE
RPOC_THET8      LAAWVEKEAYKPGEILAELPEPYLFRAEEEGVVELKELEEGAFLVLRRED----------
RPOC_TREPA      ------------------YNDAQERYGGG-------------------------------
RPOC_BORAP      ------------------YIEARERYGMS-------------------------------
RPOC_LEPIC      ------------------YHGYLDEYGDK-------------------------------
RPOC_FUSNN      ------------------YKLLKQLYGNK-------------------------------
RPOC_CALS4      ------------------YREYLEKYGNR-------------------------------
RPOC_SYMTH      ------------------YREYREKYGDA-------------------------------
RPOC_LACSS      ------------------YREKLDEYGNK-------------------------------
RPOC_LEUMM      ------------------YRQLKKEYGAG-------------------------------
RPOC_STRMU      ------------------YREKLQEYGSGS------------------------------
RPOC_STRP7      ------------------YRERLREYGYGS------------------------------
RPOC_STAS1      ------------------FREYYDKFPGK-------------------------------
RPOC_ARTS2      WDRFKNLKVADLEGDEGLYRELRDRYGM--------------------------------
RPOC_LEIXX      WESFRTLKVGDLKPEDADFNELLDRFGL--------------------------------
RPOC_CORJK      WNTFVKLAPKQMIVDENIYNELVDRYED--------------------------------
RPOC_CUTAK      WDRFKNLKVQDLEGDEILYREMKSRFGK--------------------------------
RPOC_BIFLO      FDKFKKLKPGDMVDDVDLWREMQDRYGD--------------------------------
RPOC_TROWT      WDSFKALKVGGLYAEDDVFRDVQDRYGD--------------------------------
RPOC_RUBXD      WEEFQTLEPRQIVDDEELFREMKDRFGDEYGY----------------------------
RPOC_DEHMC      LKDLQK----GNLLTENQYYELKQRFSNV-------------------------------
RPOC_ECOLI      ------------------YLDALEEFGDE-------------------------------
RPOC_BUCCC      ------------------YIQALEENEDE-------------------------------
RPOC_PSEHT      ------------------YLDALEEHGDE-------------------------------
RPOC_ALCBS      ------------------YFDAMEEFGDE-------------------------------
RPOC_METCA      ------------------YQKLVEQYDDE-------------------------------
RPOC_XYLFT      ------------------YLQARQEHADD-------------------------------
RPOC_COXBU      ------------------YLDALEEYGDD-------------------------------
RPOC_PSYCK      ------------------YYKALEEFGDE-------------------------------
RPOC_HYDCU      ------------------YLDAMDEYGDE-------------------------------
RPOC_BURM1      ------------------YYNKVEEYGDE-------------------------------
RPOC_NITMU      ------------------YRAKTEEYGDD-------------------------------
RPOC_FRATT      ------------------YAEALENYGYE-------------------------------
RPOC_SYNAS      ------------------YNDLREQYGPDG------------------------------
RPOC_PELCD      ------------------YAETMEEYAGQ-------------------------------
RPOC_DESPS      ------------------YRQALSEYPAQ-------------------------------
RPOC_BDEBA      ------------------LQAALNEFGPS-------------------------------
RPOC_LAWIP      ------------------YLQVIEHINEES------------------------------
RPOC_CAUVC      ------------------YMRAQEEYGDDS------------------------------
RPOC_RHOPB      ------------------YLRAQDEYGQDS------------------------------
RPOC_RHOS4      ------------------FLDAQDQYGADA------------------------------
RPOC_ZYMMO      ------------------LLEAQDQYGEDS------------------------------
RPOC_GLUOX      ------------------CEDLLDEYPDAG------------------------------
RPOC_RICBR      ------------------LQKAKDKYGEDA------------------------------
RPOC_ORITB      ------------------LQQAQNEYGEDN------------------------------
RPOC_NEOSM      ------------------YMNAVREYGPDS------------------------------
RPOC_EHRRW      ------------------YNQAKDNYGEDS------------------------------
RPOC_SULDN      ------------------YRTLVSRFGELG------------------------------
RPOC_SULNB      ------------------YQQISSRFGDTG------------------------------
RPOC_GRAFK      ------------------YLNILDELPQEN------------------------------
RPOC_PORGI      ------------------YLDKLDEIERTHKGN---------------------------
RPOC_CYTH3      ------------------YLDILDKLPREN------------------------------
RPOC_SALRD      ------------------YYEILYQIRDDN------------------------------
RPOC_CHLTE      ------------------YFQIITEYEDNQ------------------------------
RPOC_RHOBA      ------------------YRAARQQYGSGS------------------------------
RPOC_PARUW      ------------------YREAQEKWGRDS------------------------------
RPOC_AQUAE      ------------------FEEKYAFTIDEK------------------------------
RPOC_CARRP      -----------------FNLFIFDKKIKNI------------------------------
RPOC_THEMA      DELSNTITLKPLTTSKDQPVVFTIPYGAKILVSNGQKVKKGDQITTSTSL----------
RPOC_MYCPE      ------------SMENAIKHKIARTFYDTLA-----------------------------
RPOC_MYCGA      --------------KHSIIYKRASDYYNKLK-----------------------------
RPOC_UREPA      ------------ALIQDFDYRLAVTYDQMLK-----------------------------
RPOC_MYCPN      --------------RSSEDYRKGKIFYESLK-----------------------------
RPOC_MYCMO      ---------------EALVNLAELKNANSSKKENSKQ-----------------------
RPOC_MYCPU      ---------------NHLNDIVGSKVGN--------------------------------
RPOC_MYCH2      ---------------SELADVTSSKIGR--------------------------------
RPOC_MYCS5      ---------------NDLKEYAASKTGQ--------------------------------
                                                                            

RPOC_DEIRA      AADPIRGEVLARVYVPHGMNVQVAEGEVIEAGALLADASEGARLRVSRDSNLSGVTFPKK
RPOC_THET8      -------EPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAAQVEAEEEGE
RPOC_TREPA      ------------------------------------------------------------
RPOC_BORAP      ------------------------------------------------------------
RPOC_LEPIC      ------------------------------------------------------------
RPOC_FUSNN      ------------------------------------------------------------
RPOC_CALS4      ------------------------------------------------------------
RPOC_SYMTH      ------------------------------------------------------------
RPOC_LACSS      ------------------------------------------------------------
RPOC_LEUMM      ------------------------------------------------------------
RPOC_STRMU      ------------------------------------------------------------
RPOC_STRP7      ------------------------------------------------------------
RPOC_STAS1      ------------------------------------------------------------
RPOC_ARTS2      ------------------------------------------------------------
RPOC_LEIXX      ------------------------------------------------------------
RPOC_CORJK      ------------------------------------------------------------
RPOC_CUTAK      ------------------------------------------------------------
RPOC_BIFLO      ------------------------------------------------------------
RPOC_TROWT      ------------------------------------------------------------
RPOC_RUBXD      ------------------------------------------------------------
RPOC_DEHMC      ------------------------------------------------------------
RPOC_ECOLI      ------------------------------------------------------------
RPOC_BUCCC      ------------------------------------------------------------
RPOC_PSEHT      ------------------------------------------------------------
RPOC_ALCBS      ------------------------------------------------------------
RPOC_METCA      ------------------------------------------------------------
RPOC_XYLFT      ------------------------------------------------------------
RPOC_COXBU      ------------------------------------------------------------
RPOC_PSYCK      ------------------------------------------------------------
RPOC_HYDCU      ------------------------------------------------------------
RPOC_BURM1      ------------------------------------------------------------
RPOC_NITMU      ------------------------------------------------------------
RPOC_FRATT      ------------------------------------------------------------
RPOC_SYNAS      ------------------------------------------------------------
RPOC_PELCD      ------------------------------------------------------------
RPOC_DESPS      ------------------------------------------------------------
RPOC_BDEBA      ------------------------------------------------------------
RPOC_LAWIP      ------------------------------------------------------------
RPOC_CAUVC      ------------------------------------------------------------
RPOC_RHOPB      ------------------------------------------------------------
RPOC_RHOS4      ------------------------------------------------------------
RPOC_ZYMMO      ------------------------------------------------------------
RPOC_GLUOX      ------------------------------------------------------------
RPOC_RICBR      ------------------------------------------------------------
RPOC_ORITB      ------------------------------------------------------------
RPOC_NEOSM      ------------------------------------------------------------
RPOC_EHRRW      ------------------------------------------------------------
RPOC_SULDN      ------------------------------------------------------------
RPOC_SULNB      ------------------------------------------------------------
RPOC_GRAFK      ------------------------------------------------------------
RPOC_PORGI      ------------------------------------------------------------
RPOC_CYTH3      ------------------------------------------------------------
RPOC_SALRD      ------------------------------------------------------------
RPOC_CHLTE      ------------------------------------------------------------
RPOC_RHOBA      ------------------------------------------------------------
RPOC_PARUW      ------------------------------------------------------------
RPOC_AQUAE      ------------------------------------------------------------
RPOC_CARRP      ------------------------------------------------------------
RPOC_THEMA      --------------------------------------PAVKASISGTVRFGSNLNIRAL
RPOC_MYCPE      ------------------------------------------------------------
RPOC_MYCGA      ------------------------------------------------------------
RPOC_UREPA      ------------------------------------------------------------
RPOC_MYCPN      ------------------------------------------------------------
RPOC_MYCMO      ------------------------------------------------------------
RPOC_MYCPU      ------------------------------------------------------------
RPOC_MYCH2      ------------------------------------------------------------
RPOC_MYCS5      ------------------------------------------------------------
                                                                            

RPOC_DEIRA      KGDVTVTAHWTRRVEYPIDPTMHVLVGDGSEVTKGQRVIGAIDKEEEVIAEADGVITLHQ
RPOC_THET8      TVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHE
RPOC_TREPA      ------------------------------------------------------------
RPOC_BORAP      ------------------------------------------------------------
RPOC_LEPIC      ------------------------------------------------------------
RPOC_FUSNN      ------------------------------------------------------------
RPOC_CALS4      ------------------------------------------------------------
RPOC_SYMTH      ------------------------------------------------------------
RPOC_LACSS      ------------------------------------------------------------
RPOC_LEUMM      ------------------------------------------------------------
RPOC_STRMU      ------------------------------------------------------------
RPOC_STRP7      ------------------------------------------------------------
RPOC_STAS1      ------------------------------------------------------------
RPOC_ARTS2      ------------------------------------------------------------
RPOC_LEIXX      ------------------------------------------------------------
RPOC_CORJK      ------------------------------------------------------------
RPOC_CUTAK      ------------------------------------------------------------
RPOC_BIFLO      ------------------------------------------------------------
RPOC_TROWT      ------------------------------------------------------------
RPOC_RUBXD      ------------------------------------------------------------
RPOC_DEHMC      ------------------------------------------------------------
RPOC_ECOLI      ------------------------------------------------------------
RPOC_BUCCC      ------------------------------------------------------------
RPOC_PSEHT      ------------------------------------------------------------
RPOC_ALCBS      ------------------------------------------------------------
RPOC_METCA      ------------------------------------------------------------
RPOC_XYLFT      ------------------------------------------------------------
RPOC_COXBU      ------------------------------------------------------------
RPOC_PSYCK      ------------------------------------------------------------
RPOC_HYDCU      ------------------------------------------------------------
RPOC_BURM1      ------------------------------------------------------------
RPOC_NITMU      ------------------------------------------------------------
RPOC_FRATT      ------------------------------------------------------------
RPOC_SYNAS      ------------------------------------------------------------
RPOC_PELCD      ------------------------------------------------------------
RPOC_DESPS      ------------------------------------------------------------
RPOC_BDEBA      ------------------------------------------------------------
RPOC_LAWIP      ------------------------------------------------------------
RPOC_CAUVC      ------------------------------------------------------------
RPOC_RHOPB      ------------------------------------------------------------
RPOC_RHOS4      ------------------------------------------------------------
RPOC_ZYMMO      ------------------------------------------------------------
RPOC_GLUOX      ------------------------------------------------------------
RPOC_RICBR      ------------------------------------------------------------
RPOC_ORITB      ------------------------------------------------------------
RPOC_NEOSM      ------------------------------------------------------------
RPOC_EHRRW      ------------------------------------------------------------
RPOC_SULDN      ------------------------------------------------------------
RPOC_SULNB      ------------------------------------------------------------
RPOC_GRAFK      ------------------------------------------------------------
RPOC_PORGI      ------------------------------------------------------------
RPOC_CYTH3      ------------------------------------------------------------
RPOC_SALRD      ------------------------------------------------------------
RPOC_CHLTE      ------------------------------------------------------------
RPOC_RHOBA      ------------------------------------------------------------
RPOC_PARUW      ------------------------------------------------------------
RPOC_AQUAE      ------------------------------------------------------------
RPOC_CARRP      ------------------------------------------------------------
RPOC_THEMA      EDGNFEVLSTGEVYVEQVIEERKYPVFEGALVYVNNGDQVKKGDHLADRFLFEEEYLSAT
RPOC_MYCPE      ------------------------------------------------------------
RPOC_MYCGA      ------------------------------------------------------------
RPOC_UREPA      ------------------------------------------------------------
RPOC_MYCPN      ------------------------------------------------------------
RPOC_MYCMO      ------------------------------------------------------------
RPOC_MYCPU      ------------------------------------------------------------
RPOC_MYCH2      ------------------------------------------------------------
RPOC_MYCS5      ------------------------------------------------------------
                                                                            

RPOC_DEIRA      PASILVSKAKVYAYDDEPLVVNGDRVEPGDELADDGNLRSEISGRIELDLVRKQVRVIES
RPOC_THET8      PASILVVKARVYPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVES
RPOC_TREPA      ------------------------------------------------------------
RPOC_BORAP      ------------------------------------------------------------
RPOC_LEPIC      ------------------------------------------------------------
RPOC_FUSNN      ------------------------------------------------------------
RPOC_CALS4      ------------------------------------------------------------
RPOC_SYMTH      ------------------------------------------------------------
RPOC_LACSS      ------------------------------------------------------------
RPOC_LEUMM      ------------------------------------------------------------
RPOC_STRMU      ------------------------------------------------------------
RPOC_STRP7      ------------------------------------------------------------
RPOC_STAS1      ------------------------------------------------------------
RPOC_ARTS2      ------------------------------------------------------------
RPOC_LEIXX      ------------------------------------------------------------
RPOC_CORJK      ------------------------------------------------------------
RPOC_CUTAK      ------------------------------------------------------------
RPOC_BIFLO      ------------------------------------------------------------
RPOC_TROWT      ------------------------------------------------------------
RPOC_RUBXD      -----------------------------------------------------------G
RPOC_DEHMC      ------------------------------------------------------------
RPOC_ECOLI      ------------------------------------------------------------
RPOC_BUCCC      ------------------------------------------------------------
RPOC_PSEHT      ------------------------------------------------------------
RPOC_ALCBS      ------------------------------------------------------------
RPOC_METCA      ------------------------------------------------------------
RPOC_XYLFT      ------------------------------------------------------------
RPOC_COXBU      ------------------------------------------------------------
RPOC_PSYCK      ------------------------------------------------------------
RPOC_HYDCU      ------------------------------------------------------------
RPOC_BURM1      ------------------------------------------------------------
RPOC_NITMU      ------------------------------------------------------------
RPOC_FRATT      ------------------------------------------------------------
RPOC_SYNAS      ------------------------------------------------------------
RPOC_PELCD      ------------------------------------------------------------
RPOC_DESPS      ------------------------------------------------------------
RPOC_BDEBA      ------------------------------------------------------------
RPOC_LAWIP      ------------------------------------------------------------
RPOC_CAUVC      ------------------------------------------------------------
RPOC_RHOPB      ------------------------------------------------------------
RPOC_RHOS4      ------------------------------------------------------------
RPOC_ZYMMO      ------------------------------------------------------------
RPOC_GLUOX      ------------------------------------------------------------
RPOC_RICBR      ------------------------------------------------------------
RPOC_ORITB      ------------------------------------------------------------
RPOC_NEOSM      ------------------------------------------------------------
RPOC_EHRRW      ------------------------------------------------------------
RPOC_SULDN      ------------------------------------------------------------
RPOC_SULNB      ------------------------------------------------------------
RPOC_GRAFK      ----------------------------------------------------QYLDDSDP
RPOC_PORGI      ----------------------------------------------------QNLEDTNP
RPOC_CYTH3      ----------------------------------------------------QLLDDKDP
RPOC_SALRD      ----------------------------------------------------NRLQDDNE
RPOC_CHLTE      -----------------------------------------------------DLEDNDP
RPOC_RHOBA      ------------------------------------------------------------
RPOC_PARUW      ------------------------------------------------------------
RPOC_AQUAE      ------------------------------------------------------------
RPOC_CARRP      ------------------------------------------------------------
RPOC_THEMA      EYKIFESHYPTMFDVEERTENDRPIVVITDIDPEVSKETGLKVGDIVTENEYEAYLQIYP
RPOC_MYCPE      ------------------------------------------ESNMPFSIEEVFNFISSF
RPOC_MYCGA      ------------------------------------------ESHLPFSIDEVAKFIETH
RPOC_UREPA      ------------------------------------------DSNIPFSVKDVMAFIEKH
RPOC_MYCPN      ------------------------------------------NSSLPFSLNDAFNYIKKY
RPOC_MYCMO      ------------------------------------------EKDYGIDFYEYNEIIEEY
RPOC_MYCPU      --------------------------------------------DYGVDFYELNEVIEEY
RPOC_MYCH2      --------------------------------------------EYGVDYYELNEIIEEF
RPOC_MYCS5      --------------------------------------------DYGIDFYEYNEIIEEY
                                                                            

RPOC_DEIRA      YDFEAKMGAEAVKELLDELNLDELETE---------------------------------
RPOC_THET8      YDIDARMGAEAIQQLLKELDLEALEKE---------------------------------
RPOC_TREPA      --FTAGMGAEAIRTLLQNLDLDALVAQ---------------------------------
RPOC_BORAP      --FNASMGAEAIKSLLENLDLDELSSK---------------------------------
RPOC_LEPIC      --FVAGIGADAIKELLARIDVDAEARM---------------------------------
RPOC_FUSNN      --FEAYMGADGILKLLTAIDLEKLRDE---------------------------------
RPOC_CALS4      --FRAGMGAEAIKELLQEIDLEKLSKE---------------------------------
RPOC_SYMTH      --FKAGMGAEAVKVLLEKLDLDKMAEE---------------------------------
RPOC_LACSS      --FNAKMGAEAIKELLQDVDLEGEVAE---------------------------------
RPOC_LEUMM      --FKAGMGAEAIKELLANVDLATEADE---------------------------------
RPOC_STRMU      --FIAKMGAEAIQDLLKRVDLDAEIAE---------------------------------
RPOC_STRP7      --FVAKMGAEAIQDLLKQVDLEKEIAE---------------------------------
RPOC_STAS1      --FTAKMGAEGIKELLEEIDLDAELKH---------------------------------
RPOC_ARTS2      -YFEGSMGAEAIKKRLENFDMQAESDL---------------------------------
RPOC_LEIXX      -YFEAFMGAEAIKRRLQAFDLNQEAEL---------------------------------
RPOC_CORJK      -YFTGGMGAEAIQTLIRSFDLEAEAES---------------------------------
RPOC_CUTAK      -YFEGSMGAEAVKRRLHDFDLKSESEK---------------------------------
RPOC_BIFLO      -YFDGCMGAEAIKKRLQSLDLETISKE---------------------------------
RPOC_TROWT      -YFDACMGAEAIKRRLEDFDLQKTAQE---------------------------------
RPOC_RUBXD      VYFRGGMGAEAIRDLIRQVDLEKEARE---------------------------------
RPOC_DEHMC      --FEASMGAEALLKLLSYIDMDKERSK---------------------------------
RPOC_ECOLI      --FDAKMGAEAIQALLKSMDLEQECEQ---------------------------------
RPOC_BUCCC      --FEAKMGAEAIQNLLKNMDLKKTCKI---------------------------------
RPOC_PSEHT      --FEAKMGAEAVLDLLRELDLAQLIAE---------------------------------
RPOC_ALCBS      --FEAKMGAEAVQQLLMELDLVEEIKI---------------------------------
RPOC_METCA      --FTAKMGAEAIRELLRTMDLHAEVVQ---------------------------------
RPOC_XYLFT      --FDASMGAEAVYELLRMIDLQSEMAR---------------------------------
RPOC_COXBU      --FTALMGAEAIQRLLRDIDVEAEVEA---------------------------------
RPOC_PSYCK      --FTAKMGAEAVQDLLKDIDLDLEIDE---------------------------------
RPOC_HYDCU      --FEAQMGAEAIKKMLQAIDLDAEATR---------------------------------
RPOC_BURM1      --FRAEMGAEGVRELLRAINIDEQVEQ---------------------------------
RPOC_NITMU      --FRASMGAEGIRDLLNTLNIRVEIDD---------------------------------
RPOC_FRATT      --FEASMGAEAIRDLLADTDIESEIEL---------------------------------
RPOC_SYNAS      --FQAGIGAEAVRKLLEEVDLEGLDVE---------------------------------
RPOC_PELCD      --FVATMGAEAIRDFLLSIDIEELSTV---------------------------------
RPOC_DESPS      --FKVGIGAEAIRELLAAQDLIGLSRV---------------------------------
RPOC_BDEBA      --FKYGMGGEAVRDLLKKIDPEYLSRK---------------------------------
RPOC_LAWIP      --FVVGMGAEAIRGLLEELNLETLRNS---------------------------------
RPOC_CAUVC      --FTAEIGAEAIQNLLKAIDLEKEAER---------------------------------
RPOC_RHOPB      --FTAMIGAEAIRELLKGLELEKLEAS---------------------------------
RPOC_RHOS4      --FTANIGAEAIREMLSAIDLEQTAET---------------------------------
RPOC_ZYMMO      --FSAGIGAEAVKKLLEALDLETERED---------------------------------
RPOC_GLUOX      --IDVGIGAEAIKRALSSYDWGIPNDQERELSLAAKEKGLPDPFDYDADVMEGDSEKTM-
RPOC_RICBR      --FTASIGAEVVQQMLKELDFPTLKQE---------------------------------
RPOC_ORITB      --FIVGIGAEAIRTLLAELDLKSLRNA---------------------------------
RPOC_NEOSM      --FTAMIGAEAIRHMLASLDLEKMAVK---------------------------------
RPOC_EHRRW      --FIALTGAEAIRELLVRLDLHAINAN---------------------------------
RPOC_SULDN      --FKARMGGEVVRDLLDSIDLVDLFTQ---------------------------------
RPOC_SULNB      --LDARMGGEIVQELLADLDLVDMFAQ---------------------------------
RPOC_GRAFK      NKFIAKMGAECLIEILKRIDLDELSYE---------------------------------
RPOC_PORGI      DKFIAKIGAEAIYDLLCRVDLDSISYE---------------------------------
RPOC_CYTH3      NKFIAKMGADALETLLSRLNLDELSYS---------------------------------
RPOC_SALRD      EKFIAKIGGEAVETMLERLELDKLAQE---------------------------------
RPOC_CHLTE      AKFVAKMGGEAIHMLLKGLNLDEIALN---------------------------------
RPOC_RHOBA      --FQADMGAEAVRDLLNKLDLVTLSDQ---------------------------------
RPOC_PARUW      --FVAKMGGEAIRDLLASEDLQTQLVE---------------------------------
RPOC_AQUAE      --YEHGMGAEILKEVLSKLDLDAYSRKLKEIVKPYSIGFEDLGKEIEQKYKNLYQKLIKV
RPOC_CARRP      --IFTLSGAKALKKLLSDRELFIDCLI---------------------------------
RPOC_THEMA      EKIVADAGAQAIKKLLQNLDLEALQAE---------------------------------
RPOC_MYCPE      TGMRFGIGAEAILELLKNIDLDKEYKD---------------------------------
RPOC_MYCGA      TGIRLGIGAEAILELLEGVDLQKEYDL---------------------------------
RPOC_UREPA      TGVRFGIGAEAIRELLEKLNLEEEHEK---------------------------------
RPOC_MYCPN      TGFRVGIGAEAILELLNKIDLNYEFSK---------------------------------
RPOC_MYCMO      SGAKIKTGSEAVEYLLKNFDLTAEQEV---------------------------------
RPOC_MYCPU      SSAKIQTGSKAIEFLLENIDLEEEQRK---------------------------------
RPOC_MYCH2      SSARIATGALAIEYLLDKIDLRAEKAA---------------------------------
RPOC_MYCS5      SQAKIGTGSKAIEYLLKNIDLEKESKE---------------------------------
                       *.  :   :   :                                        

RPOC_DEIRA      ------------------------------------------------------------
RPOC_THET8      ------------------------------------------------------------
RPOC_TREPA      ------------------------------------------------------------
RPOC_BORAP      ------------------------------------------------------------
RPOC_LEPIC      ------------------------------------------------------------
RPOC_FUSNN      ------------------------------------------------------------
RPOC_CALS4      ------------------------------------------------------------
RPOC_SYMTH      ------------------------------------------------------------
RPOC_LACSS      ------------------------------------------------------------
RPOC_LEUMM      ------------------------------------------------------------
RPOC_STRMU      ------------------------------------------------------------
RPOC_STRP7      ------------------------------------------------------------
RPOC_STAS1      ------------------------------------------------------------
RPOC_ARTS2      ------------------------------------------------------------
RPOC_LEIXX      ------------------------------------------------------------
RPOC_CORJK      ------------------------------------------------------------
RPOC_CUTAK      ------------------------------------------------------------
RPOC_BIFLO      ------------------------------------------------------------
RPOC_TROWT      ------------------------------------------------------------
RPOC_RUBXD      ------------------------------------------------------------
RPOC_DEHMC      ------------------------------------------------------------
RPOC_ECOLI      ------------------------------------------------------------
RPOC_BUCCC      ------------------------------------------------------------
RPOC_PSEHT      ------------------------------------------------------------
RPOC_ALCBS      ------------------------------------------------------------
RPOC_METCA      ------------------------------------------------------------
RPOC_XYLFT      ------------------------------------------------------------
RPOC_COXBU      ------------------------------------------------------------
RPOC_PSYCK      ------------------------------------------------------------
RPOC_HYDCU      ------------------------------------------------------------
RPOC_BURM1      ------------------------------------------------------------
RPOC_NITMU      ------------------------------------------------------------
RPOC_FRATT      ------------------------------------------------------------
RPOC_SYNAS      ------------------------------------------------------------
RPOC_PELCD      ------------------------------------------------------------
RPOC_DESPS      ------------------------------------------------------------
RPOC_BDEBA      ------------------------------------------------------------
RPOC_LAWIP      ------------------------------------------------------------
RPOC_CAUVC      ------------------------------------------------------------
RPOC_RHOPB      ------------------------------------------------------------
RPOC_RHOS4      ------------------------------------------------------------
RPOC_ZYMMO      ------------------------------------------------------------
RPOC_GLUOX      ------------------------------------------------------------
RPOC_RICBR      ------------------------------------------------------------
RPOC_ORITB      ------------------------------------------------------------
RPOC_NEOSM      ------------------------------------------------------------
RPOC_EHRRW      ------------------------------------------------------------
RPOC_SULDN      ------------------------------------------------------------
RPOC_SULNB      ------------------------------------------------------------
RPOC_GRAFK      ------------------------------------------------------------
RPOC_PORGI      ------------------------------------------------------------
RPOC_CYTH3      ------------------------------------------------------------
RPOC_SALRD      ------------------------------------------------------------
RPOC_CHLTE      ------------------------------------------------------------
RPOC_RHOBA      ------------------------------------------------------------
RPOC_PARUW      ------------------------------------------------------------
RPOC_AQUAE      IADDFRAYGVEIKGLEDHGLSLEQAIHRILNEELYLNVETGEISLEDCGDSCLTGRDALK
RPOC_CARRP      ------------------------------------------------------------
RPOC_THEMA      ------------------------------------------------------------
RPOC_MYCPE      ------------------------------------------------------------
RPOC_MYCGA      ------------------------------------------------------------
RPOC_UREPA      ------------------------------------------------------------
RPOC_MYCPN      ------------------------------------------------------------
RPOC_MYCMO      ------------------------------------------------------------
RPOC_MYCPU      ------------------------------------------------------------
RPOC_MYCH2      ------------------------------------------------------------
RPOC_MYCS5      ------------------------------------------------------------
                                                                            

RPOC_DEIRA      ------------------LNEQMKDN-------------SRHKRAKARKRLEVTRSFKAS
RPOC_THET8      ------------------LLEEMKHP-------------SRARRAKARKRLEVVRAFLDS
RPOC_TREPA      ------------------LREKMMEK------------GAKSD-KRLLRRIEIVENFRVS
RPOC_BORAP      ------------------LRIQMIDK------------DDKTD-KKLLRRLEIIENFKIS
RPOC_LEPIC      ------------------IRQKIQDK------------DKISD-KRILKRLEVLEAFRDS
RPOC_FUSNN      ------------------LENELAEA------------NSAQKRKKLVKRLKIVRDFIAS
RPOC_CALS4      ------------------LRAEIKES------------TGQKR-VRAIRRLEVVQAFIDS
RPOC_SYMTH      ------------------LRHEVRTV------------SGQRK-IRATRRLEVVEAFRKS
RPOC_LACSS      ------------------LKENLKSA------------QGQKR-TRAIRRLDILDAFRKS
RPOC_LEUMM      ------------------LKRELQEA------------TGQKR-VRAVRRLDIIEAFLQS
RPOC_STRMU      ------------------LKEELKTA------------SGQKR-VKAIRRLDVLDAFQKS
RPOC_STRP7      ------------------LKEELKTA------------TGQKR-VKAIRRLDVLDAFYKS
RPOC_STAS1      ------------------LRDELESA------------TGQRL-TRAIKRLEVVESFRHS
RPOC_ARTS2      ------------------LRDIIANG------------KGQRK-TRALKRLKVVNAFLTT
RPOC_LEIXX      ------------------LREQIATG------------KGQKK-IRAIKRLRVVSSFLAT
RPOC_CORJK      ------------------LREVIRDG------------KGQKK-LRALKRLKVVAAFLRS
RPOC_CUTAK      ------------------LREIIKTG------------RGQKK-TRALKRLKVVQAFLDS
RPOC_BIFLO      ------------------LREEIKDA------------SEQRK-TKALKRLKVVNAFLTT
RPOC_TROWT      ------------------LGVQIVEC------------RGQRK-VRAIKRLRVVNSFITS
RPOC_RUBXD      ------------------LRQVVGES------------RGQKR-QKAIKRLKVVDAFRTS
RPOC_DEHMC      ------------------LIQETRST------------SGQRR-KKAGKQLQLVEAFRRS
RPOC_ECOLI      ------------------LREELNET------------NSETKRKKLTKRIKLLEAFVQS
RPOC_BUCCC      ------------------LKKEVLKV------------NSETKRKKVTKRIKLIESLLTS
RPOC_PSEHT      ------------------MREELPTI------------NSETKRKKITKRLKLMESFHQS
RPOC_ALCBS      ------------------LREEVEST------------NSDTKLKKLSKRLKLMEAFKDS
RPOC_METCA      ------------------LREEINGT------------NSETKIKKYTKRLKAIESMLAS
RPOC_XYLFT      ------------------LREEIVVT------------GSETKLKRLTKRIKLIEAFIES
RPOC_COXBU      ------------------LRTELQTT------------TSETKTKKLTKRLKVLSAFLES
RPOC_PSYCK      ------------------LREAIPQT------------GSETKLKKMSKRLKLLEAFRDS
RPOC_HYDCU      ------------------LREEMEAT------------SSETKQKKISKRLKLIDSFVQS
RPOC_BURM1      ------------------LRTELKNT------------GSEAKIKKYAKRLKVLEAFQRS
RPOC_NITMU      ------------------LRREMGTT------------GSETKMKKISKRLKVLEAFSKS
RPOC_FRATT      ------------------LQAECEES------------KSTAKKEKAIKRLRLLETFQAS
RPOC_SYNAS      ------------------LRDELKTA------------SSDTKRKKVIKRLKVIEALRKS
RPOC_PELCD      ------------------LRKEMSEA------------ASEAKRKKVAKRLKVVEAFKFS
RPOC_DESPS      ------------------LREEMAST------------SSQTKRQKLGKRLFVIEAFRDS
RPOC_BDEBA      ------------------LRLEVKDT------------KSEAGIKKLTKRLRVVEAFKGS
RPOC_LAWIP      ------------------LREESQST------------KSQTKKKKLTKRLKVVEAFIES
RPOC_CAUVC      ------------------LREELSGT------------VSDMKQKKFSKRLKILEAFQES
RPOC_RHOPB      ------------------LRVEMQET------------ESDIKHKKLAKRLKIVEAFRFS
RPOC_RHOS4      ------------------LREELKEA------------TGELKPKKIIKRLKIVESFLES
RPOC_ZYMMO      ------------------LLEELKHT------------KSELKPKKIIKRLKVVESFIES
RPOC_GLUOX      ------------------MRKKLRKA------------TSEAARKKLVKRLKLVEAFVES
RPOC_RICBR      ------------------LYEELQNT------------TSEVKKKKLVKRLKLVEDFLES
RPOC_ORITB      ------------------LQEEVNNVI-----------NSDFKRKKILRRLKLIEDFIGS
RPOC_NEOSM      ------------------LRSQAAAT------------NSEVKKKKIIKTLRLVEQFLGS
RPOC_EHRRW      ------------------LRSELEST------------TSEMKRKKIVKRLRIVENFINS
RPOC_SULDN      ------------------LKEDIELT------------KSEAKTKTIAKRLKVIESFLNS
RPOC_SULNB      ------------------LKEDIQAT------------KSEAKRKTIVKRLKVIEAFLHS
RPOC_GRAFK      ------------------LRHKANNE------------TSKQRKTEALKRLQVVEALRDA
RPOC_PORGI      ------------------LRDRANTD------------GSQQRKTEALKRLQVVESFRAS
RPOC_CYTH3      ------------------LRHAAAND------------TSQQRKAEALKRLKVVEAFRDA
RPOC_SALRD      ------------------LRYQVRTE------------TSQQRKSKALKRLDVVEAFREA
RPOC_CHLTE      ------------------LRKVLKES------------GSEQKRADALKRLKVVEAFRKS
RPOC_RHOBA      ------------------LRVDLAET------------GSKQKKKDLINRLKIVESIRDS
RPOC_PARUW      ------------------LKDKLRKT------------KSQQARMKLAKRLKIIESFVSS
RPOC_AQUAE      EYYERVREHKKDIPIFEKIKEDIRSTVLRE--------ISEARIRKALRTLQLVEGFKKS
RPOC_CARRP      ------------------LKIKIKKC------------NSFSKLFSILKHINKILIFYYS
RPOC_THEMA      ------------------IEAELKKLP-----------SSSSKAIKLRRRLKMVKDFLKS
RPOC_MYCPE      ------------------IYEKLRK----------SENTSDIKTKKLVRRLEAIKWLKDS
RPOC_MYCGA      ------------------INEELNSYSKDL-----KANKEDQKVKRALRRLETIKWLKES
RPOC_UREPA      ------------------IKQAIQN----------SPNAYDQKTKRLLRRLECVRWIKDS
RPOC_MYCPN      ------------------LNDALRKAK--------KDSVEDAKVKKILRQLETISWFRNS
RPOC_MYCMO      ------------------IKDKIKALNEAIEKESKTSQSKVEERKKLYKRLSIINAFINS
RPOC_MYCPU      ------------------IKSKIKEINNLE----KTSSSRKQDLSKLYKRLQVVESFINS
RPOC_MYCH2      ------------------VEAELAGVQKQIYK-NKKIILKNQKRDKLYKRLQVINAFINS
RPOC_MYCS5      ------------------IQDEIDTINDQNK--YEISSSEALKRNKLYKRLAIIKSFLKS
                                  :                             . :     :  :

RPOC_DEIRA      ---------------------------GNNPSWMILGTVPVMPPDLRPMVQVDGGRFATS
RPOC_THET8      ---------------------------GNRPEWMILEAVPVLPPDLRPMVQVDGGRFATS
RPOC_TREPA      ---------------------------GNKPEWMILSVIPVIPPDLRPMVQLDGGRFATS
RPOC_BORAP      ---------------------------GNKPEWMIMEVLPVIPPEIRPMVQLDGGRFATS
RPOC_LEPIC      ---------------------------GNRPEWMVLDIVPVIPPELRPMVQLEGGRFATS
RPOC_FUSNN      ---------------------------GNRPEWMILTNVPVIPAELRPMVQLDGGRFATS
RPOC_CALS4      ---------------------------GNRPEWMILEVLPVIPPDLRPMVQLDGGRFATS
RPOC_SYMTH      ---------------------------GNRPEWMILEVIPVIPPDLRPMVQLDGGRFATS
RPOC_LACSS      ---------------------------GNRPDWMVMDAIPVIPPDLRPMVQLEGGRFATS
RPOC_LEUMM      ---------------------------DNKPEWMVMEVIPVIPPDLRPMVQLEGGRFATS
RPOC_STRMU      ---------------------------GNKPEWMVLNILPVIPPDLRPMLQLDGGRFATS
RPOC_STRP7      ---------------------------GNKPEWMILNILPVIPPDLRPMLQLDGGRFASS
RPOC_STAS1      ---------------------------GNNPAWMILDVLPIIPPEIRPMVQLDGGRFATS
RPOC_ARTS2      ---------------------------NNSPLGMVLDAVPVIPPELRPMVQLDGGRFATS
RPOC_LEIXX      ---------------------------GNSPAAMVLDVVPVIPPELRPMVQLDGGRFATS
RPOC_CORJK      ---------------------------GNDPAGMVLDCIPVIPPELRPMVQLDGGRFATS
RPOC_CUTAK      ---------------------------GNSPEAMVLDCVPVIPPDLRPMVQLDGGRFATS
RPOC_BIFLO      ---------------------------GNKPEAMVLDVIPVIPPDLRPMVQLDGGRFATS
RPOC_TROWT      ---------------------------KANPACMVLDVIPVIPPELRPMVQLDAGRFAAS
RPOC_RUBXD      ---------------------------GNKPEWMILDAIPVLPPDLRPMVQLDGGRFATS
RPOC_DEHMC      ---------------------------SNKPEWMIMTVLPVLPPDLRPMVQLDGGRFATS
RPOC_ECOLI      ---------------------------GNKPEWMILTVLPVLPPDLRPLVPLDGGRFATS
RPOC_BUCCC      ---------------------------KNKPEWMILTVLPILPPDLRPLVPLDGGRFATS
RPOC_PSEHT      ---------------------------GNNPEWMIMTVLPVLPPDLRPLVPLDGGRFATS
RPOC_ALCBS      ---------------------------GNAPEWMVLTVLPVLPPDLRPLVPLDGGRFATS
RPOC_METCA      ---------------------------NNRPEWMILTVLPVLPPDLRPLVPLDGGRFATS
RPOC_XYLFT      ---------------------------GNRPEWMILTVLPVLPPDLRPLVPLDGGRFATS
RPOC_COXBU      ---------------------------GNKPEWMILTVLPVLPPDLRPLVPLDGGRFATS
RPOC_PSYCK      ---------------------------NNKPEWMVMNILPVLPPDLRPLVPLEGGRFATS
RPOC_HYDCU      ---------------------------GNKPEWMILDVLPVLPPELRPLVPLDGGRFATS
RPOC_BURM1      ---------------------------GIKPEWMILEVLPVLPPELRPLVPLDGGRFATS
RPOC_NITMU      ---------------------------GIKPEWMILAVLPVLPPELRPLVPLDGGRFATS
RPOC_FRATT      ---------------------------GNKPEWMVMTVLPVLPPDLRPLVPIEGGRFATS
RPOC_SYNAS      ---------------------------GNRPEWMILTVLPVIPPDLRPLVPLDGGRFATS
RPOC_PELCD      ---------------------------GNRPEWLILETIPVLPPELRPLVPLDGGRFATS
RPOC_DESPS      ---------------------------GNKPEWMILQVIPVLPPDLRPLVPLEGGRFATS
RPOC_BDEBA      ---------------------------INKPEWMMLEALPVLPPDLRPLVPLDGGRFATS
RPOC_LAWIP      ---------------------------GNRPEWMIMEVIPVIPPELRPLVPLDGGRFATS
RPOC_CAUVC      ---------------------------GNRPEWMVLTVVPVIPPELRPLVPLDGGRFATS
RPOC_RHOPB      ---------------------------GNKPEWMILTVVPVIPPDLRPLVPLDGGRFATS
RPOC_RHOS4      ---------------------------GNRPEWMILTVLPVIPPELRPLVPLDGGRFATS
RPOC_ZYMMO      ---------------------------GNRPEWMILEVIPVIPPELRPLVPLDGGRFATS
RPOC_GLUOX      ---------------------------GSRPDWMIMDIVPVIPPELRPLVPLDGGRFATS
RPOC_RICBR      ---------------------------ENKPEWMIMNVLPVMPPELRPLVMLDGGRFATS
RPOC_ORITB      ---------------------------GNKPEWMIVTVLPIIPPELRPLVMLDAGRFASS
RPOC_NEOSM      ---------------------------DSRPVDMILDVIPVMPPDLRPLVMLDGGRFATS
RPOC_EHRRW      ---------------------------GNKPEWMILTVIPILPPDLRPLVSLENGRPAVS
RPOC_SULDN      ---------------------------GNNPAWMMLTVLPVLPPDLRPLVSLDGGKFAVS
RPOC_SULNB      ---------------------------GNRPEWMMLTQLPVLPPDLRPLVSLDGGKFAVS
RPOC_GRAFK      NK-----------------------NRENNPEWMIMKVVPVIPPELRPLVPLDGGRFATS
RPOC_PORGI      -------------------------KGVNRPEWMVMKVIPVIPPDLRPLVPLDGGRFATS
RPOC_CYTH3      RS-----------------------RIENKPEWMIIRMVPVIPPELRPLVPLDGGRFATS
RPOC_SALRD      NE-----------------------DGTNKPEWMVMRVIPVIPPELRPLVPLDGGRFATS
RPOC_CHLTE      YEPQKRTRKKSTGLFPEEDSPELYIYEGNKPEYMVMEVVPVIPPELRPLVPLEGGRFATS
RPOC_RHOBA      ---------------------------DNRPEWMVLDVIPVIPPDLRPLVLLDSGNFATS
RPOC_PARUW      ---------------------------DNKPEWMIMSCVPVIPPDLRPLVPLDGGRFATS
RPOC_AQUAE      ---------------------------GNRPEWMILEVLPVLPPELRPLVALDGGRFATS
RPOC_CARRP      ---------------------------GNKPSWMVLKKIPVLPPRMRPLIALSEKKFASS
RPOC_THEMA      ---------------------------GNKPEWMVLEVVPVIPPDLRPMIQIEGGRFATT
RPOC_MYCPE      ---------------------------NNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTS
RPOC_MYCGA      ---------------------------GIKASNMILKVIPVTPPDTRPIIQLDGARFTTS
RPOC_UREPA      ---------------------------GSKPEWMVMTRIPVTPSETRPIISLDGGRFTTS
RPOC_MYCPN      ---------------------------KLHPKNMILHTVPVIPPDIRPIIQLDGAKFTTS
RPOC_MYCMO      ---------------------------NQKPESMLIRNLPVIPADLRPLIQLDGGRHSTS
RPOC_MYCPU      ---------------------------GQKPTSMLIYNLPVIPAELRPLVQLDGGRHSTS
RPOC_MYCH2      ---------------------------GQDPKMMIIRNLPVIPADLRPLVQLDGSRHSTS
RPOC_MYCS5      ---------------------------GQKPENLLIYNLPVIPADLRPLVQLDGGRHSTS
                                              .  :::  : : *.  **:: :.  . : :

RPOC_DEIRA      DLNDLYRRLINRNNRLKKLM--SQGAPDMIIRNEKRMLQEAVDALIDNG------RRGSP
RPOC_THET8      DLNDLYRRLINRNNRLKKLL--AQGAPEIIIRNEKRMLQEAVDALLDNG------RRGAP
RPOC_TREPA      DLNDLYRRVIHRNSRLIRLM--ELKAPDIIIRNEKRMLQEAVDALFDNS------KRKPA
RPOC_BORAP      DLNDLYRRVINRNNRLRKLL--LLNAPEIIVRNEKRMLQESVDSLFDNS------HKRKV
RPOC_LEPIC      DLNDLYRRVINRNNRLKRLL--ALKAPEIIVRNEKRMLQEAVDALFDNS------RRKRA
RPOC_FUSNN      DLNDLYRRVINRNNRLKKLL--EIRAPEIVVKNEKRMLQEAVDALIDNG------RRGKP
RPOC_CALS4      DLNDLYRRVINRNNRLKKLL--DLGAPDIIVRNEKRMLQEAVDALIDNG------RRGRP
RPOC_SYMTH      DLNDLYRRVINRNNRLKRLL--DLGAPDIIVRNEKRMLQEAVDALIDNG------RRGRP
RPOC_LACSS      DLNDLYRRVINRNNRLKRLL--DLMAPNIIVQNEKRMLQEAVDALIDNG------RRGRP
RPOC_LEUMM      DLNDLYRRVINRNNRLKRLL--DLNAPGIIVQNEKRMLQEAVDALIDNG------RRGRP
RPOC_STRMU      DLNDLYRRVINRNNRLARLL--ELNAPGIIVQNEKRMLQEAVDALIDNG------RRGRP
RPOC_STRP7      DLNDLYRRVINRNNRLARLL--ELNAPGIIVQNEKRMLQEAVDALIDNG------RRGRP
RPOC_STAS1      DLNDLYRRVINRNNRLKRLL--DLGAPGIIVQNEKRMLQEAVDALIDNG------RRGRP
RPOC_ARTS2      DLNDLYRRVINRNNRLKRLL--DLGAPEIIVNNEKRMLQEAVDSLFDNG------RRGRP
RPOC_LEIXX      DLNDLYRRVINRNNRLRRLL--DLGAPEIIVNNEKRMLQEAVDALFDNG------RRGRP
RPOC_CORJK      DLNDLYRRVINRNNRLKRML--DLGAPEIIVNNEKRMLQESVDALFDNG------RRGRP
RPOC_CUTAK      DLNDLYRRVINRNNRLKRLV--DLGAPEIIVNNEKRMLQEAVDSLFDNG------RRGRP
RPOC_BIFLO      DLNDLYRRVINRNNRLKRLI--ELGAPEIMLNNEKRMLQEAVDSLFDNG------RRGRP
RPOC_TROWT      DLNDLYRRVINRNNRLKRLL--DLGAPRIIVNNEKRMLQEAVDALFDNG------RRGRP
RPOC_RUBXD      DLNDLYRRVINRNNRLKRLL--DLGAPDVIVNNEKRMLQEAVDALFDNG------RRGRA
RPOC_DEHMC      DLNDLYRRVINRNNRLQHLM--EIGAPEIIIRNEKRMLQEAVDSLIDNG------RRGKS
RPOC_ECOLI      DLNDLYRRVINRNNRLKRLL--DLAAPDIIVRNEKRMLQEAVDALLDNG------RRGRA
RPOC_BUCCC      DLNDLYRRVINRNNRLKRLL--ELFAPEIIVRNEKRMLQEAIDALLDNG------RRGRS
RPOC_PSEHT      DLNDLYRRVINRNNRLKRLL--DLAAPDIIVRNEKRMLQEAVDALLDNG------RRGRA
RPOC_ALCBS      DLNDLYRRVINRNNRLKRLL--DLSAPDIIVRNEKRMLQESVDALLDNG------RRGRA
RPOC_METCA      DLNDLYRRVINRNNRLKRLL--DLNAPDIIVRNEKRMLQESVDALLDNG------RRGRA
RPOC_XYLFT      DLNDLYRRVINRNNRLCRLL--ELSAPDIIVRNEKRMLQESVDALLDNG------RRGRA
RPOC_COXBU      DLNDLYRRVINRNNRLKRLL--DLNAPDIIVRNEKRMLQEAVDALLDNG------RRGRA
RPOC_PSYCK      DLNDLYRRVINRNNRLKRLL--ELSAPDIIVRNEKRMLQESVDALLDNG------RRGRA
RPOC_HYDCU      DLNDLYRRVINRNNRLKRLL--DLMAPDIIVRNEKRMLQESVDSMLDNG------RRGRA
RPOC_BURM1      DLNDLYRRVINRNNRLKRLL--ELKAPEIIVRNEKRMLQEAVDSLLDNG------RRGKA
RPOC_NITMU      DLNDLYRRVINRNNRLKRLL--ELKAPEIIVRNEKRMLQEAVDSLLDNG------RRGKA
RPOC_FRATT      DLNDLYRRVINRNNRLKKLL--DLNAPDIIVRNEKRMLQEAVDALLDNG------RRGRA
RPOC_SYNAS      DLNDLYRRVINRNNRLKRLQ--ELNAPEIIIRNEKRMLQEAVDVLFDNG------RRGRA
RPOC_PELCD      DLNDLYRRVINRNNRLKRLM--ELRAPEVIIRNEKRMLQEAVDALFDNG------RRGRA
RPOC_DESPS      DLNDLYRRVINRNNRLKRLL--ELDAPDIIIRNEKRMLQESVDVLFDNG------RRGRV
RPOC_BDEBA      DLNDLYRRVINRNNRLKRLQ--ELNAPDIIIRNEKRMLQEAVDALLDNG------RRGKT
RPOC_LAWIP      DLNDLYRRVINRNNRLKRLM--ELGAPEIIIRNEKRMLQEAVDALFDNG------RRGRA
RPOC_CAUVC      DLNDLYRRVINRNNRLKRLI--ELRAPDIIIRNEKRMLQESVDALFDNG------RRGRV
RPOC_RHOPB      DLNDLYRRVINRNNRLKRLM--ELRAPDIIIRNEKRMLQEAVDALFDNG------RRGRV
RPOC_RHOS4      DLNDLYRRVINRNNRLKRLI--ELRAPDIIVRNEKRMLQEAVDALFDNG------RRGRV
RPOC_ZYMMO      DLNDLYRRVINRNNRLKRLM--DLRAPDIIVRNEKRMLQEAVDALFDNG------RRGRT
RPOC_GLUOX      DLNDLYRRVINRNNRLKRLI--ELRAPDIIVRNEKRMLQEAVDALFDNG------RRGRA
RPOC_RICBR      DLNELYRRVINRNNRLKKLI--ESKAPDIIVRNEKRMLQEAVDALFDNG------RRGRA
RPOC_ORITB      DLNELYRRLINRNNRLKYLKKEEDGVPGIVLRNEQRMVQLSADTLFDNG------KRGKA
RPOC_NEOSM      DLNALYRSVINRNNRLKSLI--YLKAPNIIINNERRMLQEAVDALFDNG------RRAKV
RPOC_EHRRW      DLNHHYRTIINRNNRLGKLL--KLNPPAIMIRNEKRMLQEAVDALFDST------RRSYV
RPOC_SULDN      DVNDLYRRVINRNQRLKRLV--ELEAPEIIVRNEKRMLQESVDALFDNG------RRANA
RPOC_SULNB      DVNDLYRRVINRNQRLKRLV--ELDAPEIIVRNEKRMLQEAVDALFDNG------RRGNA
RPOC_GRAFK      DLNDLYRRVIIRNNRLKRLM--EIKAPEVILRNEKRMLQESVDSLFDNT------RKSSA
RPOC_PORGI      DLNDLYRRVIIRNNRLKRLI--EIKAPEVILRNEKRMLQEAVDSLFDNS------RKSSA
RPOC_CYTH3      DLNDLYRRVIIRNNRLKRLI--EIKAPEVILRNEKRMLQEAVDSLFDNS------RKINA
RPOC_SALRD      DLNDLYRRVIIRNNRLKRLI--DIKAPEVILRNEKRMLQEAVDSLFDNS------RKSNS
RPOC_CHLTE      DLNDLYRRVIIRNNRLKKLI--DIRAPEVILRNEKRMLQEAVDALFDNS------RKANA
RPOC_RHOBA      DLNDLYRRIINRNNRLRKLV--DLNAPEVIIRNEKRMLQQSVDALFDNN------RCKRP
RPOC_PARUW      DLNDLYRRVINRNNRLKAIL--KLKTPDVIVRNEKRMLQEAVDALFDNG------RHGHP
RPOC_AQUAE      DLNDFYRRVINRNNRLKRLI--ELNAPDIIIRNEKRMLQEAVDALIDNG------KRGNP
RPOC_CARRP      DINELYKIVLERNYKLKKMT--TYLDPKQLLINERISLQESIYALFDNE------KLINP
RPOC_THEMA      DLNELYRRLINRNNRLKKLL--ELGAPEIILRNEKRMLQEAVDALIHNGSDSEGKRSRRA
RPOC_MYCPE      DINSFYRKIIIRNERLKRVIQN--NAPSIILNNEKRLLQEAVDALFDNA-----SRK-KP
RPOC_MYCGA      DINNFYRRIIIRNERLKKIIEL--RAPSVILNNEKRMLQEVVDALFDNA-----SRK-KP
RPOC_UREPA      DTNNFYRKIIIRNERLKQMQAT--DAPEILLDNEKRLLQEAVDSLFDNN-----SRK-KP
RPOC_MYCPN      DINNFYRRVIIRNDRLRRILEDG-TVPAIVVNNEKRLLQESVDALFDNS-----SRH-KP
RPOC_MYCMO      DINELYRRIIIRNNRLKKWQES--NAPQIIIQNELRMIQESVDALIDNQ-----RRSPSP
RPOC_MYCPU      DINELYRRIIIRNNRLRKWIEL--NAPTLITQNELRMIQEAVDALIDNS-----KKKPKP
RPOC_MYCH2      DCNELYRRIIIRNNRLKRWKAA--HAPVIIIQNEMRMLQEAVDALIDNQ-----KKSTNQ
RPOC_MYCS5      DINELYRRIIIRNNRLEKWYES--DAPVLIKQNEFRMLQEAVDALIDNS-----RKKPGP
                * *  *: :: ** :*          *  :  **   :*     ::..       :    

RPOC_DEIRA      VTNPGSDRSLR-SLTDLLGGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGVPKRMA
RPOC_THET8      VTNPGSDRPLR-SLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKRMA
RPOC_TREPA      IKG-ASNRPLK-SISDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKLWQCGLPTKMA
RPOC_BORAP      VKG-SSSRPLK-SLSDALKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKLHQCGLPAKMA
RPOC_LEPIC      VKG-KGNRPLK-SISDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKYHEMGLPKKMA
RPOC_FUSNN      VVA-QNNRELK-SLSDMLKGKQGRFRQNLLGKRVDYSARSVIVVGPSLKMNQCGIPKKMA
RPOC_CALS4      VTG-PGNRPLK-SLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKVYQCGLPKEMA
RPOC_SYMTH      VTG-PGNRPLK-SLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPHLKLHQCGLPKEMA
RPOC_LACSS      VTG-PGNRPLK-SLSHMLKGKQGRFRQNLLGKRVDYSGRSVIDVGPTLKFYQCGLPREMA
RPOC_LEUMM      VAG-PGNRPLK-SLSHMLKGKQGRFRQNLLGKRVDYSGRSVIDVGPFLKMNQMGLPVPMA
RPOC_STRMU      ITG-PGSRPLK-SLSQMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMA
RPOC_STRP7      ITG-PGSRPLK-SLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMA
RPOC_STAS1      VTG-PGNRPLK-SLSHMLKGKQGRFRQNLLGKRVDYSGRSVIAVGPSLKMYQCGLPKEMA
RPOC_ARTS2      VTG-PGNRPLK-SLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKQMA
RPOC_LEIXX      VTG-TGNRALK-SLSDMLKGKQGRFRQNLLGKRVDYSGRSVIIVGPQLKLHQCGLPKQMA
RPOC_CORJK      VTG-PGNRPLK-SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIIVGPQLKLHQCGLPKLMA
RPOC_CUTAK      VSG-PGNRPLK-SLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKMHECGLPKTMA
RPOC_BIFLO      VTG-ASNRPLK-SLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPSLRMHQCGLPKPMA
RPOC_TROWT      VSG-TNNRTLK-SLSDMLKGKSGRFRQNLLGKRVDYSGRSVIVVGPTLQLHQCGLPKLMA
RPOC_RUBXD      VTG-AGNRPLK-SLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLEMHQCGLPRLMA
RPOC_DEHMC      VAV-NGDHKAK-SLSDLLRGKQGRFRQNLLGKRVDYSGRSVIVVGPSLKLSQCGLPRRMA
RPOC_ECOLI      ITG-SNKRPLK-SLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMA
RPOC_BUCCC      ITG-SNKRPLK-SLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPYLHLNQCGIPKKMA
RPOC_PSEHT      ITG-SNKRPLK-SLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPTLKLHQCGLPKKMA
RPOC_ALCBS      ITG-SNKRPLK-SLADMIKGKQGRFRQNLLGKRVDYSGRSVIVVGPTLKLHECGLPKKMA
RPOC_METCA      ITG-SNKRPLK-SLADMIKGKQGRFRQNLLGKRVDYSGRSVIVVGPTLRLHQCGLPKKMA
RPOC_XYLFT      ITG-TNKRPLK-SLADMIKGKQGRFRQNLLGKRVDYSARSVIIVGPNLRLHQCGLPKKMA
RPOC_COXBU      ILG-SNRRQLK-SLADMIKGKSGRFRQNLLGKRVDYSGRSVIVVGPTLKLHQAGLPKKMA
RPOC_PSYCK      ITG-SNKRPLK-SLADMIKGKQGRFRQNLLGKRVDYSGRSVIVVGPTLRLHQCGLPKKMA
RPOC_HYDCU      VTG-TNKRQLK-SLADMIKGKQGRFRQNLLGKRVDYSGRSVIVVGPSLRLHQCGLPKKMA
RPOC_BURM1      MTG-ANKRPLK-SLADMIKGKGGRFRQNLLGKRVDYSGRSVIVVGPTLKLHQCGLPKLMA
RPOC_NITMU      MTG-ANKRPLK-SLADMIKGKGGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKKMA
RPOC_FRATT      VTG-SNKRPLK-SLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPSLRLHECGLPKKMA
RPOC_SYNAS      ITG-TNKRPLK-SLSDMLKGKQGRFRQNLLGKRVDYSGRSVITVGPDLRLHQCGLPKKMA
RPOC_PELCD      ITG-PNKRPLK-SLSDMLKGKGGRFRQNLLGKRVDYSGRSVIVVGPELKLHQCGLPKKMA
RPOC_DESPS      ITG-ANKRPLK-SLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPHLRLHQCGIPKKMA
RPOC_BDEBA      FTG-PNKRPLR-SLSDMLKGKQGRFRQNLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMA
RPOC_LAWIP      IAG-TNGRPLK-SLSDMIKGKQGRFRQNLLGKRVDYSGRSVIVVGPKLKLHQCGLPKKMA
RPOC_CAUVC      ITG-ANKRPLK-SLADMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKLHECGLPKKMA
RPOC_RHOPB      ITG-ANKRPLK-SLADMLKGKQGRFRQNLLGKRVDYSGRSVITVGPELRLHQCGLPKKMA
RPOC_RHOS4      ITG-TNKRPLK-SLSDMLKGKQGRFRQNLLGKRVDFSGRSVIVTGPELKLHQCGLPKKMA
RPOC_ZYMMO      ITG-GNKRPLK-SLSDMLKGKQGRFRQNLLGKRVDYSGRSVITTGPELKLHQCGLPKKMA
RPOC_GLUOX      ITG-ANKRPLK-SLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKLHQCGLPKKMA
RPOC_RICBR      AKN-ANKRPFK-SLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKLHQCGLPKKMA
RPOC_ORITB      VKN-SNKRPFK-SLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKLHQCGLPKQMA
RPOC_NEOSM      IKG-SNKRPYK-SISDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPALELHQCGLPKKIA
RPOC_EHRRW      SNK-AGSVGYKKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKLHQCGLPKKMA
RPOC_SULDN      VKG-ANKRPLK-SLSEIIKGKQGRFRQNLLGKRVDFSGRTVIVVGPSLSMDECGLPKKMA
RPOC_SULNB      VKG-ANKRPLK-SLSEVIKGKQGRFRQNLLGKRVDFSGRSVIVVGPDLRMDQCGLPKKMA
RPOC_GRAFK      VKT-DSNRPLK-SLSDSLKGKQGRFRQNLLGKRVDYSARSVIVVGPELKMFECGLPKNMA
RPOC_PORGI      VKS-DNNRPLK-SLSDSLKGKQGRFRQNLLGKRVDYSARSVIVVGPELKMHECGLPKDMA
RPOC_CYTH3      VRA-EGNRALK-SLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMHECGLPKDMA
RPOC_SALRD      VRG-SSNRPLK-SLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVSGPHLELHQCGLPKEMA
RPOC_CHLTE      VKTGESNRPLK-SLSDALKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKLHQCGLPKSMA
RPOC_RHOBA      VLG-SSNRPLK-SLTDMIKGKQGRFRENLLGKRVDYSARSVIVVGPRLKLHQCGLPKKIA
RPOC_PARUW      VMG-AGNRPLK-SLSEMLKGKQGRFRQNLLGKRVDYSGRSVIIVGPELKFNQCGLPKLMA
RPOC_AQUAE      VKQ--NGRPLK-SLADYLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELQMHQCGLPKIMA
RPOC_CARRP      ILT-SSKRVLK-SFSSLIKGKYGRFRQNLLGKRVDFSGRTVITVEPNLFLYECKIPIYIA
RPOC_THEMA      VLKDRNGRPLK-SLTDLLKGKKGRFRRNLLGKRVDYSGRAVIVVGPNLKIHQCGIPKKMA
RPOC_MYCPE      LLG-KDKRPLK-SLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMI
RPOC_MYCGA      ITA-KDKRPLK-SLTDRLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYEVGIPAPMI
RPOC_UREPA      VVG-KDKRPLK-SLSNHLKGKQGLFRQNLLGKRVDYSGRSVIVVGPELKMYEVGIPALMI
RPOC_MYCPN      ALS-KDKRSLK-SLTDRLKGKQGLFRHNLLGKRVDYSGRSVIVVGPELKMYEVGIPALMI
RPOC_MYCMO      VVS-KENRPLK-SISDALTGKKGRFRQNLLGKRVDYSGRSVIVVGPDLKMHQAGIPRQMA
RPOC_MYCPU      VTS-KDNRNLK-SISDALTGKKGRFRQNLLGKRVDYSGRSVIVVGPELKMNQVGIPREMA
RPOC_MYCH2      VTT-KEGRPLK-SISDALTGKKGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQAGLPRKMA
RPOC_MYCS5      VTS-KDGHPFK-SISDALVGKKGRFRQNLLGKRVDYSGRSVIVVGPHLKMYQVGIPRDMA
                          : *::  : ** * **.********:*.*:**   * *   :  :*  : 

RPOC_DEIRA      LELFKPFLFKVLEEKG---------EVTNIKQARKMLERYRDTRDSVWDALEEVIEDKVV
RPOC_THET8      LELFKPFLLKKMEEKG---------IAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVV
RPOC_TREPA      LELFKPFIMKKLVEKE---------IVSNIKKAKMLVEQES---PKVFSVLDEVVKEHPV
RPOC_BORAP      LELFKPFVIRRLIESE---------AVFNIKRAKNLIEQEV---DEVWQILDLVIKEHPI
RPOC_LEPIC      LELFKPFIMKRLVDLD---------LAPNIKSAKKKVEAED---KEVFDVLEYVVKEHPV
RPOC_FUSNN      LELYKPFIMRELVRRE---------LANNIKMAKKLVEESD---DKVWAVIEDVIADHPV
RPOC_CALS4      LELFKPFVMKRLVDKG---------LAQHIKSAKRMVERVR---PEVWDVLEEVIKEHPV
RPOC_SYMTH      LELFKPFVMKKLVNDG---------HAHNIKSAKRMVERMR---PEVWDVLEEVIREHPV
RPOC_LACSS      LELFKPFVMHELVKRD---------MASNIKNAKRKIDRQD---DDVWDVLEDVIKERPV
RPOC_LEUMM      IELFRPFIMKELTTRK---------LAGNVKSAKRKIDKAD---GDVMDVLEDVIKEHPV
RPOC_STRMU      IELFKPFVMREIVDRD---------IVQNVKAAKRLIERGD---DRIWDILEEVIKEHPV
RPOC_STRP7      IELFKPFVMREIVARD---------IVQNVKAAKRLVERGD---ERIWDILEEVIKEHPV
RPOC_STAS1      LELFKPFIMKELVQRE---------IATNIKNAKSKIERMD---DEVWDVLEDVIKEHPV
RPOC_ARTS2      LELFKPFVMKRLVDLN---------HAQNIKSAKRMVERYR---PQVWDVLEEIITEHPV
RPOC_LEIXX      LELFKPFVIKRLIDLS---------HAQNIKAAKRMVERSR---PQVWDVLEEIIRERPV
RPOC_CORJK      LELFKPFVMKRLVEKS---------YAQNIKSAKRMVERQR---PEVWDVLEEAIAEHPV
RPOC_CUTAK      LELFKPFVMKRLADLE---------HAQNVKSAKRMVERQR---PVVWDVLEEVIKEHPV
RPOC_BIFLO      LELFKPFVIKRLVDLN---------YAQNMKSAKRLVDRGD---AEVWGVLEEVISEHPV
RPOC_TROWT      LELFKPFIVKRLLDLA---------LAPNIRSARRMIERGD---PAVWDMLDAVIKARPV
RPOC_RUBXD      VELFKPFVMKVLVDRA---------LAPNIRSAKQMVERLR---PEVWDVLEDVIKEHPV
RPOC_DEHMC      LELFKPFVMHRLVRDG---------LAPNIKSARRLVERAR---PEVYDILEEVVKDRPV
RPOC_ECOLI      LELFKPFIYGKLELRG---------LATTIKAAKKMVEREE---AVVWDILDEVIREHPV
RPOC_BUCCC      LELFKPFIYGKLEQRN---------LATTIKSAKKMVEKEE---PIVWDILDEVIHKHPI
RPOC_PSEHT      LELFKPFIYGKLERRG---------MATTIKAAKKMVEREM---PEVWDVLDEVIREHPV
RPOC_ALCBS      LELFKPFIFAKLEGRG---------LATTIKAAKKMVERET---AEVWDILAEVIREHPV
RPOC_METCA      LELFKPFIFSKLQFRG---------LATTIKAAKKMVEREA---PEVWDILDEVIREHPV
RPOC_XYLFT      LELFKPFVFAKLQRRG---------LATTIKGAKKLVEREE---AEVWDILEEVISEHPV
RPOC_COXBU      LELFKPFIFSKLQLRG---------LATTVKAAKKLVENEG---PEVWDILEEVIREHPI
RPOC_PSYCK      LELFKPFTYNKLLSHG---------LATTIKAAKKMVEREE---PQVWDMLAMVIREHPV
RPOC_HYDCU      LELFKPFIFSKLQKRG---------LATTIKAAKKMVEQGL---PEVWDVLDEVIREHPV
RPOC_BURM1      LELFKPFIFNKLEVMG---------VATTIKAAKKEVENQT---PVVWDILEEVIREHPV
RPOC_NITMU      LELFKPFIFNKLEIMG---------IASTIKAAKREVENES---PIVWDILEDVIREHPV
RPOC_FRATT      LELFKPFVYSKLRLGG---------HATTIKQAKRMVELEE---AVVWDILETVINEHPV
RPOC_SYNAS      LELFKPFVYNRLQEKG---------YVTTVKSAKKMVERET---AEVWDALDEVVREYPV
RPOC_PELCD      LELFKPFIYNKLEERG---------FCTTIKSAKKMVEKEK---SEVWDVLEEVIKEHPV
RPOC_DESPS      LELFKPFIYNRLERKG---------LVTTIKSARKMVEKGA---KEVWDVLEEVVTEYPV
RPOC_BDEBA      LELFKPFVYNKLEEKG---------LATTIKQAKRLVDQET---VEVWDILADVVKEHPV
RPOC_LAWIP      LELFKPFIYSELEKRG---------HASTIKSAKKIVEREE---LVVWDILSDVVREYPI
RPOC_CAUVC      LELFKPFIYARLDAKG---------LSGTVKQSKRMVEREQ---PQVWDILEEVIREHPV
RPOC_RHOPB      LELFKPFIYSRLDAKG---------LSTTVKQAKKLVEKER---PEVWDILDEVIREHPI
RPOC_RHOS4      LELFKPFIYSRLEAKG---------LSSTVKQAKKLVEKER---PEVWDILDEVIREHPV
RPOC_ZYMMO      LELFKPFIYSRLDAKG---------LSMTLKQAKKWVEKER---KEVWDILEEVIREHPV
RPOC_GLUOX      LELFKPFIYSKLEKYG---------HATTIKAAKRMVEKER---PEVWDILEEVIREHPV
RPOC_RICBR      LELFKPFIYSKLELYG---------IATTIKAAKRMVEAEK---PEVWDVLEEVIREHPV
RPOC_ORITB      LELFKPFVYAELERCG---------IATTIKAAKRIVELGT---PDVWNALAKVIKHHPV
RPOC_NEOSM      LELFKPFIYSKLELYG---------IAPTIKTARRMVQNEQ---PEVWDVLAKVIHQHPV
RPOC_EHRRW      LELFKPFICSKLKMYG---------IVPTVKLANKMIQNEK---PEVWDILDEVIHEHPI
RPOC_SULDN      LELFKPHLIAKLEDKG---------YATTVKAAKKMIEDKT---NEVWECLAEIVDGYPV
RPOC_SULNB      IELFKPHLMAKLEEKG---------YATTLKQAKKMIEQQV---NEVWECLEEVVENYPV
RPOC_GRAFK      AELYKPFIIRKLIERG---------IVKTVKSAKKIIDKKE---PVVWDILENVLKGHPV
RPOC_PORGI      AELYKPFIIRKLIERG---------IVKTVKSAKKIVDRKE---PVIWDILEYVMKGHPV
RPOC_CYTH3      AELFKPFIIRKLIERG---------IVKTVKSAKKIVDRKD---PVVWDILENVLKGHPI
RPOC_SALRD      VELFKPFIIRRLIERG---------IVKTVKSAKKYVDKKT---EDVWDILEKVIQGRPV
RPOC_CHLTE      IELFQPFVIRRLVERG---------IAKSVKSAKKLIDKKD---PVVWDVLEKVIDGHPV
RPOC_RHOBA      LELYQPFIIRRLKELG---------HADTIKSAKKMLERKD---EEVWDILEQVITNHPV
RPOC_PARUW      LELFEPFIVKRLKDQG---------YVYTIRSAKKMIQRHA---PEVWDVLEDIIKGHPV
RPOC_AQUAE      LELFKPFVYRRLEEKG---------YATSIKHAKRLVEQKT---PEVWECLEEVVKEHPV
RPOC_CARRP      LELFKPILYYELKKKK---------IITTISFIDDYYKKNK---KQIILLLKNKVKSYFI
RPOC_THEMA      MELFKPFVLAKLLGEGSS-------SKTMRKVKKAIIEKEM---PEAWEVLEEVIKGSVV
RPOC_MYCPE      LKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQD---NTIWPIINKVIKQRPV
RPOC_MYCGA      LKLFKPFIIRELIMRFNEDGQEIKPIAPNIKIAEQMIAQKS---ERIWDIVDKVIKERPV
RPOC_UREPA      LKLFRPYIISELIRKRDELGNEIQPICANIKLAEQKILAQD---NEIWPVVEKVIKQRPV
RPOC_MYCPN      LKLFKPFIIHGLINKFDSNGNEIRPIASSIRQAEDMIKNQD---DLIWGIVYDVIKDRPV
RPOC_MYCMO      AKLFEPWIIKELIEKEI---------APTIKSAKKLIEDQN---PIIWPHVARVIVDKPV
RPOC_MYCPU      AKLFEPWIIKELIDQEI---------TLSVKSARKLIDNLN---PIIWPHVAKVIQGRPV
RPOC_MYCH2      AVLFEPWIIRNLIQEKK---------VGSIKMARKMIEEEN---PIIWPHVAKVIQNKPI
RPOC_MYCS5      AKLFEPWIINRIMKEEEG--------INSVKAAKKLVDSLN---PIIWPYVEQVLENRPV
                  *:.*     :                                      :   :    :

RPOC_DEIRA      LLNRAPTLHRLGIQAFEPVLVEGQSIQLHPLVCEAFNADFDGDQMAIHVPLSAQAQAEAR
RPOC_THET8      LLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEAR
RPOC_TREPA      MLNRAPTLHRLGIQAFEPVLVEGKAIRLHPLVCKPFNADFDGDQMAVHVPLTQAAQMECW
RPOC_BORAP      LLNRAPTLHRLGIQAFEPVLVEGKAIKLHPLVCHAYNADFDGDQMAVHVPLTPSAQAESW
RPOC_LEPIC      MLNRAPTLHRLGIQAFLPVLVEGKAIKLHPLVCHAFNADFDGDQMAIHVPLTPKAQLETW
RPOC_FUSNN      LLNRAPTLHRLSIQAFQPVLIEGKAIRLHPLVCSAFNADFDGDQMAVHLTLSPESMMEAK
RPOC_CALS4      LLNRAPTLHRLGIQAFEPVLVEGRAIKLHPLVCPAYNADFDGDQMAVHIPLSMEAQAEAR
RPOC_SYMTH      LLNRAPTLHRLGIQAFEPVLVEGRAIQIHPLVCTAYNADFDGDQMAVHVPLSAEAQAEAR
RPOC_LACSS      LLNRAPTLHRLGIQAFEPILVDGKSIRLHPLACEAYNADFDGDQMAIHVPLSDEAQAEAR
RPOC_LEUMM      LLNRAPTLHRLGIQAFEPVLVSGKAMRLHPLVTEAYNADFDGDQMAIHVPLSDEAQAEAR
RPOC_STRMU      LLNRAPTLHRLGIQAFEPVLIDGKALRLHPLACEAYNADFDGDQMAIHVPLSEEAQAEAR
RPOC_STRP7      LLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEAR
RPOC_STAS1      LLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLATTAYNADFDGDQMAVHVPLSKEAQAEAR
RPOC_ARTS2      LLNRAPTLHRLGIQAFEPQLVEGKAIQLHPLVCGAFNADFDGDQMAVHLPLSPEAQAEAR
RPOC_LEIXX      LLNRAPTLHRLGIQAFEPQLVEGKAIQLHPLVCAAFNADFDGDQMAVHLPLSVEAQAEAR
RPOC_CORJK      MLNRAPTLHRLGIQAFEPILVEGKAIQLHPLACEAFNADFDGDQMAVHLPLSAEAQAEAR
RPOC_CUTAK      LLNRAPTLHRLGIQAFEPQLIEGKAIQLHPLVCSAFNADFDGDQMAVHLPLSPEAQAEAR
RPOC_BIFLO      LLNRAPTLHRLGIQAFEPILVEGKAIHLPPLACAAFNADFDGDQMAVHLPLSAEAQAEAR
RPOC_TROWT      LLNRAPTLHRLGIQAFEPQLVEGKAIQLHPLVCAAFNADFDGDQMAVHLPLSLEAQAEAR
RPOC_RUBXD      LLNRAPTLHRLGIQAFEPVLVEGKAIQIHPLVCAAFNADFDGDQMAVHVPLSPEAQAEAR
RPOC_DEHMC      LLNRAPTLHRLSIQAFEPVLIDGSALRLHPLVCSAFNADFDGDQMAVHVPLSKAAVKEAR
RPOC_ECOLI      LLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEAR
RPOC_BUCCC      LLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCAAYNADFDGDQMAIHIPLTKTAQKEAC
RPOC_PSEHT      LLNRAPTLHRLGIQAFEPVLIEGKAIHLHPLVCAAYNADFDGDQMAVHVPLTIEAQLEAR
RPOC_ALCBS      MLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAFNADFDGDQMAVHVPLTLEAQLEAR
RPOC_METCA      MLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCTAFNADFDGDQMAVHVPLSLEAQLEAR
RPOC_XYLFT      VLNRAPTLHRQGIQAFEPVLIEGKAIQLHPLVCTAFNADFDGDQMAVHVPLSLEAQLEAR
RPOC_COXBU      LLNRAPTLHRLGIQAFEPVLVEGKAIQLHPLVCTAYNADFDGDQMAVHVPLTLEAQLEAR
RPOC_PSYCK      LLNRAPTLHRLGLQAFEPVLIEGKAIQLHPLVCTAFNADFDGDQMAVHVPLTLEAQLESR
RPOC_HYDCU      LLNRAPTLHRLGIQAFEPVLIEGKAINLHPLVCSAFNADFDGDQMAVHVPLSLEAQLEAR
RPOC_BURM1      MLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAFNADFDGDQMAVHVPLSLEAQMEAR
RPOC_NITMU      MLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAFNADFDGDQMAVHVPLSLEAQMECR
RPOC_FRATT      LLNRAPTLHRLGIQAFEPRLIEGKAIQLHPLVCAAFNADFDGDQMAVHVPLTVESQLEAR
RPOC_SYNAS      MLNRAPTLHRLGLQAFEPVLIEGKAIQLHPLVCTAFNADFDGDQMAVHVPLSIEAQTEAR
RPOC_PELCD      MLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCTAFNADFDGDQMAVHLPLSIESQIETR
RPOC_DESPS      ILNRAPTLHRLGMQAFEAVLIEGKAIRLHPLVCMAFNADFDGDQMAVHVPLSVEAQVEAR
RPOC_BDEBA      LLNRAPTLHRLGIQAFEPVLHEGKAIQLHPLVCTAFNADFDGDQMAVHVPLSVESQVEAR
RPOC_LAWIP      LLNRAPTLHRLGIQAFEPLLVEGKAIQLHPLVCAAYNADFDGDQMAVHIPLSVEAQVECR
RPOC_CAUVC      LLNRAPTLHRLGIQAFEPKLIEGKAIQLHPLVCAAFNADFDGDQMAVHVPLSLEAQLEAR
RPOC_RHOPB      LLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAFNADFDGDQMAVHVPLSLEAQLEAR
RPOC_RHOS4      LLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCSAFNADFDGDQMAVHVPLSLEAQLEAR
RPOC_ZYMMO      MLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCSAFNADFDGDQMAVHVPLSLEAQLEAR
RPOC_GLUOX      MLNRAPTLHRLGIQAFEPTLIEGKAIQLHPLVCTAFNADFDGDQMAVHVPLSLEAQLEAR
RPOC_RICBR      LLNRAPTLHRLGIQAFEPLLIEGKAIQLHPLVCAAFNADFDGDQMAVHIPLSIEAQLEAR
RPOC_ORITB      LLNRAPTLHCLSIQAFEPVLIEDKAIQLHPLVCTAFNADFDGDQMAVHVPLSTEAQLEAR
RPOC_NEOSM      FLNRAPTLHRLSVQAFEPVLIEGKAIQLHPLVCTAFNADFDGDQMSVHVPLSIEAQVEAR
RPOC_EHRRW      LLNRAPTLHRLGIQAFDPVLIEGKAIQLHPLVCSAFNADFDGDQMAVHIPLSLEAQLEAR
RPOC_SULDN      LLNRAPTLHKLSIQAFHPKLIDGKAIQLHPLVCAAFNADFDGDQMAVHIPLSSAAIAEAK
RPOC_SULNB      LLNRAPTLHKLSIQAFHPRLIEGKAIQLHPLVCSAFNADFDGDQMAVHVPLSDEAIAEAK
RPOC_GRAFK      LLNRAPTLHRLGIQAFQPKLIEGKAIQLHPLACTAFNADFDGDQMAVHLPLGPEAILEAQ
RPOC_PORGI      LLNRAPTLHRLGIQAFQPKLIEGKAIQLHPLSCTAFNADFDGDQMAVHLPLSNEAILEAQ
RPOC_CYTH3      LLNRAPTLHRLGIQAFQPKLIEGKAIQLHPLVCTAFNADFDGDQMAVHVPLGHEAILEAS
RPOC_SALRD      LLNRAPTLHRLGIQAFQPVLTENKAIEIHPLVCPAYNADFDGDQMAVHVPLSHEACLESM
RPOC_CHLTE      LLNRAPTLHRLGIQAFQPTLIEGKAIQLHPLVCTAFNADFDGDQMAVHVPLSPEAQLEAS
RPOC_RHOBA      LLNRAPTLHRMGIQAFEPTLVEGNAIHLHPLVCKGFNADFDGDQMAVHLPLSIEAQVEAH
RPOC_PARUW      LLNRAPTLHRLGIQAFEPVLIEGKAIRIHPLVCSAFNADFDGDQMAVYVPLSIEAQLEAK
RPOC_AQUAE      LLNRAPTLHRPSIQAFEPVLVEGKAIQLHPLVCPPFNADFDGDQMAVHVPLGIEAQLESY
RPOC_CARRP      MLNRAPTLHRMNFQSFKILLTEDKTIKIHPLVCLCYNADFDGDQMAIHLPLTNNAKVESN
RPOC_THEMA      LLNRAPTLHRMSIQAFEPKLVEGNAIQLHPVVCPPFNADFDGDQMAVHVPLSAAAQAEAR
RPOC_MYCPE      LLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEAR
RPOC_MYCGA      LLNRAPTLHRLGIQAFEPKIVDGKAIRLHPLVTTAFNADFDGDQMAVHVPISKEAVAEAR
RPOC_UREPA      ILNRAPTLHRLGIQAFEPKMVDGKAIRLHPLVTTAFNADFDGDQMAVHIPLSKEAVAEAR
RPOC_MYCPN      LLNRAPTLHRLGIQAFEPRIVDGKAIRLHPLVTTAFNADFDGDQMAVHVPLSENAVNEAR
RPOC_MYCMO      LLNRAPTLHRLSIQAFEPVLIRGKAIKLHPLVTTAFNADFDGDQMAVHVPISDESVREAK
RPOC_MYCPU      LLNRAPTLHRLSIQAFEPVLIRGKAIKLHPLVTTAFNADFDGDQMAVHVPISDEAVREAK
RPOC_MYCH2      ILNRAPTLHRLSIQAFEPVLVRAKAIQLHPLVTAGFNADFDGDQMAVHIPISPEAIRETQ
RPOC_MYCS5      LLNRAPTLHRLSIQAFQPVLIRGKAIKIHPLVTTAFNADFDGDQMAVHVPISKAAVREAQ
                .********  ..*:*   :    ::.: *:    :*********::::.:   :  *  

RPOC_DEIRA      IQMLASHNLLSPANGEPNVKPSRDIILGIFTLTQLRR---------------DNLGAGT-
RPOC_THET8      IQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRK---------------EKKGAGL-
RPOC_TREPA      TLMLSNRNLLDPANGRTIVYPSQDMVLGLYYLTKE-------------RSL--PEGARP-
RPOC_BORAP      ALMLSTNNLLNPANGHPIVFPSQDIVLGLYYLTME-------------KKN--TVGEG--
RPOC_LEPIC      MLMLSPHNILNPANGHPICGPTQDIVLGIYYLTSE-------------LPS--EPGVPL-
RPOC_FUSNN      LLMFAPNNIISPSSGEPIAVPSQDMVMGCFYMTKE-------------RPG--EKGEG--
RPOC_CALS4      FLMLAANNILKPQDGKPVMTPTQDMVLGCYYLTAD-------------EDG--VPGEGK-
RPOC_SYMTH      ILMLAAHNILNPKDGQPVITPSKDMLLGSYYLTLP-------------KPD--SEPK-M-
RPOC_LACSS      MLMLAAHHILAPKDGKPIVTPSQDVVLGNYYLTLE-------------QKN--RLGEGM-
RPOC_LEUMM      LLMLAAGHILAPKDGKPIVAPSQDMVIGNYYLTTE-------------EAG--REGEGM-
RPOC_STRMU      LLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTME-------------GAD--REGEGM-
RPOC_STRP7      ILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTME-------------EAG--REGEGM-
RPOC_STAS1      MLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLE-------------RKE--AVNTGT-
RPOC_ARTS2      ILMLSSNNILKPSDGRPVTLPSQDMIIGLYHLTTK-------------RVG--SAGEGR-
RPOC_LEIXX      ILMLASNNILKPSDGRPVTLPSQDMIIGLHHLTTV-------------REG--AEGEGR-
RPOC_CORJK      ILMLASNNILSPASGKPLAMPRLDMVTGLYYLTLL-------------KKP--EEFGGQG
RPOC_CUTAK      VLMLSTNNILKPADGRPVALPSHEMIIGAYYLTMA-------------LDG--LKGEGR-
RPOC_BIFLO      SLMMASDNILKPADGHTVTMPSQDMILGLYYLSTV-------------LEG--VKGQGR-
RPOC_TROWT      VLMLASNNILNPSDGRPVTLPSHDMIIGLYHLTTV-------------KPS--AKGAGR-
RPOC_RUBXD      ILMLSTQNILKPADGFPVAVPSQDMVLGLYYITYA-------------GED--FEEREP-
RPOC_DEHMC      ETMLSIHNMMLPSSGEPVVSPSLDMVFGCYYLTTT-------------RPG--AKGEGK-
RPOC_ECOLI      ALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRD-------------CVN--AKGEGM-
RPOC_BUCCC      SLMMSTKNILSPANGEPIIVPSQDVVLGIYYMTRK-------------KIN--GKGENM-
RPOC_PSEHT      ALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRD-------------RIN--AKGEGA-
RPOC_ALCBS      ALMMSTNNILSPANGEPIIGPTQDVVLGLYYISRD-------------RVN--AQGEGH-
RPOC_METCA      SLMMATNNILSPANGEPIINPTQDVVMGLYYMSRE-------------RLF--AKGEGM-
RPOC_XYLFT      ALMMSTNNILSPANGEPIIVPSQDVVLGLYYMSRA-------------LEN--KKGEGM-
RPOC_COXBU      SLMMSTNNVLHPANGEPIIVPSQDVVLGLYYITRD-------------RVN--AKGEGM-
RPOC_PSYCK      ALMMSTNNILSPANGEPIIVPSQDVVLGLYYISRS-------------SVN--AKGEGM-
RPOC_HYDCU      TLMMSTNNLLSPANGDPIIVPSQDVVLGLYYITRE-------------KIN--AKGEGK-
RPOC_BURM1      TLMLASNNVLFPANGDPSIVPSQDIVLGLYYATRE-------------AIN--GKGEGL-
RPOC_NITMU      TLMMSTNNVLSPANGEPIIVPSQDIVLGLYYTTRE-------------KVN--ARGEGM-
RPOC_FRATT      VLMMSTNNILSPASGQPIITPTQDIVLGLYYITRE-------------KEG--ARGEGK-
RPOC_SYNAS      VLMMSTNNILSPANGKPIIIPSQDVVLGIYYLTRS-------------KED--VLGHGM-
RPOC_PELCD      VLMMSTNNILSPAHGKPIIVPSQDMILGLYYMTRE-------------RAF--ARGEGK-
RPOC_DESPS      VLMMSTNNILSPANGEPVIIPSQDIVLGLYYMTRE-------------RIN--VKGEGR-
RPOC_BDEBA      VLMMSTNNILSPANGKPIINPSQDIVLGMYWLTRM-------------RPG--AKGSGK-
RPOC_LAWIP      VLMMSTNNILSPANGSPVIVPSQDIVLGLYYMTVE-------------RSF--EKGEGM-
RPOC_CAUVC      VLMMSTNNILSPANGRPIIVPSQDIVLGLYYLSVA-------------RDG--EPGEGK-
RPOC_RHOPB      VLMMSTNNILHPANGLPIIVPSQDIVLGLYYLSIL-------------REG--LPGEGK-
RPOC_RHOS4      VLMMSTNNVLSPANGAPIIVPSQDMVLGLYYTTME-------------RRG--MKGEGM-
RPOC_ZYMMO      VLMMSTNNILSPANGKPIIVPSQDMVLGIYYLSML-------------KEN--EPGEGM-
RPOC_GLUOX      VLMMSTNNILSPANGKPIIVPSQDIVLGLYYLSLEVPEYRETPDEAVIKDGKIVTAAPP-
RPOC_RICBR      VFMMSTNNILSPANGRPIIVPDKDIVLGLYYLTLA-------------FDH--EVGEGM-
RPOC_ORITB      VLMMSTNNILSPANGRPIIVPDKDIVLGLYYLTLS-------------IDG--EIGEGR-
RPOC_NEOSM      LLVMSTNNVLNPANSRPIIVPSKDIVLGVYYLSLE-------------EKG--GVVHPV-
RPOC_EHRRW      ILMMSTNNILSPSNGKPIIVPSKDIILGIYYLTLQ-------------DYV--EPEEIL-
RPOC_SULDN      VLMLASMNILLPASGKAIATPSQDMVLGIYYITLE-------------KNG--VKGSNK-
RPOC_SULNB      VLMLASMNILLPASGKAIAVPSQDMILGLYYLTLE-------------KND--VKGQHK-
RPOC_GRAFK      LLMLASHNILNPANGSPITVPSQDMVLGLYYMTKHKK----------TTKDETVIGEGL-
RPOC_PORGI      LLMLASHNILNPANGAPITVPSQDMVLGLYYITKLRP----------NTK-----GHGL-
RPOC_CYTH3      LLMIASHNILNPANGAPITVPSQDMVLGLYYVTKGRK----------STPEHPIKGEGM-
RPOC_SALRD      VLMLSSHNVRSPADGGPLAVPSQDMILGLYYITKAKS----------NQK-----GEGM-
RPOC_CHLTE      LLMLSSHNLILPQSGKPVTVPSQDMVLGMYYLTKARF----------GDV-----GQGQ-
RPOC_RHOBA      TLMMSTNNVFAPSNGKPIMSPSQDIVMGCYFMTVEMP----------DQK-----GEGM-
RPOC_PARUW      LLMMAPDNIFLPSSGKPVAVPSQDMTLGLYYLMLDPL----------YIRENH-ELKTR-
RPOC_AQUAE      ILMLSTQNVLSPAHGKPLTMPSQDMVLGTYYITHDP------------IPG--RKGEGK-
RPOC_CARRP      YLLLSINNIISPSNGNAIIIPTQDIIMGIYYFTFDFK------------------NKS--
RPOC_THEMA      FLMLSRYNIISPAHGKPISLPTQDIIIGSYYLTTV-------------GKEFDSLKEED-
RPOC_MYCPE      TIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKL---------------NMPGQGM-
RPOC_MYCGA      AIMLASWHILGPKDGKPVATPTQDMVLGNYYLTTEKR---------------NEKGEGL-
RPOC_UREPA      SILLASWHILGPKDGKPIITPTQDMILGIYYLTKEKF---------------PQVIEEMM
RPOC_MYCPN      AILLASKHILGLKDGRPIVTPTQDMVLGNYYLTTERK---------------GQTGEGI-
RPOC_MYCMO      ELLMANRNILGPKDGEPIINPSQDIILGLYYLTREVK---------------GAKGEAK-
RPOC_MYCPU      ELLFANRNILGPKDGEPIINPSQDMILGIYYLTIEIA---------------GAKGEAK-
RPOC_MYCH2      ELMFADKNILGPKDGEPIVNPSQDMVLGLYYLSQEKA---------------GAKGEGS-
RPOC_MYCS5      ELMLASKNILGPKDGEPIINPSQDIILGLYYLTIEKA---------------NQKNEGK-
                  :::  ::     . .   *  ::  * .                              

RPOC_DEIRA      ----------------EYASEADALAAFD---------EGKLSLNSPVMVNGVETSPGRL
RPOC_THET8      ----------------EFATPEEALAAHE---------RGEVALNAPIKVAGRETSVGRL
RPOC_TREPA      ---------------RRFSSVEEVMMAAE---------KGVIGWQDQIQVRYHKCD----
RPOC_BORAP      ---------------KKFLNFNNVILAIN---------NRSLDYNASI---YVKID----
RPOC_LEPIC      ---------------KSFSNLEEVHYAID---------RGVVEFRTKI---SVYHQ----
RPOC_FUSNN      ---------------KLFSNIEQVITAYQ---------NDKVGTHALI---KVRMN----
RPOC_CALS4      ----------------YFSSPEEALMAYQ---------LGYIHIHAKIKVKMT-----RE
RPOC_SYMTH      ----------------RFSHPHEALLAYQ---------NGLVELHDWVEIRFPEP--PKD
RPOC_LACSS      ----------------IFKDTNEVLMAYQ---------TGHVHLHSRIGLSVADM-ANRP
RPOC_LEUMM      ----------------IFSSVDEARIAFA---------SKVVHYHTRVGIQTSSFPSEKP
RPOC_STRMU      ----------------VFKDRDEAVMAYR---------NGYVHLHSRVGIAVDSMP-NKP
RPOC_STRP7      ----------------VFKDRDEAVMAYR---------NGYVHLHSRVGIATDSL--NKP
RPOC_STAS1      ----------------IYNDTNEVLKAYA---------NGYVHLHTRIGVHAASF-NNPT
RPOC_ARTS2      ----------------IFSSVSEAIMAFD---------LHELHLNSQVKIRL-EGFVPYA
RPOC_LEIXX      ----------------AFASVSEAIMAKD---------QGSLHLNATIKIRL-DNYVPSD
RPOC_CORJK      AYAPATEDGP---AQGVYSSLAEAIMAYD---------RGVLGLQAPIHVRI-SHLRPTA
RPOC_CUTAK      ----------------AFTSLAEAIMAHD---------LGELEIGAKIKLRL-KGIVPPH
RPOC_BIFLO      ----------------VFSSLEEAEMALD---------RHEIDMQAKVLIRLPESFVLPK
RPOC_TROWT      ----------------AFSSVAEAIMAKD---------RGDLSISAPVKILF-SNIVLDG
RPOC_RUBXD      --------------KALLASYAEADNAYR---------EGSLRLHDKVILRREGERIETT
RPOC_DEHMC      ----------------IFGDFEEAKRYYE---------MGIIDLRAIIKVRD--------
RPOC_ECOLI      ----------------VLTGPKEAERLYR---------SGLASLHARVKVRITEYEKDAN
RPOC_BUCCC      ----------------LLSSPKEAEYMYS---------LGAVDLHSIVKIRILEYKKDEK
RPOC_PSEHT      ----------------IFKDPKEAEKAYR---------SGNADLHAIVKVRISQSVKNEN
RPOC_ALCBS      ----------------VFADTKEVMRALG---------NKQVHIHARVKVRVHEVVKDLE
RPOC_METCA      ----------------TFASVDEAEQAFL---------NGAVDLHAKVVVRVREVVVGEG
RPOC_XYLFT      ----------------VFANTSELKRAYD---------NSVVELHAKVKVRITEIETDDQ
RPOC_COXBU      ----------------RFADAQEVVRAYE---------NDQVDLHARITVRIKEGILNEA
RPOC_PSYCK      ----------------IFATVNEALRAIG---------SNDLHVNAKIKVRVTETHIDDD
RPOC_HYDCU      ----------------AFSNWMEVQRALD---------AKAVHVHTKIKLKIEETVIDDA
RPOC_BURM1      ----------------TFTGVSEVIRAYE---------NKEVELASRVNVRITEMVRNED
RPOC_NITMU      ----------------YFANISEVSRAYE---------NRVIELNARIFVRIREYELADG
RPOC_FRATT      ----------------LFSSYEDVSRAYN---------SGTIDIHAKIKLRIDRQVFDTK
RPOC_SYNAS      ----------------SFSNPEEVRSAFD---------AGAVELRARIKVRIDDELKE--
RPOC_PELCD      ----------------ILSSRDELRMAYD---------AGEIDLQAKIKVRMSPALGEPE
RPOC_DESPS      ----------------VFSSVDEAIISYD---------YKETDLQAKVKVRRPEGIVD--
RPOC_BDEBA      ----------------AFSSVQEAQYAFE---------TGLVDLQAVCKVRINGTLQE--
RPOC_LAWIP      ----------------VFCAPWEVISAID---------NNQVNIHAKIKVRMEDGNIY--
RPOC_CAUVC      ----------------IFADLGEIEAAMD---------AGVVSLHAKIKARHTEMTPEGV
RPOC_RHOPB      ----------------LFGEAAEIEHALH---------AKVIHLHTKIKYRWEGLDENGK
RPOC_RHOS4      ----------------AFSSVEEVEHALA---------AGEVHLHATITARIKQIDEEGN
RPOC_ZYMMO      ----------------RLSNMTEVHQALN---------VGAVTLHSKIISRVPQVNEQGE
RPOC_GLUOX      ----------------AYSDVAEIESAML---------SGSLKLHDKIRLRLPTIDAEGK
RPOC_RICBR      ----------------MFSDLTEMEHALY---------NKFITIHTKIKYRRNQLNAEGK
RPOC_ORITB      ----------------LFGSMAEIHHALF---------NKVVSLHSKIKFRKHIINADGD
RPOC_NEOSM      ----------------TFCATWEAEHAFA---------NGDIGLHTKIRCGIELEDGV--
RPOC_EHRRW      ----------------FFGDFSHVEYALH---------NKDIHICSKIKYKMNYCTDSSD
RPOC_SULDN      ----------------LFANVDEVRIAIE---------HDALDIHAKVRTRDDG------
RPOC_SULNB      ----------------LFANVEEVEIAFE---------QQALDLNARIRTVLDG------
RPOC_GRAFK      ----------------TFYSAEELVIAYN---------QKRVDLNAGIKIRTKDYNEEGE
RPOC_PORGI      ----------------IFYGPEEATIAYN---------EGKVDIHAPIKVYVEDYEN-GE
RPOC_CYTH3      ----------------AFYGAEEVVIAIN---------EGRLSQHAHIKVKGIVRTDAGE
RPOC_SALRD      ----------------RFANVQEVRQAFD---------QDQVALHAKIQLRDPDGSG---
RPOC_CHLTE      ----------------LFYSMEEVIIAYN---------EERVGLHAQIFVKYDGKVDQVS
RPOC_RHOBA      ----------------TFSTYEEVDYALA---------QGIVGLHTRIKLRLPKYQKLKT
RPOC_PARUW      ----------------VFRDSEEVLLALQASGSYNWYEEGSKSPNGENRSDYLRGIRIHE
RPOC_AQUAE      ----------------AFGTFEEVLKALE---------LGHVDIHAKIKVKVGN------
RPOC_CARRP      ---------------ISLNDINDIINFFE---------FNNYNFQINIKFNNKKK-----
RPOC_THEMA      -------------VKWKFSSPEEAMLAYH---------LGFIKLHTPILIKVAVNGEE--
RPOC_MYCPE      ----------------LFANVDELKTVYQ---------MKKVHVHSIIGIPTSAFPKKQF
RPOC_MYCGA      ----------------IFSDFDQVILAYE---------AKQVSIHALIGLSTKCLTKKPF
RPOC_UREPA      AKDPTQARVEFINNFHIFSTQDEAIRAYK---------LKTIRINDVIGITTKAFNNKTF
RPOC_MYCPN      ----------------IFGTVHEARAAYE---------AGKVHLHAIVGISTKAFPNKHF
RPOC_MYCMO      ----------------YYMSYDDMYAAYS---------SKKIDLHARVAIPYRTV-KAFK
RPOC_MYCPU      ----------------VFQDVNSMLRAYE---------EGSVSLHARVAIPFKKLQKTFN
RPOC_MYCH2      ----------------FFSTYEAMLKAYE---------FRSVELHARVVLPFEQV-KPFI
RPOC_MYCS5      ----------------FYPSFNEMMLAYE---------NKYINLATRVVLPVSALKKISI
                                                                            

RPOC_DEIRA      RYTFSNPDEALHAVEQGEIDHQDHVRIRLNGQVYETSA----------------------
RPOC_THET8      KYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSP----------------------
RPOC_TREPA      ------------------------------GQLVVTTA----------------------
RPOC_BORAP      ------------------------------GKYKKTTA----------------------
RPOC_LEPIC      ------------------------------GKILETTP----------------------
RPOC_FUSNN      ------------------------------GELIETTP----------------------
RPOC_CALS4      ING------------------------EKKSKVIETTV----------------------
RPOC_SYMTH      LEP------------------------YSEEWWEHPDN----------------------
RPOC_LACSS      FTD------------------------DQRHKIMVTSV----------------------
RPOC_LEUMM      FTD------------------------EQRSKIMITSV----------------------
RPOC_STRMU      WTD------------------------EQRHKIMITTV----------------------
RPOC_STRP7      WTE------------------------EQRHKVLLTTV----------------------
RPOC_STAS1      FTE------------------------EQNKKILLTSV----------------------
RPOC_ARTS2      GWE------------------APEGWEPGQTALVQTSL----------------------
RPOC_LEIXX      A--------------------ADTGTEP-VTAVVETTL----------------------
RPOC_CORJK      EIEA---------------ELFPDGWQRGQTWLAETTL----------------------
RPOC_CUTAK      D----------------------ETVRADGSVILDTTL----------------------
RPOC_BIFLO      NWEPGEVKVLDPREGED--EVVKEERFHDGTVLFATSY----------------------
RPOC_TROWT      K--------------------------TLDSAVVETTL----------------------
RPOC_RUBXD      L------------------------GRVLFNESIERTL----------------------
RPOC_DEHMC      ----------------------------GKGNMLETTT----------------------
RPOC_ECOLI      GEL------------------------VAKTSLKDTTV----------------------
RPOC_BUCCC      KNL------------------------TEKKKIIKTTI----------------------
RPOC_PSEHT      GVV------------------------EDTITVIDTTV----------------------
RPOC_ALCBS      GNV------------------------EERTFIADTTP----------------------
RPOC_METCA      GER------------------------TESIKRVQTTV----------------------
RPOC_XYLFT      GLR------------------------NKASSIVDTTV----------------------
RPOC_COXBU      GEI------------------------EESDRLVNTAA----------------------
RPOC_PSYCK      GNR------------------------TKETSIKDTVA----------------------
RPOC_HYDCU      GVE------------------------TVKKGIVDTTV----------------------
RPOC_BURM1      KSEGAPEF-------------------VPKISLYATTV----------------------
RPOC_NITMU      ERR-------------------------EKITRYETTV----------------------
RPOC_FRATT      GNT------------------------YNEKGVVNTTV----------------------
RPOC_SYNAS      -----------------------------------TTV----------------------
RPOC_PELCD      TLV-------------------------------ETTT----------------------
RPOC_DESPS      -----------------------------------TTM----------------------
RPOC_BDEBA      -----------------------------------TTV----------------------
RPOC_LAWIP      ----------------------------------NTTA----------------------
RPOC_CAUVC      ----------------------------LLRKVIDTTP----------------------
RPOC_RHOPB      ----------------------------QVSRWYETTA----------------------
RPOC_RHOS4      ----------------------------EVVKRYQTTP----------------------
RPOC_ZYMMO      ----------------------------TYMKRVETTP----------------------
RPOC_GLUOX      ----------------------------SVRQTILTTP----------------------
RPOC_RICBR      ----------------------------IVPVIVDTTY----------------------
RPOC_ORITB      ----------------------------KVMALVNTTP----------------------
RPOC_NEOSM      -------------------------------KVYTTTF----------------------
RPOC_EHRRW      GNGP-----------------------TYYSKIVETTP----------------------
RPOC_SULDN      -------------------------------RIIHTTA----------------------
RPOC_SULNB      -------------------------------RIATSTA----------------------
RPOC_GRAFK      LVY----------------------------MIKDTTV----------------------
RPOC_PORGI      LVR----------------------------RMVETSV----------------------
RPOC_CYTH3      LVE----------------------------QMIDTVA----------------------
RPOC_SALRD      -------------------------------EMIDTTV----------------------
RPOC_CHLTE      DPV----------------------------RLVDTLVPEEQAERRAWLKSQIEQKKLLV
RPOC_RHOBA      DDES-----------------------GEYGAIIDTTP----------------------
RPOC_PARUW      KIKL-----------------------RTENGIIETTP----------------------
RPOC_AQUAE      -------------------------------EWIETTP----------------------
RPOC_CARRP      ---------------------------------INTTL----------------------
RPOC_THEMA      -------------------------------KRIKTTL----------------------
RPOC_MYCPE      PK----------------------------DGILITTV----------------------
RPOC_MYCGA      AK----------------------------QGIVITTV----------------------
RPOC_UREPA      SK----------------------------EGILVTTV----------------------
RPOC_MYCPN      EA----------------------------QGTLITTV----------------------
RPOC_MYCMO      VN--------------------------QNVEYIISTV----------------------
RPOC_MYCPU      LK--------------------------GDKGYIFSTV----------------------
RPOC_MYCH2      AK--------------------------TMRGHLISTV----------------------
RPOC_MYCS5      LQK-------------------------TDAPYIYSTV----------------------
                                                                            

RPOC_DEIRA      ---GRVQFRRMVQEALGAQGGLIDTLVDLET------------T----------------
RPOC_THET8      ---GRILFARIVAEAVEDEK-VAWELIQLDV------------P----------------
RPOC_TREPA      ---GRLVLNEEVP----AEIPFVNET----------------------------------
RPOC_BORAP      ---GRVIFNEALP----NGIEFVNKT----------------------------------
RPOC_LEPIC      ---GRLIFNTILP----EGYAYVNRP----------------------------------
RPOC_FUSNN      ---GRVLFNEILP----EIDRNYHKT----------------------------------
RPOC_CALS4      ---GKIIFNEAIP----QDLGFVD-------------------RNNPETAFNLEINDL--
RPOC_SYMTH      ---WNTVSGKRIK----TTIGRMI-------------------FNEVLHPKLRYINET--
RPOC_LACSS      ---GKVMFNEIMP----ADFPYLNEPTTDNL------------MNGVPDKYFIDNGED--
RPOC_LEUMM      ---GKLFFNEILP----SDFPYINEPSEDN-------------FKRVDDSFFIDAGEN--
RPOC_STRMU      ---GKILFNDIMP----ADLPYLQEPNNANL------------TDKTPDKYFLAPGSN--
RPOC_STRP7      ---GKILFNDIMP----EGLPYLQEPNNANL------------TEGVPAKYFLPLGGD--
RPOC_STAS1      ---GKVIFNEIIP----DSFAYINEPTQTNL------------ENKTPEKYFIAPTEIGE
RPOC_ARTS2      ---GQVIFNQTLP----EDYPWVEAV----------------------------------
RPOC_LEIXX      ---GRALFNEALP----VDYPYVEAV----------------------------------
RPOC_CORJK      ---GRVLFNELLP----WNYPYVEGV----------------------------------
RPOC_CUTAK      ---GQALFNEVLP----DDYPYVDFL----------------------------------
RPOC_BIFLO      ---GRILFNETLP----TDYPFVNEQ----------------------------------
RPOC_TROWT      ---GRAIFNEALP----DGHPYINEL----------------------------------
RPOC_RUBXD      ---RGYLGDAYNP----AAYRFVNHE----------------------------------
RPOC_DEHMC      ---GRIIFNDVLP----KAVEFQNMD----------------------------------
RPOC_ECOLI      ---GRAILWMIVP--KGLPYSIVNQA----------------------------------
RPOC_BUCCC      ---GRAILWIHVP--MGLPFKIFNKT----------------------------------
RPOC_PSEHT      ---GRAILSLILP--KGMPYESINQP----------------------------------
RPOC_ALCBS      ---GRCKLWDIVP--AGLGFDMVNQN----------------------------------
RPOC_METCA      ---GRALIWNIVP--EGIPFEMVNVD----------------------------------
RPOC_XYLFT      ---GRALLSEILP--EGLPFVLVNTE----------------------------------
RPOC_COXBU      ---GRILLWQIVP--KGLPFALVDQP----------------------------------
RPOC_PSYCK      ---GRLLIWNIMP--VGMSFDECNEE----------------------------------
RPOC_HYDCU      ---GRALLLRILP--KGLGFDLLNLN----------------------------------
RPOC_BURM1      ---GRAILSEILP--PGLPFSVLNKP----------------------------------
RPOC_NITMU      ---GRALLSEILP--AGLPFPLINKV----------------------------------
RPOC_FRATT      ---GRALLLNILP--EGLSFSLLNKV----------------------------------
RPOC_SYNAS      ---GRVILYEIIP--EAISFDVINKV----------------------------------
RPOC_PELCD      ---GRVLLRDVVP--EVIPFDYINVV----------------------------------
RPOC_DESPS      ---GRIILGELVP--KSVPFVEVNKV----------------------------------
RPOC_BDEBA      ---GRAILSDIVP--KEVPFNEVNVT----------------------------------
RPOC_LAWIP      ---GRILVWEGLP--KGLKFEYVNCV----------------------------------
RPOC_CAUVC      ---GRMKIAALLPHHPQIGHRLIEKA----------------------------------
RPOC_RHOPB      ---GRTMLGQVLPKSVKMPFDVINKL----------------------------------
RPOC_RHOS4      ---GRLRLGNLLPLNAKAPFELVNRL----------------------------------
RPOC_ZYMMO      ---GRMLLGETLPQNYKVPFETINRL----------------------------------
RPOC_GLUOX      ---GRALIAQILPKHQAIPFSLVNKQ----------------------------------
RPOC_RICBR      ---GRLMVGELLPSNPNIEYKFINKP----------------------------------
RPOC_ORITB      ---GRLMLGELLPDGDNISFDVVNKV----------------------------------
RPOC_NEOSM      ---GRLQLLKILP--KGVPFESINMV----------------------------------
RPOC_EHRRW      ---GRLMLWQIFPEHKNLTFDLVNQV----------------------------------
RPOC_SULDN      ---GRMLLKAILP--NFVPSELWNRV----------------------------------
RPOC_SULNB      ---GRLILKSIIP--DYVPEKYWNKV----------------------------------
RPOC_GRAFK      ---GRVLFNEAVP----EKAGYINEV----------------------------------
RPOC_PORGI      ---GRLMVNEYVP----KKVGYVNEV----------------------------------
RPOC_CYTH3      ---GRVLFNLVVP----EEVGFVNEL----------------------------------
RPOC_SALRD      ---GRVIFNETLP----DTLDYVNEV----------------------------------
RPOC_CHLTE      TTVGRVIFNQHMP----EEIGFINKL----------------------------------
RPOC_RHOBA      ---GRVRFNEMLP----VGMDFYNRA----------------------------------
RPOC_PARUW      ---GRVVFNTIVP----KELGFQNYS----------------------------------
RPOC_AQUAE      ---GRVLFNSIMP----EGQPFVNKT----------------------------------
RPOC_CARRP      ---GRIIINYLFFKNFDYFLNIV-------------------------------------
RPOC_THEMA      ---GRVIFNGILP----EDLRDYNRI----------------------------------
RPOC_MYCPE      ---GKVILNDVLPEEMSYLNNPD-NLEEL----------------------SDNDIVEWG
RPOC_MYCGA      ---GKAIMNSIMPEEMAYLNDGD-NLLEL----------------------DESNIVFAG
RPOC_UREPA      ---GKIIFNQAFPVNFPYINDVK-NLYGE----------------------NQFEIIGMH
RPOC_MYCPN      ---GKIIFNDVLGDNIPYINEGEFDEHAC----------------------PQKFIVPPS
RPOC_MYCMO      ---GKFIFNRAFPDNFPFIFDNKFDNYR------------------NNEE--NKYLVPKG
RPOC_MYCPU      ---GKFIFNQAFPENFPFIFDSSVSSIS------------------DAQEYTKKYYIPYG
RPOC_MYCH2      ---GKFILNNIFPANFPFIFDDNVDELEL-----------------NYPSQIKKYVLPYG
RPOC_MYCS5      ---GKFILNNAFPRDFDFVFGKRVTEKLTSTNEHGEEVVSLKTKIDTSEHDIKRYVFNYG
                                                                            

RPOC_DEIRA      ---------------YEKDALKDMVMACFKHLG---------------------------
RPOC_THET8      ---------------QEKNSLKDLVYQAFLRLG---------------------------
RPOC_TREPA      ---------------LDDKRIRKLIERVFKRQD---------------------------
RPOC_BORAP      ---------------LSDLELQILISKVYVVHG---------------------------
RPOC_LEPIC      ---------------LSDKETNRIIADVYDKYG---------------------------
RPOC_FUSNN      ---------------YGKKEIKSLIKSLYEAHG---------------------------
RPOC_CALS4      ---------------VDKSKLGKILDRVYRIHG---------------------------
RPOC_SYMTH      ---------------IEKKWMGKIIDMAYRKLG---------------------------
RPOC_LACSS      --IHDYLAGAPVILPFKKGFLSDIIAQVFKVYK---------------------------
RPOC_LEUMM      --IHDYLADTSIVNPFKKGFLSDIIAEVYKRYK---------------------------
RPOC_STRMU      --IQEAIKNLDLNIPFKKKNLGNIIAEIFKRFR---------------------------
RPOC_STRP7      --IKEAISNLELNPPFKKKNLGNIIAEIFKRFR---------------------------
RPOC_STAS1      EGLKAYFDEQPLIKPFNKNFLGNVIAEVFNRFS---------------------------
RPOC_ARTS2      ---------------ADKGELSRIVNDLAERYP---------------------------
RPOC_LEIXX      ---------------ADKGQISAIVNALAERYP---------------------------
RPOC_CORJK      ---------------MAKKPQASVINDLAAKYP---------------------------
RPOC_CUTAK      ---------------VGKKQIGKIVNDLSERMT---------------------------
RPOC_BIFLO      ---------------VAKGRLSKIVDDIAMRYS---------------------------
RPOC_TROWT      ---------------VDKQVISSIINNLAEVYS---------------------------
RPOC_RUBXD      ---------------LKKGEIKQLVQQYVERYP---------------------------
RPOC_DEHMC      ---------------IPKSAIKKIIGRCYKILS---------------------------
RPOC_ECOLI      ---------------LGKKAISKMLNTCYRILG---------------------------
RPOC_BUCCC      ---------------LRKSHISEILNTCYRLLG---------------------------
RPOC_PSEHT      ---------------LGKKQISGLINECYRRLG---------------------------
RPOC_ALCBS      ---------------MTKKAISKLLNTCYRILG---------------------------
RPOC_METCA      ---------------MTKKAISRLINHAYRTLG---------------------------
RPOC_XYLFT      ---------------MTKKNISRLINSSYRMLG---------------------------
RPOC_COXBU      ---------------MTKKAVTKLLDFCYRNLG---------------------------
RPOC_PSYCK      ---------------MTKKNISKLINSCYRKVG---------------------------
RPOC_HYDCU      ---------------LTKKNISKALNACYRILG---------------------------
RPOC_BURM1      ---------------LKKKEISRLINTAFRKCG---------------------------
RPOC_NITMU      ---------------LKKKEISKLINASFRRCG---------------------------
RPOC_FRATT      ---------------LVKKEISKIINQAFRVLG---------------------------
RPOC_SYNAS      ---------------MNKKELANLIDYCYRLCG---------------------------
RPOC_PELCD      ---------------MAKKHVANLIDVCFRLAG---------------------------
RPOC_DESPS      ---------------MSKKALAALIDYTYRHAG---------------------------
RPOC_BDEBA      ---------------MGKKQIAALIDKTFRLAG---------------------------
RPOC_LAWIP      ---------------LTKKNIATLVGNAYRDAG---------------------------
RPOC_CAUVC      ---------------LTKKEIGNLIDIVYRHCG---------------------------
RPOC_RHOPB      ---------------MTKKEISGVIDQVYRHCG---------------------------
RPOC_RHOS4      ---------------LRKKDVQNVIDTVYRYCG---------------------------
RPOC_ZYMMO      ---------------LTKKDIADVIDTVYRHTG---------------------------
RPOC_GLUOX      ---------------LTKKNVSDVIDTVYRHCG---------------------------
RPOC_RICBR      ---------------LTKKDISLVIDLVYRHCG---------------------------
RPOC_ORITB      ---------------MTKKGISAIVDMVYRYYG---------------------------
RPOC_NEOSM      ---------------LTVRDISNLVDLVYKTCG---------------------------
RPOC_EHRRW      ---------------LTVKEITAIVDLVYRSCG---------------------------
RPOC_SULDN      ---------------MKKKAINEVVDYVQKHGG---------------------------
RPOC_SULNB      ---------------LKKKDIGALVDYIYKIGG---------------------------
RPOC_GRAFK      ---------------LTKKSLREIIGKILKITS---------------------------
RPOC_PORGI      ---------------LGKKALRDIIGSVIKICG---------------------------
RPOC_CYTH3      ---------------LTKKKLQLIIGMVFKIAG---------------------------
RPOC_SALRD      ---------------LSTKNVRPVIARVLKQTG---------------------------
RPOC_CHLTE      ---------------INKKVAKELIAQLSSEVG---------------------------
RPOC_RHOBA      ---------------MRSGDLAKSISDCYQRLG---------------------------
RPOC_PARUW      ---------------LPKKKMGELVMQCYKKAG---------------------------
RPOC_AQUAE      ---------------LDKKGLSKLITELYIRVG---------------------------
RPOC_CARRP      ---------------FKKKILTYLIKYLFDFNQ---------------------------
RPOC_THEMA      ---------------FDKKQINALVYETFKRHG---------------------------
RPOC_MYCPE      KDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDAS------------------------
RPOC_MYCGA      EDFKQKLAKRPLYKPFGKKTLSKIIEILYKNFP---------------------------
RPOC_UREPA      ESILDYLKAYNLKEPLTKKTLSTVIDYLYKVSE---------------------------
RPOC_MYCPN      GDVRAAIAAHQVLPAFGKKVISKLIDLLYTVVE---------------------------
RPOC_MYCMO      TKLDEYIKNLPVNNPFNKKEIAKFVRIVFDEFSGAMPISKIASVVKKVNSGNYHDTVMMY
RPOC_MYCPU      LNIKETIQNTPINDALSKKDLSKIIRTIFDKYVPVLTKEDVASVINDVNHTNYKDTSTKF
RPOC_MYCH2      TNFREYIQNLKVNEPLNKKAIAKIVRQIFDTYDGLLAKEDIATVIDQLDFGNYQNRVLLY
RPOC_MYCS5      DNFTAKIKEADVNLPLNKKEIAKIVRNIYEKYVPIVNIEDISQVINKIDKTQLDNLHELC
                                        :                                   

RPOC_DEIRA      ------------------------------------------------------------
RPOC_THET8      ------------------------------------------------------------
RPOC_TREPA      ------------------------------------------------------------
RPOC_BORAP      ------------------------------------------------------------
RPOC_LEPIC      ------------------------------------------------------------
RPOC_FUSNN      ------------------------------------------------------------
RPOC_CALS4      ------------------------------------------------------------
RPOC_SYMTH      ------------------------------------------------------------
RPOC_LACSS      ------------------------------------------------------------
RPOC_LEUMM      ------------------------------------------------------------
RPOC_STRMU      ------------------------------------------------------------
RPOC_STRP7      ------------------------------------------------------------
RPOC_STAS1      ------------------------------------------------------------
RPOC_ARTS2      ------------------------------------------------------------
RPOC_LEIXX      ------------------------------------------------------------
RPOC_CORJK      ------------------------------------------------------------
RPOC_CUTAK      ------------------------------------------------------------
RPOC_BIFLO      ------------------------------------------------------------
RPOC_TROWT      ------------------------------------------------------------
RPOC_RUBXD      ------------------------------------------------------------
RPOC_DEHMC      ------------------------------------------------------------
RPOC_ECOLI      ------------------------------------------------------------
RPOC_BUCCC      ------------------------------------------------------------
RPOC_PSEHT      ------------------------------------------------------------
RPOC_ALCBS      ------------------------------------------------------------
RPOC_METCA      ------------------------------------------------------------
RPOC_XYLFT      ------------------------------------------------------------
RPOC_COXBU      ------------------------------------------------------------
RPOC_PSYCK      ------------------------------------------------------------
RPOC_HYDCU      ------------------------------------------------------------
RPOC_BURM1      ------------------------------------------------------------
RPOC_NITMU      ------------------------------------------------------------
RPOC_FRATT      ------------------------------------------------------------
RPOC_SYNAS      ------------------------------------------------------------
RPOC_PELCD      ------------------------------------------------------------
RPOC_DESPS      ------------------------------------------------------------
RPOC_BDEBA      ------------------------------------------------------------
RPOC_LAWIP      ------------------------------------------------------------
RPOC_CAUVC      ------------------------------------------------------------
RPOC_RHOPB      ------------------------------------------------------------
RPOC_RHOS4      ------------------------------------------------------------
RPOC_ZYMMO      ------------------------------------------------------------
RPOC_GLUOX      ------------------------------------------------------------
RPOC_RICBR      ------------------------------------------------------------
RPOC_ORITB      ------------------------------------------------------------
RPOC_NEOSM      ------------------------------------------------------------
RPOC_EHRRW      ------------------------------------------------------------
RPOC_SULDN      ------------------------------------------------------------
RPOC_SULNB      ------------------------------------------------------------
RPOC_GRAFK      ------------------------------------------------------------
RPOC_PORGI      ------------------------------------------------------------
RPOC_CYTH3      ------------------------------------------------------------
RPOC_SALRD      ------------------------------------------------------------
RPOC_CHLTE      ------------------------------------------------------------
RPOC_RHOBA      ------------------------------------------------------------
RPOC_PARUW      ------------------------------------------------------------
RPOC_AQUAE      ------------------------------------------------------------
RPOC_CARRP      ------------------------------------------------------------
RPOC_THEMA      ------------------------------------------------------------
RPOC_MYCPE      ------------------------------------------------------------
RPOC_MYCGA      ------------------------------------------------------------
RPOC_UREPA      ------------------------------------------------------------
RPOC_MYCPN      ------------------------------------------------------------
RPOC_MYCMO      ADLFKDKQNKKS--VRHAQILANYTKQEFEKINKKLTLQ-NEG--VERVWDSKHRSELLE
RPOC_MYCPU      ANLVTTNKTALE--YIHAESLSKFTTKHFVDVNKKLSLK-TPGNPNQPIWEVDQYVELLE
RPOC_MYCH2      EKLRDYKKQKLP--VPHLSKLSEFTIFEYSQLYKQLQQ--NGPVESYRVLEDHEKAELLE
RPOC_MYCS5      SELKDFNGNKLEDNRIHLELLVRLIKEEFLKIQDQYFAKDEESIFNHKYWELKHYTKLLE
                                                                            

RPOC_DEIRA      ------IEATAGLLDGLKEGGFKLSTTSGITIGIDDIVLPPNKGELLAEADQMLAEIEQN
RPOC_THET8      ------MEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEKKQYLEEADRKLLQIEQA
RPOC_TREPA      ------SWLAVQMLDALKTIGYTYATFFGATLSMDDIIVPEQKVQMLEKANKEVLAIASQ
RPOC_BORAP      ------SSTVIEMLDIIKELGFKYATKFGCTISMSDIIVPDEKKAYIDRANKEIAKIQND
RPOC_LEPIC      ------PAKTVLMLDDIKKLGYRYATLFAPTISIEDIRVSPGKVGLVGDANKEVEKADSE
RPOC_FUSNN      ------FTETAELINRVKNFGYHYGTFAGVSVGIEDLEVPPKKKSLLNQADKEVAQIDKD
RPOC_CALS4      ------PTKTAETLDKIKELGFKYSTKAAITISVSDMVIPKEKEKLLKEADEMVAKIEAQ
RPOC_SYMTH      ------TVKTAEQTDKIKDLGFRFATQSGATIAISDIKVPGDKDEILRQAEKEVDQVERN
RPOC_LACSS      ------VQRTSDLLDDMKTLGYVQATHAGLTVGVADVPQLPEKQEIVDDAHKKVTTISKQ
RPOC_LEUMM      ------VTETSLLLDRMKDLGYDKSTESGLTVSMTDVLELEEKPAILEDAHSQVATVTKQ
RPOC_STRMU      ------TTETSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKQEIIDAAHHRVEEISKA
RPOC_STRP7      ------TTETSALLDRMKNLGYHHSTLAGLTVGIADIPVVDDKAEIIEESHKRVEQITKQ
RPOC_STAS1      ------ITDTSMMLDRMKDLGFKFSSKAGITVGVSDIVVLPDKQDILDEHEKLVEKVTKQ
RPOC_ARTS2      ------KVVTAATLDNLKDAGFYWATRSGVTVAISDIEVPAEKPVILAGYEERAAKIQGQ
RPOC_LEIXX      ------KVEVAAALDRIKDAGFYWGTRSGVTVSLSDILTPPNKPQIVAGYEKKAAKINSE
RPOC_CORJK      ------MITVAQTVDKLKDAGFYWATRSGVTITMHDVLVLPNKQEVLDNYEAKARVIEKK
RPOC_CUTAK      ------QLEVAHVLDNLKDIGYKWGSLSGVTVSIGDVQTPPTKPEILAGYETRAAKVDRE
RPOC_BIFLO      ------TQQVAATLDALKDLGFTRAPWSGVSFAFSDVNEPPERDEKIAEYEAKADKVNAN
RPOC_TROWT      ------KVEVANTLDKIKSVGFHWATRSGVTVAISDVVSPPEKQEIISKYEAQARGVQQD
RPOC_RUBXD      ------TELVSQLLDTLKHVGFHTATLAGISIGKNDIVVPEQKREILEKYEKLVEEVEEQ
RPOC_DEHMC      ------SQDMAVMLDKIKELGFKFATSSGISIAMSDISVPREKTKLVAAADERTAIAEGQ
RPOC_ECOLI      ------LKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAEVAEIQEQ
RPOC_BUCCC      ------LKKTVRLADQMMYIGFSYAAKSGVSVGINDIIIPKEKEKIIFQAEKEVLEIDKQ
RPOC_PSEHT      ------LKDTVMFADQIMYTGFHYAMKSGVSIGIDDLVIPPVKAQIIESAEAEVTEINQQ
RPOC_ALCBS      ------TKETCIFADQLMYLGFREATLSGSSIGVEDMVIPDAKYTMIDAAEEEVREIEEQ
RPOC_METCA      ------IKASVIFADQLMYLGFSHATRAGVSFGVEDMEIPVRKDEIIQAAEREVKEIQNQ
RPOC_XYLFT      ------LKETVVFADKLMYTGYAYATRAGVSICIDDMLIPIEKKEILGEAEQEVLEIQEQ
RPOC_COXBU      ------LKTTVIFADKLMYMGFHYATHSGVSIGINDLVVPDQKEAIISRAEDEVREIEKQ
RPOC_PSYCK      ------VKESVMFADQLMYLGFAQATLSGVSIGIDDMVIPPLKKQIIEVAEAEVREIEDQ
RPOC_HYDCU      ------PKETVIFADQLMYAGFKWSTLAGLSFCSDDMLIPDDKAPIIERADEQVTEIQRQ
RPOC_BURM1      ------LRATVVFADQLMQSGFRLATRAGISICVDDMLVPPQKETIVGDAAKKVKEYDRQ
RPOC_NITMU      ------LRETVIFADKLMYAGFSYATRAGISICLDDMLTPAQKDAIISASEKEVQEIELQ
RPOC_FRATT      ------GKATVVLADKLMYAGFKYSTLSGVSVGVDDMTIPDNKEAKIEEAEKEIKQITEQ
RPOC_SYNAS      ------EKTTVILADRLKDMGFKYATHSGMSFAVRNLNIPKNKKDIVVRADRDVLEIQKQ
RPOC_PELCD      ------NKETVLLADKLKDTGYRFSTMAGISICLDDMVIPESKDVLMKAAVEEVTEIQKQ
RPOC_DESPS      ------TKDTVILADRLKDTGYEYATRAGISICIDDMKIPATKVGLVKKGEDEVLDVEQQ
RPOC_BDEBA      ------AKATCILADKIMEYGFKYSTAAGMSIGIDDMVIPAAKAPMIADAEKQVTEIQQQ
RPOC_LAWIP      ------IKATVILCDRLKDIGYEYATRAGITIGVKDLIIPATKKTIIDTATSEVDDIERQ
RPOC_CAUVC      ------QKATVIFADKVMGLGFKEAAKAGISFGKDDIIIPVRKTAIVEETRKLAEEYEQQ
RPOC_RHOPB      ------QKETVMFCDRIMALGFYNAFKAGISFGKDDMVVPASKWKTVEDTRTLAKEFEQQ
RPOC_RHOS4      ------QKESVIFCDQIMGMGFREAFKAGISFGKDDMLIPDTKWPIVNEVRDQVKEFEQQ
RPOC_ZYMMO      ------QKDTVLFADAIMSLGFKYACKAGISFGKDDMIVPAAKEALVEETRALVQDFEQQ
RPOC_GLUOX      ------QKEAVIFCDRLMGLGFRHAARAGISFGKDDMIIPEAKATLVGKTSEEVKEFEQQ
RPOC_RICBR      ------QKATVIFADQLMKLGFKYACSSGISFGMDDMVVPKSKIVHIDETQLEIKEFEQQ
RPOC_ORITB      ------QKATVVFADKLMKLGFKYACISGISFGMDDMIVPETKSKHVNDTLLEVQEFERQ
RPOC_NEOSM      ------HGKTVEFADGIMELGFRYATLSGISFGKDDMVVPPTKSEHVRRANEEVKEYEFQ
RPOC_EHRRW      ------QSETVEFSDKLMSLGFRYASQSGISFGRMDMIIPDTKTMHVDNASEKIKEFAVQ
RPOC_SULDN      ------IGVTAGFLDRLKNLGFKHATEAGISISIDDIKIPAGKEAKIAESKNRVFEIQKQ
RPOC_SULNB      ------VSETAGFLDNLKDMGFKYATKVGVSISVDDIKIPEMKEGRVQTAKEQVKEIQRQ
RPOC_GRAFK      ------VPETSEFLDEIKGLGYGFAFRGGLSFSLGDIIIPEEKQSMIDEANEQVEGIIGN
RPOC_PORGI      ------VATTAKFLDDIKNLGYYMAFKGGLSFNLADVLIPDEKDQLIQEGYTAVEQIMQD
RPOC_CYTH3      ------MSKTAKFLDDIKQIGFQMAFRGGLSIGLDNIGIPADKNTLIDGAKKEVDSVWSN
RPOC_SALRD      ------FEETADFLDAIKDMGFRRSTTSGMTFSLSDIIIPDEKEELIEEANETVEEAEQN
RPOC_CHLTE      ------NVETARFLDNIKEVGFDYAMRGGLSIGLSDAIVPETKVKHIKNAQRDSAKIIKE
RPOC_RHOBA      ------RKATIHLLDDMMQTGFRESTRSGLSFATDDLVTPDTKLQFIKEAEKEVMKHKKA
RPOC_PARUW      ------LEATVRFLDNLKSIGFAEATKSALSMGVCDVKIPTIKQKILHDAHERVAVVRKQ
RPOC_AQUAE      ------NEETVKFLDRVKELGFLRSTLAGISIGVEDLQVPKAKKKIIEEALKKTEEIWNQ
RPOC_CARRP      ------LSKIIIILEKLKKIGFLISTYSGITISYFDLI------EVKNTFLINKVVFKLK
RPOC_THEMA      ------IDRAADLLDDIKDIGFHYATVSGLTLSLKDLKIPPERDEILRKTWEKVRIIEEN
RPOC_MYCPE      ------LEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKY
RPOC_MYCGA      ------LQKVPQVLDKIKEFGFKYSTLSSTTISVFDIPRYDNKQEYITKANEMIAKLKHM
RPOC_UREPA      ------IEVVPQTMDKIKALGFKYSMISATSISAFDIPSYDQKYEYFKETDELVSKLREF
RPOC_MYCPN      ------FKDLPRILENIKALGFKYSTHSSTTVSVFDIPKYSNKQQYFDEADQQVLKYKQF
RPOC_MYCMO      KIWFAYNNIVASVLDKIKVLGFKFSMQSGSTFSINDIKTSLDKEKYVKEGEEYINNLNKM
RPOC_MYCPU      NVWFDYVNIVASVLDEIKDLGFKFSTKSGTSISIHDIEVSDNKKERIKEGDDYTSELKSM
RPOC_MYCH2      KIWFKYNNMVCSILDKIKDLGFHYSTLSGTSIAISDIKMAPKKHEFIKDGENYINKLNTF
RPOC_MYCS5      RVWFRYSNYVSTVLDVIKDLGFKFSTKSGITISMNDIVTSKTTKERIKKAEEETEALKDY
                              : :   *:  .   . :.   :                        

RPOC_DEIRA      FEFGFMTEEERYKQVVQLWNNTTDAVKDAVFENFSKNYP---------------------
RPOC_THET8      YEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYP---------------------
RPOC_TREPA      YRGGHITQEERYNRVVEVWSKTSEELTSLMMETLERDKD--------------------G
RPOC_BORAP      YAKGVITGEERYNNVVSVWLKTNEELTNKMMEILKKDRD--------------------G
RPOC_LEPIC      YRKGIITNEERRKKVIEIWTKTNDLITESMFKELEKDKG--------------------G
RPOC_FUSNN      YKSGKIINEERYRKTIEVWSRTTEAVTDAMMKNLDE------------------------
RPOC_CALS4      FRRGLISEEERYEKVIETWNMTTEKVTEALMATLDK------------------------
RPOC_SYMTH      YRRGLITNDERYQRVIAIWSEAKEKVTSTLVKTMED------------------------
RPOC_LACSS      FRRGLITDEERHARVIEIWNDAKDDIQQRLTDSFDP------------------------
RPOC_LEUMM      FRRGLITDSERYQRVTEIWTKAKDIIQDKLIESFEP------------------------
RPOC_STRMU      FRRGLMTDDDRYEAVTATWRDAKEQLEARLVETQDA------------------------
RPOC_STRP7      FRRGMITDDERYNAVTAEWRAAREKLEKRLIANQDP------------------------
RPOC_STAS1      FNRGLITDFERYNAVIEIWTDAKDQIQNELMGSLEK------------------------
RPOC_ARTS2      YDKGLIDDDERRQELIEIWNKATNEIAQVMRDNLSP------------------------
RPOC_LEIXX      FEKGLTTDLERRQELVKIWTEATNEVAEAMSANFPA------------------------
RPOC_CORJK      MARGKINEAERYQSLVDLWKEATDYVGQSVEDLYPD------------------------
RPOC_CUTAK      YDRGAVTEEERRQDLIQIWTEATAELTAAMEANFTQ------------------------
RPOC_BIFLO      YEMGLLTEEARRQELIDLWTECTAEVSKEVEEKFDP------------------------
RPOC_TROWT      FEIGLLTDLERRQALVSIWSEATDRVAEAMRKCFPD------------------------
RPOC_RUBXD      WEAGFISDEERAERVIGLWTQAKNEVEEAMKANLWK------------------------
RPOC_DEHMC      FARGLITEDERYNSIIETWMETTDRITDAIQAGFDK------------------------
RPOC_ECOLI      FQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRD---------GQEEKQVS
RPOC_BUCCC      FQTGLVTSSERYNKVIDIWAIANENIADAMMKNLSYEIIFQKN---------KKKITQKS
RPOC_PSEHT      FQSGLVTAGEKYNKVIDIWSRVNENLSREMMSNLSKDTVINAQ---------GEEVEQAS
RPOC_ALCBS      FASGLVTRGERYNKVVDIWARTNDQIAKAMMENLRVEVVKNRD---------GKDEEQGS
RPOC_METCA      FASGLVTDGERYNKVVDIWSHANDQVAKVMMEGLGVDEVTVGN---------GETIKQKS
RPOC_XYLFT      YQSGLVTAGERYNKVVDIWSRTNERIAKAMMDTIGTERVVNAD---------GEIVDQKS
RPOC_COXBU      YASGLVTHGERRNKVIDIWSRTNDQVAKAMMEKIAVEKVKDAE---------GKEVAQSS
RPOC_PSYCK      FEQGFVTAGERYNKVVDIWSRTNDKVAKAMMDNLATDKIINAK---------GEEEEQKS
RPOC_HYDCU      FAQGLVTEGERYNKVVDIWSHTNELVTKSMMEELQYETVTDAE---------GNEVKQTS
RPOC_BURM1      YMSGLVTAQERYNNVVDIWSATSEAVGKAMMEQLSTEPVIDRD---------GNETRQES
RPOC_NITMU      YTSGLVTQGERYNKVVDIWGRAGDQVAKAMMDQLGVEPIIDPETGTAKTGESGKPLIQES
RPOC_FRATT      YQSSLITENERYNNIINIWSKTSDEVGASMMDAISKDTVSING----------EKKEIES
RPOC_SYNAS      YMDGLITDGERYNKVIDLWAQATEKIASEMMGGIETEEQITTEG---------KKVVE-S
RPOC_PELCD      YTEGLITDGERYNKVIDIWAKCTEDIAQTMLDTLSKDEIVSPEGE--------AVKVP-S
RPOC_DESPS      YSDGLITAGEKYNKVIDIWSKVSEDVANEMMDEIKTETFEDKDGN--------LVEGP-S
RPOC_BDEBA      YDEGLITDGERYNKVVDIWAQTADKIAKEGMNAIEKQTF-NVNGK--------EVVGP-S
RPOC_LAWIP      YRDGIITRTEKYNKVVDVWTKATQDISSEMTKEISTEVVKDPKTE--------RTEVNQS
RPOC_CAUVC      YADGLITKGEKYNKVVDAWAKATDRVADEMMAELQMKHKDENG-------------REKE
RPOC_RHOPB      YNDGLITHGEKYNKVVDAWSKCTKKISEDMMTEISAVKKNPKG-------------GEAQ
RPOC_RHOS4      YMDGLITQGEKYNKVVDAWSKCSDKVAGEMMAEISAVRYDDAG-------------AEKE
RPOC_ZYMMO      YQDGLITQQEKYNKVIDAWSRCGDRVAGEMMKEIQMVHKGPDG-------------RELP
RPOC_GLUOX      YQDGLITAGERYNKVVDAWSRCTDEVQAAMLKEISKQVIG------------------KP
RPOC_RICBR      YSNGLITYGEKYNKVIDAWSRCTDRVANDMMKEIAKPPVSDD--S-----------NQQK
RPOC_ORITB      YSEGLITSGEKYNKVIDAWSRYTDRVANDMMKGIAAGDQTSVGLT-----------NQER
RPOC_NEOSM      YQEGLITKHEKYNKVVDAWQKCTDLVAKDMMDGISGYESVAE------------------
RPOC_EHRRW      YQDGLITKSERYNKVIDEWSKCTDLIAKDMMKAISVYDEESK------------------
RPOC_SULDN      FEAGLLTEQERYNKIIDVWTDTNNTLATQMMDLVQTDKA--------------------G
RPOC_SULNB      YAAGLLTDQERYNKIIDIWTDANNSIAEALMDLIRKDKD--------------------G
RPOC_GRAFK      YNMGLITNNERYNQVIDIWTSTNAGLTDLAMKRIREDKQG--------------------
RPOC_PORGI      YSMGFITFNERYNQIIDTWTHINGRLSNVLIKQLSSDNDG--------------------
RPOC_CYTH3      YLMGLITDNERYNQVIDIWTRVNSEITDTLMKQLEADQQG--------------------
RPOC_SALRD      YSMGFITDNERYNQVIDVWTKTNNKVSEVLFDALKEHKEG--------------------
RPOC_CHLTE      YNRGTLTDNERYNQIVDVWQKTSNLVADESYEKLKKDRDG--------------------
RPOC_RHOBA      YDRGLMTGKERYNQVLDAWTHAREAITADMMSAMENDIRPGGW----------------Y
RPOC_PARUW      YEDGIITEGERYSKTISIWTEVSDVLSEELFKLISEVKDST-------------------
RPOC_AQUAE      YVQGIITNKERYNRIIDVWSEATNLVSKAMFEEIEKSKRIENGKE-----------YPGT
RPOC_CARRP      YNNNIFSIVELLNNFFVKIIIKKIQINKTGLK---------------------------K
RPOC_THEMA      YEKGFLTEEQRKSEIIRLWMSVTEEITKLTSKTLAEDP----------------------
RPOC_MYCPE      YQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEY--------------------L
RPOC_MYCGA      YQKGLLTDDERYTKVIRLWADVKDNVSRDIKEIITRPEY--------------------K
RPOC_UREPA      YLDGKLTDDERYTKVVQAWSQTKDKVTHDIEKLINSNEY--------------------K
RPOC_MYCPN      YNKGLLTDDERYKRVVKLWNGVKEKVSSEIQDLIKREEY--------------------R
RPOC_MYCMO      YENGFITDDEKYTLAISEWAKIKEKITNSLKKIIEDN----------------------K
RPOC_MYCPU      YREGLLTDDERYSLTINKWSEVKDNIQNDLKKIVKNN----------------------P
RPOC_MYCH2      YAKGLITDDERYVLAIAKWTQIKNDIQEDLNQSIKDD----------------------N
RPOC_MYCS5      FKKGYLTDDERYTLTIKKWSDVKESIEKELKKVVDSN----------------------L
                   .                     :                                  

RPOC_DEIRA      FNPLWIMSQSGARGNPQQIRQLAGMRGLMARPD-------------------GSTIEVPI
RPOC_THET8      FNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPS-------------------GETFEVPV
RPOC_TREPA      FNTIYMMATSGARGSRNQIRQLAGMRGLMAKPS-------------------GDIIELPI
RPOC_BORAP      FNVIYMMADSGARGSRNQIRQLAGMRGLMAKTS-------------------GDIIELPI
RPOC_LEPIC      FNPVFIMAASGARGSKQQIRQLAGMRGLMAKPS-------------------GEIIELAI
RPOC_FUSNN      FNPVYMMATSGARGNVSQMRQLAGMRGNMADTQ-------------------GRTIEVPI
RPOC_CALS4      FNPIFMMAHSGARGSKNQIRQLAGMRGLMADPS-------------------GRIIELPI
RPOC_SYMTH      FNPVNMMMKSGARGNISQITQLAGMRGLMADPS-------------------GKIVELPV
RPOC_LACSS      TNPISMMSDSGARGNISNFTQLAGMRGLMAAPN-------------------GGMMEVPV
RPOC_LEUMM      TNPIFMMQDSGARGNISNFVQLAGMRGLMAGPG-------------------GKIIELPV
RPOC_STRMU      KNPIVMMMDSGARGNISNFSQLAGMRGLMAAPN-------------------GRIMELPI
RPOC_STRP7      KNPIVMMMDSGARGNISNFSQLAGMRGLMAAPN-------------------GRIMELPI
RPOC_STAS1      TNPIFMMSDSGARGNASNFTQLAGMRGLMAAPS-------------------GEIIELPI
RPOC_ARTS2      MNTINRMVSSGARGNWMQVRQIAGIRGLVANPK-------------------GEIIPRPI
RPOC_LEIXX      DNTINRMVTSGARGNWLQVRNIAGMRGLVNNPK-------------------GEIIPRPI
RPOC_CORJK      DNPIPMIVKSGAAGNMRQIWTLAGMKGMVTNSR-------------------GEYITRPI
RPOC_CUTAK      TNPIHMMVDSGARGSMTQMRQIAAMRGLVADPK-------------------GDIIPRPI
RPOC_BIFLO      TSNLAIIVQSGARGNMMQINQIAGMRGLVANPK-------------------GEIIPRPV
RPOC_TROWT      DNTINTMVTSGARGNWLQVRNIAGMRGLVANPK-------------------GETIPRPI
RPOC_RUBXD      LNPIYMMANSGARGSYSQITQLAGMRGLMTNAK-------------------GEIIDEPV
RPOC_DEHMC      QGSVYMMANSGAKGNISQIRQMAGLRGLMTNPS-------------------GRIIDFPI
RPOC_ECOLI      FNSIYMMADSGARGSAAQIRQLAGMRGLMAKPD-------------------GSIIETPI
RPOC_BUCCC      FNNIFIMADSGARGSAAQIRQLAGMRGLMAKPD-------------------GSIIETPI
RPOC_PSEHT      FNSVFMMADSGARGSAAQIRQLAGMRGLMARPD-------------------GSIIETPI
RPOC_ALCBS      FNSIFMMADSGARGSAAQIRQLAGMRGLMAKPD-------------------GSIIETPI
RPOC_METCA      FNSIFMMADSGARGSAAQIRQLAGMRGLMAKPD-------------------GSIIETPI
RPOC_XYLFT      MNSLYIMADSGARGSPQQIRQLAAMRGLMVRPD-------------------GSIIETPI
RPOC_COXBU      FNSIYMMSDSGARGSAAQTRQLAGMRGLMARPD-------------------GTIIETPI
RPOC_PSYCK      FNSIFIMSDSGARGSAAQIRQLAGMRGLMAKPD-------------------GSIIETPI
RPOC_HYDCU      FNSVYMMADSGARGSVAQMRQLGGMRGLMAKPD-------------------GSIIETPI
RPOC_BURM1      FNSIYMMADSGARGSAVQIRQLAGMRGLMAKPD-------------------GSIIETPI
RPOC_NITMU      FNSIYMMADSGARGSAAQIRQLAGMRGLMAKPD-------------------GSIIETPI
RPOC_FRATT      FNSVYMMAKSGARGSYNQMRQLAGMRGLMAKPD-------------------GTMIETAI
RPOC_SYNAS      FNPIYMMADSGARGSNAQIRQLAGMRGLMAKPS-------------------GEIIETPI
RPOC_PELCD      FNSIHMMADSGARGSAQQIRQLAGMRGLMAKPS-------------------GEIIETPI
RPOC_DESPS      FNSIFVMADSGARGSRDQIRQLAGMRGLMAKPS-------------------GAIIETPI
RPOC_BDEBA      FNPIYIMADSGARGSAAQIRQLGGMRGLMAKPS-------------------GEIIETPI
RPOC_LAWIP      FNPIFMMSNSGARGNQDQMRQLAGMRGLMAKPS-------------------GEIIETPI
RPOC_CAUVC      INAIYMMAHSGARGSQAQMKQLGGMRGLMAKPS-------------------GEIIETPI
RPOC_RHOPB      INSIFMMSNSGARGSQDQMRQLAGMRGLMAKPS-------------------GEIIETPI
RPOC_RHOS4      PNSVYMMSHSGARGSPAQMKQLGGMRGLMAKPN-------------------GEIIETPI
RPOC_ZYMMO      VNAIYMMAHSGARGSAAQIKQLAGMRGLMAKPS-------------------GEIIETPI
RPOC_GLUOX      TNSVWMMSHSGARGSPAQMKQLAGMRGLMVKPS-------------------GEIIEQPI
RPOC_RICBR      INSIYMMAISGARGSFQQIKQLGGMRGLMTKSN-------------------GQIIPTPI
RPOC_ORITB      LNSIFMMADSEARSSVTQIKQLIGSKGLIAKAS-------------------GEIIDRPI
RPOC_NEOSM      MNSIFMMAQSGARGSAAQIKQLAGMRGLMAKPS-------------------GEIIPNPI
RPOC_EHRRW      LNSIYMMAHSGARGSASQMKQLAGMRGLMAKPS-------------------GEIIETPI
RPOC_SULDN      FNSIHMMADSGARGSAAQIRQLAGMRGLMAKPS-------------------GEIIETPI
RPOC_SULNB      FNSVHMMADSGARGSAAQIRQLSGMRGLMAKSD-------------------GSIIETPI
RPOC_GRAFK      FNSVYMMLDSGARGSKEQIRQLTGMRGLMAKPKKSN------------SGG-GEIIENPI
RPOC_PORGI      FNSVFMMMDSGARGSKEQIRQLSGMRGLMAKPQKSG------------AEG-GQIIENPI
RPOC_CYTH3      FNPIYMMMHSGARGSREQIRQLGGMRGLMAKPQKNL------------QGSVGEIIENPI
RPOC_SALRD      FNPIFTMADSGARGSQEQIRQLGGMRGLMAKPQKNIGE----------GGGGGEILENPI
RPOC_CHLTE      FNPLYMMLDSGARGSREQVRQLTGMRGLIARPQKSM------------SGQPGEIIENPI
RPOC_RHOBA      INPVFLMSHSGARGGIEQIRQLAGMRGLMAKP-------------------TGEIIETPI
RPOC_PARUW      MNPLYLMMDSGARGNKSQIRQLGALRGLMAKPS-------------------GDIIESPI
RPOC_AQUAE      FNPIYMMAISGARGNRDQIRQLAGMRGLMAKHS-------------------GEFIETPI
RPOC_CARRP      TNNLFIMLDSGSRGSMLQIKQLIAFRGFFSKSN-------------------GDIIKDPI
RPOC_THEMA      FNPIYMMVNSGARGNIDQVKQLAGIRGLMIKAYDPRSREIKSKIFKGQAIHEALTFDYPV
RPOC_MYCPE      TNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQK--------SKVIKDTIEVPI
RPOC_MYCGA      ENSIVVIADSGARGNISNFTQLFGMRGLMSKSYNYDQKIK--------SQVIRDTIEVPI
RPOC_UREPA      DNPIVIMAKSGARGNTSNFTQLAGMRGLMSKSYNYDQKNN--------NGVIKDTIEIPI
RPOC_MYCPN      DNSIVVMADSGARGNISNFTQLFGMRGLMSKSFNYERNNQ--------SKIIKDTIEVPI
RPOC_MYCMO      ENSIFMMMQSGARGNISNYVQLAGMRGLMANNVKTLKADAQN------ERVVRSTVEVPV
RPOC_MYCPU      LNPIFIMMNSGARSNMANYVQLAGIRGLMTNNTKILKSDAEN------ERVVRSTVEIPV
RPOC_MYCH2      QNSLVMMMKSGARGNISNFVQLAGMRGLMANNVKALKVDAEN------ERVVRSIVEVPV
RPOC_MYCS5      DNPLFMMLSSGARGTYSNFTQLAGMRGLMNNNTKILKADAEN------DRVVRSIVEIPV
                 . :  :  * : .   :   : . :* .                          .  .:

RPOC_DEIRA      RASFREGLTVLEYFISTHGARKGGADTALRTADSGYLTRKLVDVAHEVVVRDVDCGSTDS
RPOC_THET8      RSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNY
RPOC_TREPA      RSNFKEGLNVIEFFISTNGARKGLADTALKTADAGYLTRRLVDIAQDVVVNEEDCGTING
RPOC_BORAP      ISNFKEGLSVIEFFISTNGARKGLADTALKTADAGYLTRRLVDIAQDVVVRIEDCGTING
RPOC_LEPIC      RSNFREGLSVLEFFISTHGARKGLADTALKTADAGYLTRRLVDISQDVIISEDDCGTEES
RPOC_FUSNN      KANFREGLTVLEFFMSSHGARKGLADTALRTADSGYLTRRLVDISHEVIVNEEDCHTHEG
RPOC_CALS4      RSNFREGLNVLEFFISTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREEDCGTDEG
RPOC_SYMTH      KANFREGLTVLEYFLSTHGTRKGLADTSLRTADSGYLTRRLVDVAQDVIVREDDCGTTAG
RPOC_LACSS      TSNFREGLSVMEMFMSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREEDCGTDRG
RPOC_LEUMM      TANFREGLTVMEMFISTHGARKGMSDTALKTANSGYLTRRLVDVAQDVIVREFDNDSDRG
RPOC_STRMU      LSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRG
RPOC_STRP7      LSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRG
RPOC_STAS1      TSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREEDCGTDRG
RPOC_ARTS2      KSSYREGLSVLEYFIATHGARKGLADTALRTANSGYLTRRLVDVSQDVIVREEDCGTERG
RPOC_LEIXX      ISSYREGLSVAEYFIATHGARKGLADTALRTADSGYLTRRLVDVSQDVIIREDDCGTTKG
RPOC_CORJK      KTSFREGLSVLEYFNNSHGSRKGLADTALRTADSGYLTRRLVDVAQDVIVREDDCGTKQG
RPOC_CUTAK      KSNFREGLTVLEYFISTHGGRKGQADTALRTADSGYLTRRLVDVSQDVIVRENDCGTTRG
RPOC_BIFLO      KSNYRDGLSVLEYFISQHGARKGLADTALRTAESGYLTRRLVDVSQDVIVREEDCGTKAG
RPOC_TROWT      ISSYREGLSVTEYFISTHGARKGLVDTALKTADSGYLTRRLVDVAQDVVVRERDCGFTRG
RPOC_RUBXD      KSNFMEGLTVLEYFTSTHGARKGQADTALRTADSGYLTRRLVDVAQDVVIREEDCGTDGY
RPOC_DEHMC      KSSLREGLTALEYFISTHGARKGLADTALRTSGSGYLTRRLIDVTQDVIILQEDCGTANG
RPOC_ECOLI      TANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEG
RPOC_BUCCC      TANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVITQTNCKTKKG
RPOC_PSEHT      TANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVINEDDCGTEDG
RPOC_ALCBS      TSNFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVNHIDCGTEEG
RPOC_METCA      TANFREGLTVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVITEDDCGTTDG
RPOC_XYLFT      KANFREGLSVQEYFNSTHGARKGLADTALKTANSGYLTRRLVDVTQDLCVVQLDCGTAGG
RPOC_COXBU      TANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTEHDCGTEAS
RPOC_PSYCK      KANFREGLTVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVITSDDCGTEQG
RPOC_HYDCU      TANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDVVVTEPDCGTDAS
RPOC_BURM1      TANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVTQDLVVVEDDCGTSNG
RPOC_NITMU      TANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVTQDLVVTQEDCGTSNG
RPOC_FRATT      TANFREGLSVLQYFTSTHGARKGLADTALKTANAGYLTRRLVDVAQDLVVIEEDCGTDDG
RPOC_SYNAS      TANFREGLTVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDCIITQQDCGTVDG
RPOC_PELCD      TANFREGLTVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDAIITEQDCDSLDG
RPOC_DESPS      KANFREGLDVLEYFISTHGARKGLADTALKTANSGYLTRRLVDVAQEATIVEADCQTLDG
RPOC_BDEBA      TANFREGLTVIQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDVVVSEIDCGVEDG
RPOC_LAWIP      TSNFREGLTVLQYFTSTHGARKGLADTALKTANSGYLTRRLVDVVQDVIVYKNDCGTVDG
RPOC_CAUVC      VSNFKEGLTVQEYFNSTHGARKGLADTALKTANSGYLTRRLVDVAQDCIIVEEDCGTTKG
RPOC_RHOPB      ISNFKEGLSVLEYFNSTHGARKGLADTALKTANSGYLTRRLVDVAQDCIITADDCGTKLG
RPOC_RHOS4      ISNFKEGLTVLEYFNSTHGARKGLADTALKTANSGYLTRRLVDVAQDCIVRTHDCGTENA
RPOC_ZYMMO      ISNFKEGLTVLEYFNSTHGARKGLADTALKTANSGYLTRRLVDVSQDCVVVEDDCGTERA
RPOC_GLUOX      IANFKEGLSVLDYFTSSHGARKGLADTALKTANSGYLTRRLVDVAQDCIIVEPDCGTERG
RPOC_RICBR      IANFKEGLTVFECFNSANGMRKGQIDTALKTASSGYLTRKLVDVAQDCIITEKDCNTDKG
RPOC_ORITB      LSNFCEGLTVFECFIGIPGTRKGLADTAVKTKVSGHLSRKLSESAHGYFVKREDCGTTNG
RPOC_NEOSM      ISNLREGQGVLEYFNSTHGARKGLADTALKTANSGYLTRRLVDVAQDSIIVEEDCGSSNG
RPOC_EHRRW      ISNFREGLNVFEYFNSTHGARKGLADTALKTANSGYLTRRLVDVAQDCIVVEYDCKTHNG
RPOC_SULDN      ISNFKEGLNVVEYFISTHGARKGLADTALKTANAGYLTRKLVDVAQNVKIVEHDCHTHEG
RPOC_SULNB      TSNFREGLNVLEYFISTHGARKGLADTALKTANAGYLTRKLIDVAQNVKVSMTDCGTHEG
RPOC_GRAFK      LSNFKEGLSILEYFISTHGARKGLADTALKTADAGYLTRRLVDVSQDVIVNEDDCGTLRG
RPOC_PORGI      LSNFKEGLSVLEYFISTHGARKGLADTALKTADAGYLTRRLVDVSHDVIITEEDCGTLRG
RPOC_CYTH3      LSNFKEGLDVIEYFISTHGARKGLADTALKTADAGYLTRRLVDVAQDAIINEQDCGTLRG
RPOC_SALRD      LSNFKEGLTVQEYFISTHGSRKGLADTALKTADAGYLTRRLVDVSQSVTVTEHDCGTLRG
RPOC_CHLTE      ISNLKEGLTVLEYFISTHGARKGLSDTSLKTADAGYLTRRLHDVAQDVIVTIDDCGTTRG
RPOC_RHOBA      KANFREGLSVLEYFSSTHGARKGLADTALKTADSGYLTRKLADVAQNVVVTMHDCGTTQG
RPOC_PARUW      TSNFREGLSVIEFSISSHGARKGLADTALKTADSGYLTRRLVDVAQDVIITEDDCGTLNG
RPOC_AQUAE      ISNFREGLSVLEYFISTYGARKGLADTALKTAFAGYLTRRLVDVAQDITITERDCGTVKG
RPOC_CARRP      FDNLKNGLNMKNYFISTFGARKGLTDTSLKTANSGYLTRKLIDVSHDLVIYKIDCKTKTG
RPOC_THEMA      DKNLREGVDILQFFISTYGARKGQVDTAMNTSFAGYLTRRLVDVAQSVTVAEPDCGTHEG
RPOC_MYCPE      KNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKG
RPOC_MYCGA      KHSFIEGLTINEYFNSSYGARKGMTDIAMKTSKSGYMTRKLVDAAQEVIINDSDCNTNKG
RPOC_UREPA      KHSFIEGLSVSEYFNSSFGARKGMTDTAMKTAKSGYMTRKLVDSTQAVVIKDHDCGTKEG
RPOC_MYCPN      KHSFLEGLTINEYFNSSYGARKGMTDTAMKTAKSGYMTRKLVDATHELIINHDDCGTRKG
RPOC_MYCMO      KSSFLDGLTAYEFYSSTHGARKGLTDVALNTARSGYLTRRLVDVAQNIVVSEDDCGSDFG
RPOC_MYCPU      KSSFLDGLTAYEFYSSTHGARKGLTDTALNTAKSGYLTRRLVDVAQGIVVTEKDCATQNG
RPOC_MYCH2      KSSFLEGLTSFEFYSSTHGARKGLTDTALNTAKSGYLTRRLVDVAQNIVVVAEDCFSDFG
RPOC_MYCS5      KSSFLDGLTAYEFYSSTHGARKGLTDTALNTAKSGYLTRRLVEVAQGVVIREEDCGSDYG
                  .  :*    :      * ***  * ::.*  :*:::*:* :  :   :   :      

RPOC_DEIRA      TVMPLGATDERTGEWR---SRKGSEIETSIYGRTLTADVEFSDGRVIPEGEMLSMEDVKA
RPOC_THET8      ISVPLFQPDEVTRSLR---LRKRADIEAGLYGRVLAREVEVLGVRLE-EGRYLSMDDVHL
RPOC_TREPA      IEYRAVK---SGD-------EIIESLAERIVGKYTLERVEHPIT-HELLLDVNEYIDDER
RPOC_BORAP      IKVETVK---NGE-------EILESLKEKAVGSYSIERIKNPIT-GEIVLDANEEISEAK
RPOC_LEPIC      ISLGVVK---EGE-------NVIVSLNDRVFGRYTAEDVIDPVT-DQVVYPRNTLITREV
RPOC_FUSNN      IEVEALV---GANG------KIIEKLSERINGRVLAEDLVHK---GKKIAKRNTMIHKDL
RPOC_CALS4      I-YVEEIREGNEI---------IEKLSDRIIGRIAAEDIVDSE--GNVIVRRNEMINEEE
RPOC_SYMTH      ITWTEEVDQFGNV---------IEPITPHIVGRVALNDIVHPET-GEIIVYANEMIDEDL
RPOC_LACSS      L-LIHSLREGNEM---------IEPLYDRLVGRCPMKTIVNPTT-GEVMVAKNQLMDEQL
RPOC_LEUMM      V-AVQAIMDGTSV---------VEPLYDRILGRYAMKSVFDPET-DEKIVSRNEMIDEDV
RPOC_STRMU      L-TITAITDGKEV---------TETLEERLVGRYTKKSVRHPET-GEIIASPDTLITEDM
RPOC_STRP7      L-LIRSIAEGKEM---------IESLEERLNGRYTKKTVKHPET-GAVIIGPNELITEDK
RPOC_STAS1      L-LVSDIKEGTEM---------IEPFIERIEGRYSKETIRHPET-NEVIVNPDELVTAEI
RPOC_ARTS2      LVTPIAVADANGE------LVLDENVENSAYARTLAVDVVDSKG--KVLAAGGTDCGDVV
RPOC_LEIXX      LDLPIATVDAEGV------LTRDPNVENSVFARTLAADAVGTDG--TVVAKAGEDVGDVL
RPOC_CORJK      AVVPVAVPVLDAEGKPTGNYTAADFVETSVLGRYLASDATASDG--TVIVAEGDVVGEGE
RPOC_CUTAK      MPKTIAVDDGNGN------LVRVEGLDTAVYARCLAADAVDANG--NVVVEANSDLGDEE
RPOC_BIFLO      LPIRVAERDNDGN------LVLVKAADGGPYSRLLAADVIDPADGQTVLYKRDDALSMDV
RPOC_TROWT      VRMPVTFRGDDGE------LHKVENAEHSVYGRTLAEDVKTPDD--NLIAKAGEDISGIM
RPOC_RUBXD      IELPLYLEDGQGD------------PNDSVAARYLARDLVNPETG-EVVAEAGTDITRPL
RPOC_DEHMC      TWIIEPKEKGMLP-----------PLVDRILGRWTAHNVVHPQT-GEIIVDNNEEIDEIK
RPOC_ECOLI      IMMTPVIEGGDVK----------EPLRDRVLGRVTAEDVLKPGTAD-ILVPRNTLLHEQW
RPOC_BUCCC      ILMNSLIEGGDIK----------ETLKERVLGRITVENIYHLNSKN-IIIPKNTLLNEKW
RPOC_PSEHT      LTMKPLIEGGDVV----------EALRERVLGRVVAEDIVIPGTNT-VLVERNIMLDEKL
RPOC_ALCBS      LLMTPLIEGGDVV----------EPLRERVLGRVVARDVMNPLNQDEVAVEAGTLLDEVW
RPOC_METCA      LQMAPLIEGGDVV----------EPLAERVLGRVLAEHAVDPASGDV-LLEAGSMLDERA
RPOC_XYLFT      LTMTPIVEGGDVV----------EPLKDRVLGRVVAEDVLLPGNDDEPIVTRSTLLDEQW
RPOC_COXBU      IEMMPHIEGGDVV----------EPLRERVLGRILAEPVMDPKSRKE-LLAKDTFLDERR
RPOC_PSYCK      LLMKPHIQGGEII----------EKLGELVLGRVTARDVTYNDNAEKILIPAGTLIDEHW
RPOC_HYDCU      ITMAPHVEGGEVV----------EELKERILGRVVAEDVA--GLDGEIIVEKGTLLDERL
RPOC_BURM1      VAMKALVEGGEVV----------EALRDRILGRVAVADVVNPETQE-TLYEAGTLLDETA
RPOC_NITMU      VVMKALVEGGEVI----------EALRERILGRVVANDIINPEHQA-VIYPAGMLLDENA
RPOC_FRATT      LMFSAIVEDGEVK----------VPLVERALGRTLAADVV--TEKGVVLLEAGTLLDENL
RPOC_SYNAS      ISVSALMEGGEII----------ETAGERVLGRVVLEDIMDPFTGE-VLVGANQEIDESL
RPOC_PELCD      IVMTALTEGGEVI----------ERLGDRILGRTALEDVLDPVTGE-VLVEANQQIDETL
RPOC_DESPS      IVAEPLLDGGEVL----------VPLGDRILGRVALEDVVDPFTGE-VLVVAGEQMEEDK
RPOC_BDEBA      LEITPIYEAGEIV----------QNIGDRILGRTALKDVVDAATNE-VVVRANQEITEND
RPOC_LAWIP      IEVKQVQDGGEIK----------QNLSERILGRVLLYPIYHPVTNE-IIFPENTLIDEYV
RPOC_CAUVC      ITLRAVVEGGDVL----------VSLGSRVLGRFTAEDVKDPGTGE-LVVPADTYIDENI
RPOC_RHOPB      IKMRAIIDAGTVV----------ASLASRILGRTAGEDLRDPLTNK-VVVKRGTLMEESH
RPOC_RHOS4      ITASAAVNEGEVV----------SPLAERVLGRVAAEDILVPGSDE-VIVARGELIDERR
RPOC_ZYMMO      LEMKAITQGGNVI----------ASLGERILGRTLAEDIMGT-DGQ-VAIPIGTLLDEAH
RPOC_GLUOX      LTVRAVMDSGEVV----------ASLSERILGRTLSKDVIHPVTQD-VILPRNTLIEEAE
RPOC_RICBR      IEVKSIIEGGEVI----------VPLAEMILGRTAAINIYHPVTND-LILTKGELINESK
RPOC_ORITB      LIITAVVEGGVIV----------VTLAEQVLGRVAVSNVYCPITKV-LILQQGEMIDEYK
RPOC_NEOSM      LVVRATVEGGVVI----------IPLSDSIFSRVSATDIIDPSDGS-VIVRAGEMFDDKS
RPOC_EHRRW      FAMRSVIDGGTVV----------ETLDNIILGRVAAVDIYNPITKE-LLVNAGELIDEAK
RPOC_SULDN      IEISDISDQNTLI----------ESLEDRLNGRVLADDVIDPISNE-ILFAEGTLLDEVS
RPOC_SULNB      VEVSDIVVGNEMI----------EPLADRIYGRVLAEDIIDPITSE-VLVSEGTMIDEET
RPOC_GRAFK      VEVKPLKKNE-EIVES---------LGERILGRISLNDVVNP-STQEHIVATNEEITEEI
RPOC_PORGI      LLTTELKQNE-DVVAS---------LYERILGRVSVHDIIHP-TTGDIIVRAGEEIREQA
RPOC_CYTH3      LTVSALKDND-DIVEP---------LTERILGRVSVHDVFHI-ISNELLVSSGQEITEEI
RPOC_SALRD      INVGALKDNE-EVVAP---------LSDRITGRVSVRDVYDP-HTDELIVEANELITDEI
RPOC_CHLTE      LHVERNIEEETSGQIK---------FREKIKGRVAARDIVDV-INDKVVVKAGEIITDEL
RPOC_RHOBA      ITKGVVYRGE-KVEVS---------LAESINGRVSLKSIVNP-VTDEVIVEANQMITPEI
RPOC_PARUW      IDVSAIKQGQ-EELLP---------LKDRIFGRTVCEDIYQPGDSTKLLAKSGDTLTVLQ
RPOC_AQUAE      FEMEPIVEAGEER----------VPLKDRIFGRVLAEDVKDPYTGE-IIARRNEVIDEKL
RPOC_CARRP      IKIFLNSYFTLVE------------LYKNLYGRLLLFSVSLKNK---ILLKENTLIDNKV
RPOC_THEMA      IRAMDLIKEGTVV----------EKMNEFLFGRVLARDVLDPETKEVLKNPETGKEYTRN
RPOC_MYCPE      TILEVIEDTKSGS--------VIESLNERLINRFPIFDVVHPKSKK-VLAPAGEIITKAV
RPOC_MYCGA      IVVSTITNSLDGG--------VVETLSERIVTRYTIDPIYDEKTKE-LLVDADTLITSEL
RPOC_UREPA      IIVREIRNTKDNT--------SIESLKDRIVGRYSINTIYDTKNK--LIIESDKLITSEI
RPOC_MYCPN      IVVEAIVETKTRS--------LVESLFDRIVNRYTIGPILDPETKA-EIVPANSLITQEL
RPOC_MYCMO      LKVKDITDTRTAT--------IIVPLIERIEGRYLNSALYSNEGQ--LLANKNTLVTEEF
RPOC_MYCPU      FVVKDIVDNKTKT--------VIVPIRERIEGRFTIEDVKDKDGN--VIVEKDTLIDAKM
RPOC_MYCH2      FVVKDIIDTKTNT--------IIVPLLERIEGRFLNKDVYDSRGI--KLASAGSMVDLQT
RPOC_MYCS5      FVVKDIKDTKTNT--------IIESLQERIEGRFTAVPIYDQNGK--LIVKESELITPEI
                                                                            

RPOC_DEIRA      I--AKDAK-HIGEVFVRTPLNCRVKAGVCQKCYGYDLSQAKPVSMGEAVGVVAAESIGEP
RPOC_THET8      LIKAAEAG-EIQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGIVAAQSIGEP
RPOC_TREPA      AEKVEEA--GVESVKLRTVLTCESKRGVCVCCYGRNLARNKIVEIGEAVGIVAAQSIGQP
RPOC_BORAP      IELLEKI--GIEKLVIRSVLTCEAEHGVCQKCYGRDFSKNKPVNIGEAVGIIAAQSIGQP
RPOC_LEPIC      GQKVENL--GYDKIRVRSPLTCESKQGVCIRCYGMDMARLIPAEIGEAVGTIAAQSIGQP
RPOC_FUSNN      LDKIEEL--GIKKVKIRSPLTCALEKGVCQKCYGMDLSNYNEILLGEAVGVVAAQSIGEP
RPOC_CALS4      AEKIDKA--GITRVKIRSPLTCRSRHGVCRMCYGRDLATGELVNIGEAVGIIAAQAIGEP
RPOC_SYMTH      AEQILAA--GIKEVTIRSVLTCRTRYGVCRACYGRNLATGRLVDVGEAVGIIAAQSIGEP
RPOC_LACSS      AQAVVDA--GVEEVTIRSVFTCNTKHGVCKKCYGRNMANGEEVEVGEAVGTVAAQSIGEP
RPOC_LEUMM      AKKIVNA--GIKEVTIRSVFTSTTEHGVSVLDYGRNLASGEEVEVGEAVGTVAAQSIGEP
RPOC_STRMU      AHYIAEA--GVSEVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEP
RPOC_STRP7      AREIVNA--GVEEVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEP
RPOC_STAS1      AKKITDA--GIEEMYIRSAFTCNTRHGVCEKCYGKNLATGEKVEVGEAVGTIAAQSIGEP
RPOC_ARTS2      IAELFAA--GITEVKVRSVLTCESSVGTCALCYGRSLATGKTVDIGEAVGIIAAQSIGEP
RPOC_LEIXX      IDKLVAA--GVVDIKVRSVLTCESAVGVCAACYGRSLATGKLVDIGEAVGIIAAQSIGEP
RPOC_CORJK      LQALLEA--GVEEVKVRSVMTCATNTGVCSTCYGRSMATGKKVEIGEAVGIVAAQSIGEP
RPOC_CUTAK      ISRLIAA--GISQIKVRSVLTCTAAQGCCARCYGRSLSTGHLVDVGEAVGIIAAQSIGEP
RPOC_BIFLO      LNDLVAH--GVEEVKCRSVLTCESKRGVCAKCYGWSLATNKLVDVGETVGIVAAQSIGEP
RPOC_TROWT      IDSFIAA--GVESVEVRSVLTCRSKVGVCSACYGRSLATGARVDIGDAVGIVAAQSIGEP
RPOC_RUBXD      FEAWLEELPRETKVPVRTPTKCENPHGVCQKCYGRSLATNRPVDVGEAVGIIAAQSIGEP
RPOC_DEHMC      AKAIGEA--GITEVFVRSPLTCESTHGMCRRCYGRDLGRVRLVDMNTAVGIIAAQSIGEP
RPOC_ECOLI      CDLLEEN--SVDAVKVRSVVSCDTDFGVCAHCYGRDLARGHIINKGEAIGVIAAQSIGEP
RPOC_BUCCC      CNILEKN--FIDSIIVRSVVHCETSFGVCAYCYGRDLARGKIVKKGEAVGVIAAQSIGEP
RPOC_PSEHT      CDLLEEH--SVDEVRVRSVITCDNDFGVCANCYGRDLARGHIINAGESVGVIAAQSIGEP
RPOC_ALCBS      VAQLETM--GVDEVLVRSPITCATRWGVCATCYGRDLARGHQVNVGEAVGVIAAQSIGEP
RPOC_METCA      VQLLEQH--GVDNVRVRSVITCKTRYGVCASCYGRDLGRGHKVNIGEAIGVIAAQSIGEP
RPOC_XYLFT      VAKLEEA--GVQSVKVRSPITCESPFGVCALCYGRDLARGHLVNMGEAVGVIAAQSIGEP
RPOC_COXBU      VDILEEH--SIDRVRVRSAITCEARYGICSMCYGRDLARGHVVNVGEAIGVVAAQSIGEP
RPOC_PSYCK      VKVLDNN--AIDDIWVRSVITCNIEHGVCSQCYGRDLARGHKVNIGESVGVMAAQSIGEP
RPOC_HYDCU      VNLIDES--GVDAVKVHSPITCETKFGICQKCYGRDLARGHMVNLGEAVGVMAAQSIGEP
RPOC_BURM1      VEEIERL--GIDEVRVRTPLTCETRYGLCASCYGRDLGRGTLVNVGEAVGVIAAQSIGEP
RPOC_NITMU      VDTIEML--GIDEVKVRTPLTCETRYGLCAKCYGRDLGRGTPVNVGEAVGVIAAQSIGEP
RPOC_FRATT      VELLDDN--GIDMIKVRSPITCKTRRGLCAKCYGRDLARERQVNVGESVGVIAAQSIGEP
RPOC_SYNAS      SEKIDRA--GIESVRIRSVLTCKAKYGVCARCYGRDLGHGHLVNIGEAVGIIAAQSIGEP
RPOC_PELCD      VEKIENA--GIEKVKIRSVLTCQSQRGICATCYGRDLARGHLVNLGEAVGVIAAQSIGEP
RPOC_DESPS      VAILEEA--GIDRVMIRSVLTCRSKRGVCAACYGRDLGRGHLINQGEAVGVIAAQSIGEP
RPOC_BDEBA      VKIIEGR--GIDKVDIRSALICQSKRGVCVKCYGRDLSRGATVNLGETVGIIAAQSIGEP
RPOC_LAWIP      VKKLEEI--GIASVTIRSALTCQSERGVCALCYGRDLARGHLVNIGETVGIIAAQSIGEP
RPOC_CAUVC      ADAIEAA--VVQSVKVRSVLTCEAKIGVCGACYGRDLARGTPVNIGEAVGVIAAQSIGEP
RPOC_RHOPB      VDALQQA--GIQEVKIRSALTCELVNGICGKCYGRDLARGTPVNHGEAVGVIAAQSIGEP
RPOC_RHOS4      ADLVDQA--NVASVRIRSPLTCEAEEGVCAMCYGRDLARGTLVNIGEAVGIIAAQSIGEP
RPOC_ZYMMO      IAVIEKI--GIQSVKIRSPLVCESHGGVCAACYGRDLARGTPVNIGEAVGVIAAQSIGEP
RPOC_GLUOX      AELIEKA--GVESVDIRSVLTCDSRVGICAHCYGRDLARGTPVNIGEAVGVIAAQSIGEP
RPOC_RICBR      LEQIESA--GLDRIMIKSVLTCESSTGICAICYGRDLATGSLVSEGEAIGVIAAQSIGEP
RPOC_ORITB      VELINTA--GINSIKVRSVLTCELQEGVCAKCYGRDLSTGKLVAIGTAVGIVAAQSIGEP
RPOC_NEOSM      IERIESL--GIDSVRIRSVLTCKSKHGICRKCYGADLSNRKLVALGEAVGVIAAQSVGEP
RPOC_EHRRW      VEKIRIA--GLDAVKVRSPLTCEAKKGICALCYGRDLAIGDVVSIGEAVGVIAAQSVGEP
RPOC_SULDN      AKVIAEA--GIKTAYIRTPTTCKSENGICALCYGVNLATGQIVRRGEAVGIIAAQSIGEP
RPOC_SULNB      ATRVQEA--GVRSVVMRAPSSCKAPKGICAKCYGLNMADNKMVKRGEAVGVIAAQSIGEP
RPOC_GRAFK      VAKIEAA--PIESVEVRSPLTCEAKKGICIKCYGRNLATNKIVQTGEAVGVVAAQSIGEP
RPOC_PORGI      AQIIEDS--PIEAVEIRSVLTCESKKGVCAKCYGRNLATNRMVQRGEVVGVIAAQSIGEP
RPOC_CYTH3      ARSIDDS--GIESVEIRSVLTCESRRGCCAKCYGRNLSSGQMVGIGESVGVIAAQSIGEP
RPOC_SALRD      ADDIAQT--SIEEIEIRSVLTCEAERGVCTLCYGQNLATGRMVEVGESVGVVAAQSIGEP
RPOC_CHLTE      AAAIQDNI-GVEEAEIRSVLTCESKVGICAKCYGTNLSVHKLVEIGEAVGVIAAQSIGEP
RPOC_RHOBA      ARNIEAM--GLEKIQVRTPMSCDAPLGVCRCCYGMDMSTGSMVEEGMAVGIIAAQSIGEP
RPOC_PARUW      AEAIDDS--GIESIRIRSVLTCETRRGVCAKCYGINLANSRSISMGEAVGIIAAQSIGEP
RPOC_AQUAE      AEKITKA--GIEKVRVRSPLTCEAKHGVCAMCYGWDLSQRKIVSVGEAVGIIAAQSIGEP
RPOC_CARRP      LFLLIKK--KINTIFVRSVLFCISNRGVCCFCYGIDLSTNKIVLIGVSVGIISAQSIGEP
RPOC_THEMA      TMLTDDDANFLASYKKMVDVVRYEEIDITELSLPNMYAEIAEPVGEYEEGTELTWDVIKA
RPOC_MYCPE      ANEIVDA--GIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEP
RPOC_MYCGA      AEKIAKA--NVTKALIRSPIYCQSTKGLCQKCFGNDLTTNDLVQIGTAIGVIAAQSIGEP
RPOC_UREPA      ANIIQNS--GIREVEVRSPLHCASLYGVCQKCFGLDLSTNKLIETGTAIGVIAAQSIGEP
RPOC_MYCPN      AKQICAT--SIKQVLVRSVIYCERENGVCQYCFGVDLSTGKLVELGTAVGVIAAQSIGEP
RPOC_MYCMO      ADQIVNKY-NIKEVEIRSILGCHTRNGVCKLCYGKDLASNAPVNIGEAVGIIAAQSIGEP
RPOC_MYCPU      AEEIVEVH-DVKEVNIRSILGCEAKNGVCQKCFGKDLATSRIVSIGEAVGITASQSIGEP
RPOC_MYCH2      AKKIVAA--GIKKVEIRSILSCHIKNSVCKKCYGKDLATNRLVSIGEAVGIIAAQSIGEP
RPOC_MYCS5      ASEIVAK--GITKVEIRSVLSCHTRNGLCKKCYGKDLATNRIVNIGEAVGVIAAQSIGEP
                                          .                      *   :  : :.

RPOC_DEIRA      GTQLTMRTFHTGGIAGGG------------------------------------------
RPOC_THET8      GTQLTMRTFHTGGVAGAA------------------------------------------
RPOC_TREPA      GTQLTMRTFHVGGTASSTTEENRITFKYPILVKSIEGVHVKMEDGSQL-------FTRRG
RPOC_BORAP      GTQLTMRTFHIGGVAQAGSEDDKISLKNTFILNGIEGFNVRVENG-IL-------FTRKG
RPOC_LEPIC      GTQLTMRTFHIGGAASAKVQEKEHKVSYTGIVNNINGRLITNEKSQSV-------FSRRG
RPOC_FUSNN      GTQLTMRTFHTGGVAGAATVVN--------------------------------------
RPOC_CALS4      GTQLTMRTFHTGGVAG--------------------------------------------
RPOC_SYMTH      GTQLTMRTFHTGGVAG--------------------------------------------
RPOC_LACSS      GTQLTMRNFHTGGVAGG-------------------------------------------
RPOC_LEUMM      GTQLTMRNFHTGGVAGG-------------------------------------------
RPOC_STRMU      GTQLTMRTFHTGGVASN-------------------------------------------
RPOC_STRP7      GTQLTMRTFHTGGVASN-------------------------------------------
RPOC_STAS1      GTQLTMRTFHTGGVAG--------------------------------------------
RPOC_ARTS2      GTQLTMRTFHTGGAVSAS------------------------------------------
RPOC_LEIXX      GTQLTMRTFHTGGSASA-------------------------------------------
RPOC_CORJK      GTQLTMRTFHLGGVGGD-------------------------------------------
RPOC_CUTAK      GTQLTMRTFHTGGVAGD-------------------------------------------
RPOC_BIFLO      GTQLTLRSFHSGGVAAA-------------------------------------------
RPOC_TROWT      GTQLTMRTFHSGGSASA-------------------------------------------
RPOC_RUBXD      GTQLTMRTFHTGGVSGV-------------------------------------------
RPOC_DEHMC      GTQLTLRTFHTGGVVGV-------------------------------------------
RPOC_ECOLI      GTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKLS-NVKSVVNSSGKL-------VITSR
RPOC_BUCCC      GTQLTMRTFHIGGAASKVASESSIQIRKNGIIHLN-QAKSVINSNGKI-------VIISR
RPOC_PSEHT      GTQLTMRTFHIGGAASRASAENNVQVKTNGTLKLH-NAKYVLNTDGKI-------AIISR
RPOC_ALCBS      GTQLTMRTFHIGGAASRASAVSSIQIKHGGKVRFH-NAKHVQHKDG-L-------VIVSR
RPOC_METCA      GTQLTMRTFHIGGAASRSAAISNVEVKSSGQIRLT-NLKTVVNRDNAL-------VAVSR
RPOC_XYLFT      GTQLTMRTFHIGGTALSAAAIDNITVKTSGSVKFT-NLKYVEHANGTL-------VAVSR
RPOC_COXBU      GTQLTMRTFHIGGAASRATAANNIGVKSTGKIKLR-NLKTVEQAQGNL-------VAVSR
RPOC_PSYCK      GTQLTMRTFHVGGAASSASVDNSISVRSAGQAHFE-NMKTVQHTDGHL-------VIVSR
RPOC_HYDCU      GTQLTMRTFHIGGTASASTAQSQVEVKHEGKVKFD-NLKTIKNTENQV-------VVTSR
RPOC_BURM1      GTQLTMRTFHIGGAASRAAVASSVEAKSNGTVRFSPSMRYVTNAKGEQ-------IVISR
RPOC_NITMU      GTQLTMRTFHIGGAASRTAVASQVESKSNGIVRYSPTMRYVTNARNEL-------IAISR
RPOC_FRATT      GTQLTMRTFHTGGAASLGITVSDIKVKTAGKIKFK-NIRTVTNKEGQE-------IVISR
RPOC_SYNAS      GTQLTMRTFHIGGTA-KFEEHSTLDSRHDGIVKYV-DLNYVVSKIGET-------VVMSR
RPOC_PELCD      GTQLTMRTFHIGGTASRRAEQTSLEARFDGFVKYL-NLNSVLDAEGFH-------VVMNR
RPOC_DESPS      GTQLTMRTFHIGGTASRSVEQAEIRTHRGGKVAFN-NLHYVENSSGVK-------IVMNR
RPOC_BDEBA      GTQLTMRTFHLGGAASRAVEQSVHTSRYDGVVKLQ-NVHAVTNRNGKL-------TVMNR
RPOC_LAWIP      GTQLTMRTFHIGGTASREIERSNFEALHSGRIVLT-RVKSVENRDGVH-------LVIGK
RPOC_CAUVC      GTQLTMRTFHIGGTAQVA-EQSFFEASNEGTVRVI-GPTVVGS-DGAL-------VIMSR
RPOC_RHOPB      GTQLTMRTFHIGGAAQIN-EQSFIESNFDGKVTIK-NKAIAKNGEGHL-------VAMVR
RPOC_RHOS4      GTQLTMRTFHIGGIAQGG-QQSFLEASQEGRIEFR-NPNLLENANGEQ-------IVMGR
RPOC_ZYMMO      GTQLTMRTFHIGGAAQLN-EQSHLEAVTDGRLQFR-DLRTIIDPQGKQ-------IALSR
RPOC_GLUOX      GTQLTMRTFHIGGAATRGAEQSMVEASRDGIVTIK-NRNVVENSQKVL-------VVMSR
RPOC_RICBR      GTQLTMRTFHIGGAATKGAEVSSVEASYDAKVKIL-SRNVVINSEERK-------IVMSR
RPOC_ORITB      GTQLTMRTFHIGGAATRGVEASSFEAIVDGRVKII-NPNFVVNSNNKS-------VIMSR
RPOC_NEOSM      GTQLTMRTFHVGGAATRRVENSSMVAFCGGKVKFT-NANLITDRDGNY-------VVLSR
RPOC_EHRRW      GTQLTMRTFHVGGTAMRGVETSNLIAMLDAKVKLV-NSNVVEDKYGNK-------IVMSR
RPOC_SULDN      GTQLTLRTFHVGGTASSTAQERQVVAEKEGFIRYY-NLKTYVSKEGRN-------IVANR
RPOC_SULNB      GTQLTLRTFHTGGTATAGKEERSVVATKEGFVRYY-NLSVYRNTEGKL-------IVANR
RPOC_GRAFK      GTQLTLRTFHVGGIAGNISEDNKLEAKFAGVAEIEDLKVVKGEAPDGG----TADIVISR
RPOC_PORGI      GTQLTLRTFHVGGIASNVATENSLLSKYDGILEFEELRAVDVTDE-------SHQVVVSR
RPOC_CYTH3      GTQLTLRTFHVGGTASNITVDANIKAKFDGVVAFDDLRVIQSTNLEGD----KVTVVMGR
RPOC_SALRD      GTQLTLRTFHTGGTATREVGESTIQAKFAGTLEFENLRTVTYEDTDG-----PKEVVLSR
RPOC_CHLTE      GTQLTLRTFHQGGAAQGGIAETETKAFYEGQVELEDVKSVEHSIITEDGIEETRQIVIQK
RPOC_RHOBA      GTQLTMRTFHIGGSVSKQVEESDIKTSRDGEVRLTRMKAVTNAEG--------RDIVLTR
RPOC_PARUW      GTQLTMRTFHLGGIASAGLT-PEIVADDNGILVYTDLRTVKTDEG--------NWVALNK
RPOC_AQUAE      GTQLTMRTFHIGGAATAQKVQSFVKAESDGKVKFY-NVKLIVNRKGEK-------INISK
RPOC_CARRP      GTQLTMRTFHTGGVASYFFYSDNLIISNSGFVKFKKCKCVINKFGEVIIVSLYGEFMIFN
RPOC_THEMA      AKNEGKYRIKVKVYPVVGTVYAEEEPLYDKKGERQ-------------------------
RPOC_MYCPE      GTQLTMRTFHTGGVSSGT------------------------------------------
RPOC_MYCGA      GTQLTMRTFHTGGTANEG------------------------------------------
RPOC_UREPA      GTQLTMRTFHTGGVAGDT------------------------------------------
RPOC_MYCPN      GTQLTMRTFHTGGVSTEN------------------------------------------
RPOC_MYCMO      GTQLTMRTFHTGGVAGVE------------------------------------------
RPOC_MYCPU      GTQLTMRTFHSGGVAGVE------------------------------------------
RPOC_MYCH2      GTQLTMRTFHTGGVANVE------------------------------------------
RPOC_MYCS5      GTQLTMRTFHTGGVAGGE------------------------------------------
                ..:     ::                                                  

RPOC_DEIRA      ------------------------------------------------------------
RPOC_THET8      ------------------------------------------------------------
RPOC_TREPA      TLFFHKTLAEYQLQ----------------------------------------------
RPOC_BORAP      TLKIINVFYEEKIK----------------------------------------------
RPOC_LEPIC      SIVIQRLIQQYKTE----------------------------------------------
RPOC_FUSNN      ------------------------------------------------------------
RPOC_CALS4      ------------------------------------------------------------
RPOC_SYMTH      ------------------------------------------------------------
RPOC_LACSS      ------------------------------------------------------------
RPOC_LEUMM      ------------------------------------------------------------
RPOC_STRMU      ------------------------------------------------------------
RPOC_STRP7      ------------------------------------------------------------
RPOC_STAS1      ------------------------------------------------------------
RPOC_ARTS2      ------------------------------------------------------------
RPOC_LEIXX      ------------------------------------------------------------
RPOC_CORJK      ------------------------------------------------------------
RPOC_CUTAK      ------------------------------------------------------------
RPOC_BIFLO      ------------------------------------------------------------
RPOC_TROWT      ------------------------------------------------------------
RPOC_RUBXD      ------------------------------------------------------------
RPOC_DEHMC      ------------------------------------------------------------
RPOC_ECOLI      ------------------------------------------------------------
RPOC_BUCCC      ------------------------------------------------------------
RPOC_PSEHT      ------------------------------------------------------------
RPOC_ALCBS      ------------------------------------------------------------
RPOC_METCA      ------------------------------------------------------------
RPOC_XYLFT      ------------------------------------------------------------
RPOC_COXBU      ------------------------------------------------------------
RPOC_PSYCK      ------------------------------------------------------------
RPOC_HYDCU      ------------------------------------------------------------
RPOC_BURM1      ------------------------------------------------------------
RPOC_NITMU      ------------------------------------------------------------
RPOC_FRATT      ------------------------------------------------------------
RPOC_SYNAS      ------------------------------------------------------------
RPOC_PELCD      ------------------------------------------------------------
RPOC_DESPS      ------------------------------------------------------------
RPOC_BDEBA      ------------------------------------------------------------
RPOC_LAWIP      ------------------------------------------------------------
RPOC_CAUVC      ------------------------------------------------------------
RPOC_RHOPB      ------------------------------------------------------------
RPOC_RHOS4      ------------------------------------------------------------
RPOC_ZYMMO      ------------------------------------------------------------
RPOC_GLUOX      ------------------------------------------------------------
RPOC_RICBR      ------------------------------------------------------------
RPOC_ORITB      ------------------------------------------------------------
RPOC_NEOSM      ------------------------------------------------------------
RPOC_EHRRW      ------------------------------------------------------------
RPOC_SULDN      RNAAVLLVEPKIKAPFSGRVEIQTVHDEVIISVSSK-TDTIRYVLRKNEIAKPNELAGVG
RPOC_SULNB      RNAGVLLVEPKIKAVNKGKVSIVVTHDEIVISVENNGDDEVRYNLRKSDVAKSNELAGVA
RPOC_GRAFK      ------------------------------------------------------------
RPOC_PORGI      ------------------------------------------------------------
RPOC_CYTH3      ------------------------------------------------------------
RPOC_SALRD      ------------------------------------------------------------
RPOC_CHLTE      ------------------------------------------------------------
RPOC_RHOBA      ------------------------------------------------------------
RPOC_PARUW      ------------------------------------------------------------
RPOC_AQUAE      ------------------------------------------------------------
RPOC_CARRP      ------------------------------------------------------------
RPOC_THEMA      ------------------------------------------------------------
RPOC_MYCPE      ------------------------------------------------------------
RPOC_MYCGA      ------------------------------------------------------------
RPOC_UREPA      ------------------------------------------------------------
RPOC_MYCPN      ------------------------------------------------------------
RPOC_MYCMO      ------------------------------------------------------------
RPOC_MYCPU      ------------------------------------------------------------
RPOC_MYCH2      ------------------------------------------------------------
RPOC_MYCS5      ------------------------------------------------------------
                                                                            

RPOC_DEIRA      ------------------------------------------------------------
RPOC_THET8      ------------------------------------------------------------
RPOC_TREPA      -----------------------------------------------------EGDSVQV
RPOC_BORAP      -----------------------------------------------------NIKEIKV
RPOC_LEPIC      -----------------------------------------------------ELSNLRV
RPOC_FUSNN      --------------------------------------------------------SKKA
RPOC_CALS4      ------------------------------------------------------------
RPOC_SYMTH      ------------------------------------------------------------
RPOC_LACSS      ------------------------------------------------------------
RPOC_LEUMM      ------------------------------------------------------------
RPOC_STRMU      ------------------------------------------------------------
RPOC_STRP7      ------------------------------------------------------------
RPOC_STAS1      ------------------------------------------------------------
RPOC_ARTS2      ------------------------------------------------------------
RPOC_LEIXX      ------------------------------------------------------------
RPOC_CORJK      ------------------------------------------------------------
RPOC_CUTAK      ------------------------------------------------------------
RPOC_BIFLO      ------------------------------------------------------------
RPOC_TROWT      ------------------------------------------------------------
RPOC_RUBXD      ------------------------------------------------------------
RPOC_DEHMC      ------------------------------------------------------------
RPOC_ECOLI      ------------------------------------------------------------
RPOC_BUCCC      ------------------------------------------------------------
RPOC_PSEHT      ------------------------------------------------------------
RPOC_ALCBS      ------------------------------------------------------------
RPOC_METCA      ------------------------------------------------------------
RPOC_XYLFT      ------------------------------------------------------------
RPOC_COXBU      ------------------------------------------------------------
RPOC_PSYCK      ------------------------------------------------------------
RPOC_HYDCU      ------------------------------------------------------------
RPOC_BURM1      ------------------------------------------------------------
RPOC_NITMU      ------------------------------------------------------------
RPOC_FRATT      ------------------------------------------------------------
RPOC_SYNAS      ------------------------------------------------------------
RPOC_PELCD      ------------------------------------------------------------
RPOC_DESPS      ------------------------------------------------------------
RPOC_BDEBA      ------------------------------------------------------------
RPOC_LAWIP      ------------------------------------------------------------
RPOC_CAUVC      ------------------------------------------------------------
RPOC_RHOPB      ------------------------------------------------------------
RPOC_RHOS4      ------------------------------------------------------------
RPOC_ZYMMO      ------------------------------------------------------------
RPOC_GLUOX      ------------------------------------------------------------
RPOC_RICBR      ------------------------------------------------------------
RPOC_ORITB      ------------------------------------------------------------
RPOC_NEOSM      ------------------------------------------------------------
RPOC_EHRRW      ------------------------------------------------------------
RPOC_SULDN      GQIEGKYYFPYESGAEVQEYESIVETIKDGWNVPSRIPYASEVLVANGAPVTQKIFAKED
RPOC_SULNB      GKIEGKLFLPLKDGDMVEEGDSIVEVIKEGWSIPSRIPFASELKVEDGAPVTQEVLSEAK
RPOC_GRAFK      ------------------------------------------------------------
RPOC_PORGI      ------------------------------------------------------------
RPOC_CYTH3      ------------------------------------------------------------
RPOC_SALRD      ------------------------------------------------------------
RPOC_CHLTE      ------------------------------------------------------------
RPOC_RHOBA      ------------------------------------------------------------
RPOC_PARUW      ------------------------------------------------------------
RPOC_AQUAE      ------------------------------------------------------------
RPOC_CARRP      ------------------------------------------------------------
RPOC_THEMA      ------------------------------------------------------------
RPOC_MYCPE      ------------------------------------------------------------
RPOC_MYCGA      ------------------------------------------------------------
RPOC_UREPA      ------------------------------------------------------------
RPOC_MYCPN      ------------------------------------------------------------
RPOC_MYCMO      ------------------------------------------------------------
RPOC_MYCPU      ------------------------------------------------------------
RPOC_MYCH2      ------------------------------------------------------------
RPOC_MYCS5      ------------------------------------------------------------
                                                                            

RPOC_DEIRA      ------------------------------------------------------------
RPOC_THET8      ------------------------------------------------------------
RPOC_TREPA      RDRARVLKDEVLYHTTDGQTVYASVSGFARIIDRTVYL---------------VGPEQKT
RPOC_BORAP      SDSQRVIKGIPLFVNNKGVEILSSYIGYVKLRDDKFLI---------------VSEEQEV
RPOC_LEPIC      ENGQKVDKGELVATSPAGENITSEMPGTIHIENGLFRI---------------LGEEAVI
RPOC_FUSNN      ENDGEVSFRDIKTIEINGEDVVVSQGGKIIIADN------------------------EH
RPOC_CALS4      ------------------------------------------------------------
RPOC_SYMTH      ------------------------------------------------------------
RPOC_LACSS      ------------------------------------------------------------
RPOC_LEUMM      ------------------------------------------------------------
RPOC_STRMU      ------------------------------------------------------------
RPOC_STRP7      ------------------------------------------------------------
RPOC_STAS1      ------------------------------------------------------------
RPOC_ARTS2      ------------------------------------------------------------
RPOC_LEIXX      ------------------------------------------------------------
RPOC_CORJK      ------------------------------------------------------------
RPOC_CUTAK      ------------------------------------------------------------
RPOC_BIFLO      ------------------------------------------------------------
RPOC_TROWT      ------------------------------------------------------------
RPOC_RUBXD      ------------------------------------------------------------
RPOC_DEHMC      ------------------------------------------------------------
RPOC_ECOLI      ----------------------------NTELKLIDEF---------------GRTKESY
RPOC_BUCCC      ----------------------------NVELKMLDKT---------------GKTQESY
RPOC_PSEHT      ----------------------------STEITIIDSY---------------GREKERY
RPOC_ALCBS      ----------------------------SADLAVADEL---------------GRERERY
RPOC_METCA      ----------------------------SGEISVIDEH---------------GRERERY
RPOC_XYLFT      ----------------------------SGEISVLDTH---------------GRERERY
RPOC_COXBU      ----------------------------SGELVVQDLQ---------------GSEREHY
RPOC_PSYCK      ----------------------------SAEIALTDEL---------------GRERERY
RPOC_HYDCU      ----------------------------SGEISILDSL---------------GREKERY
RPOC_BURM1      ----------------------------SGEALITDDI---------------GRERERH
RPOC_NITMU      ----------------------------SGEVVIQDDN---------------GRERERH
RPOC_FRATT      ----------------------------AGEIIVSDTM---------------GRVREQH
RPOC_SYNAS      ----------------------------HGEIHVLDEQ---------------LRSRGKY
RPOC_PELCD      ----------------------------NAEIAVVDET---------------GRERERY
RPOC_DESPS      ----------------------------NAEIFVKDEF---------------GRDREKF
RPOC_BDEBA      ----------------------------NGSALVIDEA---------------GRERENF
RPOC_LAWIP      ----------------------------SGQLSIVDEQ---------------GRERERY
RPOC_CAUVC      ----------------------------NTSVSVL-VD---------------GKERETY
RPOC_RHOPB      ----------------------------NMVVAVTDAD---------------GTERATH
RPOC_RHOS4      ----------------------------NMQLAIIDEA---------------GQERATH
RPOC_ZYMMO      ----------------------------TGEVVLVGTD---------------GRELASS
RPOC_GLUOX      ----------------------------NCEILLTDEN---------------GVERARY
RPOC_RICBR      ----------------------------NCELLLLDNN---------------GNEKAHS
RPOC_ORITB      ----------------------------SCEVILADNV---------------GQEITRY
RPOC_NEOSM      ----------------------------SFEILLVDSL---------------GIEHFQG
RPOC_EHRRW      ----------------------------SCDVVLLDSV---------------GNEKMRH
RPOC_SULDN      GVVKYFLLRGDYLERFEGLKAGYEVIEKGLFATVVDSN---------------NREAVRH
RPOC_SULNB      GTVKFFLLKGDYLEAHDGVKSGDKVEEKGLFAVVVDDN---------------NREAGRH
RPOC_GRAFK      ----------------------------TAELKIKDKK--------------TGVVLSNN
RPOC_PORGI      ----------------------------MTELRIADPN--------------TGIILANH
RPOC_CYTH3      ----------------------------SGEIRIVEPV--------------SGKTLLSN
RPOC_SALRD      ----------------------------QGEVRIMDTDG-------------DRRELTSY
RPOC_CHLTE      ----------------------------NGKLNIIDPD--------------SGKVLKRY
RPOC_RHOBA      ----------------------------NGQIMLVDDR---------------GREVESY
RPOC_PARUW      ----------------------------NGRLNIVKDEGRTLDEYKKLLSTKSIEPLQAF
RPOC_AQUAE      ----------------------------DAAIGIVDEE---------------GRLLERH
RPOC_CARRP      -----------------------------------------------------KIILEKY
RPOC_THEMA      ------------------------------------------------------------
RPOC_MYCPE      ------------------------------------------------------------
RPOC_MYCGA      ------------------------------------------------------------
RPOC_UREPA      ------------------------------------------------------------
RPOC_MYCPN      ------------------------------------------------------------
RPOC_MYCMO      ------------------------------------------------------------
RPOC_MYCPU      ------------------------------------------------------------
RPOC_MYCH2      ------------------------------------------------------------
RPOC_MYCS5      ------------------------------------------------------------
                                                                            

RPOC_DEIRA      ------------------------------------------------------------
RPOC_THET8      ------------------------------------------------------------
RPOC_TREPA      EIRNGSNVVIKADEYVPPGK-----------TVATFDPFTEPILAEQDGFVRYEDIILGS
RPOC_BORAP      SLKAGTKLEIEVGEYVESGK-----------VIGTFDPFAEPIIAEVKGKIKFKDIILGT
RPOC_LEPIC      PVKTGTIVNVKVNDITQPNQ-----------PLAEFDPYNEVGISEIDGTVQWMDLEIGK
RPOC_FUSNN      EVDSGSVIRVTEGQKVKEGD-----------VLVTFDPYHIPIISSHDGKVQYRHFTPKN
RPOC_CALS4      ------------------------------------------------------------
RPOC_SYMTH      ------------------------------------------------------------
RPOC_LACSS      ------------------------------------------------------------
RPOC_LEUMM      ------------------------------------------------------------
RPOC_STRMU      ------------------------------------------------------------
RPOC_STRP7      ------------------------------------------------------------
RPOC_STAS1      ------------------------------------------------------------
RPOC_ARTS2      ------------------------------------------------------------
RPOC_LEIXX      ------------------------------------------------------------
RPOC_CORJK      ------------------------------------------------------------
RPOC_CUTAK      ------------------------------------------------------------
RPOC_BIFLO      ------------------------------------------------------------
RPOC_TROWT      ------------------------------------------------------------
RPOC_RUBXD      ------------------------------------------------------------
RPOC_DEHMC      ------------------------------------------------------------
RPOC_ECOLI      KVPYGAVLAKGDGEQVAGGE-----------TVANWDPHTMPVITEVSGFVRFTDMIDGQ
RPOC_BUCCC      KIPYGSILTKGEGQKVKAGE-----------IIAKWDPHTIPVITEVNGYIKFIDMVDGK
RPOC_PSEHT      KVPYGAVLTVQDNAEVQGND-----------IVATWDPHSHPIVLEHKSKVSFSDIDDSN
RPOC_ALCBS      KLPYGATVTVNEGDEVSGGQ-----------VVATWDPHTHPIIAEVEGKVQFGDMEEGI
RPOC_METCA      KIPYGAVLSVREGGAVKAGQ-----------IVVNWDPHTHPVISEVRGRAKLIDFVEGV
RPOC_XYLFT      KLPYGATINVKDMAEVKSGQ-----------ILANWDPHNHPIVSEVAGFVRFIDFVDGV
RPOC_COXBU      KVPYGATISVRDGDSVKAGQ-----------IVAQWDPHTHPIITEVAGTLRFVDLVDGV
RPOC_PSYCK      KVPYGSSVLVKNEDQVEGGQ-----------TIAKWDPHTHPIITEFAGTARFSEITDGL
RPOC_HYDCU      KIPYGSMLNVKDGIDVTSGN-----------VLATWDAHTHPIITEAEGIIQFGNFDG--
RPOC_BURM1      KIPYGATLLQLDGAAIKAGT-----------QLATWDPMTRPIITEYGGTVKFENVEEGV
RPOC_NITMU      KAPYGATLLIRDGEVVKAGQ-----------VLAAWDPHTRPIITEYSGKVRFENVEEGV
RPOC_FRATT      KIPMGAVVPLASGKAVEIGD-----------VIATWDPHAQPLITDVAGKVVLEDVIDGI
RPOC_SYNAS      TVPYGAHLKVKDGQSVKRGD-----------RMAEWDPFSIPILAEVDGTVKFGDIIEGK
RPOC_PELCD      GVVYGARLRINPDAPVQAGS-----------LLAEWDPYTMPILTEIAGTVRFGDILEGV
RPOC_DESPS      KVNYGAQVLVKEGEDIERDT-----------VLADWDAYTIPIVAEVGGIIRYGDIFNGI
RPOC_BDEBA      KLVYGAVLNFKEGDKVAKGQ-----------TVAEWDPYSNPIIAEVSAKIQYQDIEEGS
RPOC_LAWIP      SLPNGARLYVKEGQEVTKGT-----------FLAEWDPFNEPFVSEVNGFIKFTDLIDGK
RPOC_CAUVC      KPPYGARLRVKDGDLVKRGQ-----------RLGDWDPYTTPIITEVAGKIRAEDLVDGL
RPOC_RHOPB      RIQYGARMRVDEGDMVKRGQ-----------RIAEWDPYTRPVLTEVEGIIGFEDLVEGQ
RPOC_RHOS4      KLTYGAKVHVKDGQTVKRAT-----------RLFEWDPYTLPIIAEKAGVARFVDLVSGI
RPOC_ZYMMO      RILLGAHLLHNDGDMVKKGD-----------RLAEWDPFTIPVITESAGIVKYQDLVENQ
RPOC_GLUOX      RVPYGARLMVSEGEAVTRTQ-----------KMAEWDPYTLPIITEQAGTVEYLDLIDSI
RPOC_RICBR      KIPYGARLLVDEGDMVTKTQ-----------KLAEWDPYTIPIITEKSGKVLFKDMVEGI
RPOC_ORITB      KAQYGSILLVTDGQEVTKGT-----------SLVAWDPYAMPIVTEKSGYVMFKDMIDGV
RPOC_NEOSM      RVQYGGTVYVKEGEVVPIGK-----------KLADWDLYTVPIVAEASGTVSYADMIEGV
RPOC_EHRRW      SVPYGARLYVNDGQLVKITE-----------KIADWDPYTMPIITEKTGIIKYMDLIDGV
RPOC_SULDN      YIARGSIIVAEDDAVVDPKTLIAKPKNDESTVIAEWDPYSNPIISETSGTVKFEDIIIGT
RPOC_SULNB      YISRGSVVHVDNNAKVERGATLSAPEKTTQVVIAEWDPYSEPIIAEQKGTLKFEDIIPGV
RPOC_GRAFK      NIPYGSQININDGATVKEGE-----------VICTWDPYNGVIISEFAGKIKYENVEQGV
RPOC_PORGI      NIPYGAKLFFRQGDAVKKGD-----------KIIEWDPFNAVIVSEVAGTLSFEGVVENV
RPOC_CYTH3      HVPYGAFLNVKDGETVKKGQ-----------ELCFWDPYNAVILSEFEGTIQFDSIEEGV
RPOC_SALRD      VVPYGAELLVDEGEDVEDGD-----------VLASWDPYNSLILTEANGTVRFEDIIEDT
RPOC_CHLTE      VVPHGAHLNVEHGQMVRKEQ-----------VLFSSEPNSTQIIAEMPGFAKFIDIEKGV
RPOC_RHOBA      DIPTGAMLMVKEGDKVTAGQ-----------VLCEWNPYSIPILSEVTGKIRFEDVVEGE
RPOC_PARUW      NVELGTKILLEEGTKVKPGT-----------RVAEWEQHNIPIICDRPGYVRYEDLVEGL
RPOC_AQUAE      TIPYGARILVEEGQEVKAET-----------KLADWDPFNTYIIAEVGGKVELRDIILDV
RPOC_CARRP      KFYYGTKIKFRNGFLIKKNT-----------KLINFNDNNFYIYSENIGYVYFKKENNIV
RPOC_THEMA      LLVYQEVINEIVAKMLEENG---------IEKVSVRPDIIVRSPLTCESEYGVCAACYGM
RPOC_MYCPE      ------------------------------------------------------------
RPOC_MYCGA      ------------------------------------------------------------
RPOC_UREPA      ------------------------------------------------------------
RPOC_MYCPN      ------------------------------------------------------------
RPOC_MYCMO      ------------------------------------------------------------
RPOC_MYCPU      ------------------------------------------------------------
RPOC_MYCH2      ------------------------------------------------------------
RPOC_MYCS5      ------------------------------------------------------------
                                                                            

RPOC_DEIRA      ------------------------------------------------------------
RPOC_THET8      ------------------------------------------------------------
RPOC_TREPA      TLIEEVNTETGMVERRITTLKTG------------------------------IQLQPRV
RPOC_BORAP      TLKEEINTETGNVEKRITD-NVF------------------------------ESLDPRI
RPOC_LEPIC      NVRRDEDLRTSNILLKVIE-QRR------------------------------EKLNPRI
RPOC_FUSNN      IRDEKYDVHEYLVVRSVDS----------------------------------VDSEPRV
RPOC_CALS4      ------------------------------------------------------------
RPOC_SYMTH      ------------------------------------------------------------
RPOC_LACSS      ------------------------------------------------------------
RPOC_LEUMM      ------------------------------------------------------------
RPOC_STRMU      ------------------------------------------------------------
RPOC_STRP7      ------------------------------------------------------------
RPOC_STAS1      ------------------------------------------------------------
RPOC_ARTS2      ------------------------------------------------------------
RPOC_LEIXX      ------------------------------------------------------------
RPOC_CORJK      ------------------------------------------------------------
RPOC_CUTAK      ------------------------------------------------------------
RPOC_BIFLO      ------------------------------------------------------------
RPOC_TROWT      ------------------------------------------------------------
RPOC_RUBXD      ------------------------------------------------------------
RPOC_DEHMC      ------------------------------------------------------------
RPOC_ECOLI      TITRQTDELTGLSSLVVLDSAER------------------TAGGKDLRPALKIVDAQGN
RPOC_BUCCC      SITKQNDELTGLSSIVVLDISER------------------NILGKDLKPALKIIGKNEE
RPOC_PSEHT      TET-QTDELTGLTRIVVKDLSKA------------------NAK----EPKLIIESEERG
RPOC_ALCBS      TVNHQTDELTGLTNIEMLSSQNR------------------PSAGKDMRPVIRVLDSKGK
RPOC_METCA      TVREQSDEMTGLSSMVVIDPKQR------------------GGAGKELRPLVKLVDEEGN
RPOC_XYLFT      TVIEKTDDLTGLSSREIADLKRR------------------GSQGKDLRPLVRIVDKKGN
RPOC_COXBU      TMNRQTDELTGLSSIVITSTKQR------------------SASGKELRPMVKLVDKNDD
RPOC_PSYCK      TATVKVDDATGMSSFEILATRDR------------------SSSAKDLRPAIILNTDEGK
RPOC_HYDCU      AVEEHVDELTGLTTHVVKSSKER------------------SSATKELRPYIQLVDDKGE
RPOC_BURM1      TVAKQIDDVTGLSTLVVIDAKRRG-----------------SQASKSVRPQVKLLDANGD
RPOC_NITMU      TVAKQIDEVTGLSTLVVIDPKRRG-----------------VVQTKGLRPVVKLLDEEGK
RPOC_FRATT      TSKHTYDDLTGQQTIEITSISQR-------------------TTSKNLKPVVKIVDEKGA
RPOC_SYNAS      TMQEQVDEVTGLSRKVIVEFKG-----------------------ADLRPRVSLKDATGK
RPOC_PELCD      SMEEQVDEVTGLSRKVVIESKG-----------------------ADKRPRITLKDSEGK
RPOC_DESPS      TMQEKVDPVTGKSSMVIVHSAGG----------------------VTLNPRISVKNDRGK
RPOC_BDEBA      TMQEQVDAVTGFATKVIMESKS-----------------------SDVKPTVFLVDGAGK
RPOC_LAWIP      TYQEKLDEATHQSSMTIIEYRT-----------------------TSFRPSISICDAEGQ
RPOC_CAUVC      SIREEVDEATGIAQRVVADWRTS-------------------ARGSDLRPAMGVLS-EDG
RPOC_RHOPB      SISETLDESTGIAKRVVIDWRSQ-------------------RGGADLRPAIVIKG-KDG
RPOC_RHOS4      SVREDTDEATGMTQKIVSDWRST-------------------PKGGDLKPEIIIMNPETG
RPOC_ZYMMO      TLTEQVDEATGISQRVVIEYRAP-------------------RGKEDLRPRLTLMN----
RPOC_GLUOX      TLVERMDEVTGLSSKVVVDYKQA-------------------AKGVDLRPRLQLKD-ASG
RPOC_RICBR      SVRDVTDEATGIPSKVIIESKQY-------------------SRGAELRPRIQLLD-AKG
RPOC_ORITB      SVKDIIDESTGIVNRVIIEPKQG-------------------RGEVVLRPRICLLD-QNK
RPOC_NEOSM      SYNEVHDESTGILNRMVVDWRQA-------------------ESSSGLRPRVEILD-ESG
RPOC_EHRRW      SINEVLDESTGISNRVVVDWKLH-------------------LQGANLRPRLVLVN-DNG
RPOC_SULDN      TATEQYDELTGKTRLMISDHVPA-----------------------EYKPTIVLASEDGE
RPOC_SULNB      TVVEQFDEVTGDTRLELNEYIPA-----------------------AYKPAITLATESGE
RPOC_GRAFK      TYQVEIDEQTGFQEKVISESRNK-----------------------------KLIPTLHI
RPOC_PORGI      TFKMESDETTGLKEKIIIESKDK-----------------------------TMAPYARI
RPOC_CYTH3      TYREESDEQTGHREKVIVDTKDK-----------------------------TKNPAIIV
RPOC_SALRD      TYREETDEQTGHKEKVIVESRER-----------------------------TLTPAVIV
RPOC_CHLTE      TYKEEVDPQTGFAQHTIINWRSKL------------------------RASETREPRVAI
RPOC_RHOBA      TMRLDR-EASGNTRMTIIDHKGD------------------------------LHPQLVI
RPOC_PARUW      STERDVNKQTGQAELIVKQHRGE------------------------------LHPQVAI
RPOC_AQUAE      TVREERDPITGKTASVISFMRPRDAMLHTPRIAVITEDGKEYIYDLPVNAILNIPPEKIS
RPOC_CARRP      KNYCLEDNKFYYKTLKNFKITII-------------------------------------
RPOC_THEMA      DLSNHKIVNVGEAVGVVAAQSIG-------------------------------------
RPOC_MYCPE      ------------------------------------------------------------
RPOC_MYCGA      ------------------------------------------------------------
RPOC_UREPA      ------------------------------------------------------------
RPOC_MYCPN      ------------------------------------------------------------
RPOC_MYCMO      ------------------------------------------------------------
RPOC_MYCPU      ------------------------------------------------------------
RPOC_MYCH2      ------------------------------------------------------------
RPOC_MYCS5      ------------------------------------------------------------
                                                                            

RPOC_DEIRA      -----------------------------------------------DITMGLPRVIELF
RPOC_THET8      -----------------------------------------------DITQGLPRVIELF
RPOC_TREPA      FISDESGNALGSYYLPEEARLMVEEGAQVKAGTVIVKLAKAIQK-TSDITGGLPRVSELF
RPOC_BORAP      FIIDSGGVEIASYVLPGDAYLQVEDGQNINIGDIIAKLSKGSEK-TQDITGGLPRVNDLF
RPOC_LEPIC      AVIS--GGSREEYSVPVDAIISVQDGDKVKAGDILFKIPTVAEK-TRDITGGLPRVDELF
RPOC_FUSNN      HILDKKNEKLATYNIPYGAYMMVRDGAKVKKGDIIAKIIKLGEG-TKDITGGLPRVQELF
RPOC_CALS4      ----------------------------------------------VDITQGLPRVEELF
RPOC_SYMTH      ----------------------------------------------DDITQGLPRVEELF
RPOC_LACSS      ----------------------------------------------EDITQGLPRIQEIF
RPOC_LEUMM      ----------------------------------------------NDITQGLPRVQEIV
RPOC_STRMU      ----------------------------------------------ADITQGLPRIQEIF
RPOC_STRP7      ----------------------------------------------TDITQGLPRVQEIF
RPOC_STAS1      ----------------------------------------------SDITQGLPRIQEIF
RPOC_ARTS2      -------------------------------------------G-GDDITQGLPRIQELF
RPOC_LEIXX      ----------------------------------------------DDITQGLPRVQELF
RPOC_CORJK      ------------------------------------------------ITGGLPRVQELF
RPOC_CUTAK      -----------------------------------------------DITQGLPRVVELF
RPOC_BIFLO      ----------------------------------------------SDITQGLPRVTELF
RPOC_TROWT      ----------------------------------------------VDITQGLPRVQELF
RPOC_RUBXD      ----------------------------------------------EDITAGLPRVVELF
RPOC_DEHMC      -----------------------------------------------DITTGLPRVEELF
RPOC_ECOLI      DVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGG-TKDITGGLPRVADLF
RPOC_BUCCC      DIFIPGTDMPAQYFLPGKSIILLEDGMKISSGDILARVPQESVG-TKDITGGLPRVADLF
RPOC_PSEHT      ---------LQETRLPSFTTIEVVDGTTVNPGDVLARIPQEGSK-TRDITGGLPRVADLF
RPOC_ALCBS      PIVMPNTDMPAQYFLPGGALCGLKDGANIGVGDVIARIPQESSK-TRDITGGLPRVADLF
RPOC_METCA      DIFIPSTEITAQYFLPAGAIIGIRDGDLVEVGDVLARIPQESSK-TRDITGGLPRVADLF
RPOC_XYLFT      DLTIPGTDLSAQYLLPPRSIVNLQDGAPVGIGDVVAKIPQEASK-TRDITGGLPRVADLF
RPOC_COXBU      DLFLPGGKVPAHYFLPEGTFLTKEDGTTVNIGDVLARIPQETSK-TRDITGGLPRVADLF
RPOC_PSYCK      E---------VVYFLPAETIIRVSDGEKVAAGSILGRVPQASSG-TKDITGGLPRVADLF
RPOC_HYDCU      VVPFPGTQTPAMYYLPENSVVVVNQSDKVGAGDILARIPQESSK-TKDITGGLPRVADLF
RPOC_BURM1      EVKIPGTEHSVQIGFQVGALITVKDGQQVQVGEVLARIPTESQK-TRDITGGLPRVAELF
RPOC_NITMU      EVRLAGSNLPVHITFQVGSIITVRDGQQVSVGEVLARIPQESSK-TRDITGGLPRVAELF
RPOC_FRATT      EL--------KSIPLAVGAVLNVADDSILEVGDIVAKIPLEGSK-NKDITGGLPRVAELF
RPOC_SYNAS      TAKVPGTNAAARHLLSVGVNIVVSEGDQVKAGDIIAKIPRETTK-TKDITGGLPRVAELF
RPOC_PELCD      TAKLP-NGAPARYMLPVGAIIVASEDETVSGGAILAKIPRETTK-TKDITGGLPRVAELF
RPOC_DESPS      TLKLPDSEGFARYSLPVGSLISVEEGAEIKAGTIVGKIPRETSK-TKDITGGLPRVAELF
RPOC_BDEBA      TLNLPGRDIPARYLIPVGAQLLVADQQEVHAGDVIAKMHREASK-TKDITGGLPRVAELF
RPOC_LAWIP      TKQRITSTTPAIYSLPAGAIIMVKDGQEVQAGDIIARKPRETSK-TRDIVGGLPRVAELF
RPOC_CAUVC      SYKRLSNGGEARYLLSAGAILSVADGDEVKPGEVIARIPTEGAK-TRDITGGLPRVAELF
RPOC_RHOPB      KILKLARGGEARYMLSVDAILSVDVGAKVKTGDILARISTESAK-TRDITGGLPRVAELF
RPOC_RHOS4      DPMRNEAGNPISYPMSVEAILSVEDGQTVRAGDVVARIPREGAR-TKDITGGLPRVAELF
RPOC_ZYMMO      ----GDSGETARYMLSPGTVISVDDGQEVLAGTVLARVSRESAK-TRDITGGLPRVAELF
RPOC_GLUOX      NVVKLANGNDARYFLSPDSILSVENGAEVNAGDVLARIPREGSK-TRDITGGLPRVAELF
RPOC_RICBR      EIIMLSNGLEARYYLPVGAVLSVEDGVQISVGDIIARIPKESTT-TKDITGGLPRVAELF
RPOC_ORITB      QPLTLSNGLEAEYFLPVNSILSVEEGANVSAGDILARIPREFAG-TKDITGGLPRVIELF
RPOC_NEOSM      SVAKCQYSKDAVYLLPLGAILNVSNGDVVKAGDVIAKITKESTT-TRDITGGLPRVIELF
RPOC_EHRRW      DIITLSSGLEANYFIPIGAVLSVQDGQKVHAGDVITRIPRESIK-TRDITGGLPRVIELF
RPOC_SULDN      ---------LLRYQVQSKTSIYVEDGAKVKVADIIAKTPKALQK-SSDITGGLPRVSELF
RPOC_SULNB      ---------LIRYQLDPKTILFVKDGEEVNIADILAKTPKAAIK-SKDITGGLPRVSELF
RPOC_GRAFK      LGK--KDEVIRSYNLPVGAHLMVDNEEKIGVGKILVKIPRKSSK-AGDITGGLPRVTELF
RPOC_PORGI      IDE--NGEMLKNYSLPMGAHVVKDDGDTVKVGEILVKIPRSVGK-AGDITGGLPRVTELF
RPOC_CYTH3      NHK--KGE-PKGYSIPVGAHLAVEDGQDVKPGQVLVKIPRSVGK-TRDITGGLPRVTELF
RPOC_SALRD      ETE--DGE-QREYNMPVDARIQVDEGDEVQAGQTLAKMPRQAAQ-TSDITGGLPRVEELF
RPOC_CHLTE      VSE--SGEIRKTYPVPIKSNLYVEDGQKIVPGDIIAKVPRNLDRVGGDITAGLPKVTELF
RPOC_RHOBA      EDE--TGRPLHAQYLPERATISVKEGEEVIPGKVLAEMPRETGG-VSDITGGLPRVTEIF
RPOC_PARUW      YADQACEDLVGTYPLPAGAIISVEEGEFATAGKMLARLPRSAIK-TKDITGGLPRVAELF
RPOC_AQUAE      LEWRVCPTCSESEETTIQHQYYVVKDLEVQPGDILARIPKETAK-VRDIVGGLPRVEELF
RPOC_CARRP      -----NKSIKKNYFIPKNFNIVVYCYDYIFPGEIIAKLVSVTIL-KSSIIGGLPRLSELF
RPOC_THEMA      ------EPGTQLTMRTFHVGGVMGASDIVSGLTTVEKTFEPYAFLREEKSGGKKEIRKYY
RPOC_MYCPE      -----------------------------------------------NIAQGFERLKQLF
RPOC_MYCGA      -----------------------------------------------NITQGFERLKQIF
RPOC_UREPA      -----------------------------------------------NITQGFERIKQLF
RPOC_MYCPN      -----------------------------------------------NLAQGFERLKQIF
RPOC_MYCMO      -----------------------------------------------DITGGFGRLIELI
RPOC_MYCPU      -----------------------------------------------DITGGFGRLTELI
RPOC_MYCH2      -----------------------------------------------DITGGFTRLIELI
RPOC_MYCS5      -----------------------------------------------DITGGFGRLIELI
                                                                   *  .: .  

RPOC_DEIRA      EARKPK--TQAVVADRDGVIRIEE------------------EEERYLVRIEADDEQY--
RPOC_THET8      EARRPK--AKAVISEIDGVVRIEE------------------TEEKLSVFVESE------
RPOC_TREPA      EARRPK--NAAVLAQISGVVSFKG-----------------LFKGKRIVVVRDHYG----
RPOC_BORAP      ETRIPK--NLTEMAKVSGIVQFKS-----------------IQKGKRLINILDEYG----
RPOC_LEPIC      EARRPK--DATTLAETDGKIEISG----------------EIVKEKRVLYIHPDNPDL--
RPOC_FUSNN      EARNPK--GKATLAEIDGRIEILT----------------TKKKQMRVVNVRSLENPE--
RPOC_CALS4      EARKPK--GLAVITEISGVVRINE----------------S-KKRREITVVDEENNISK-
RPOC_SYMTH      EARKPK--GQAIIAELDGEVSITE----------------Q-KGRREITITSEDG-ESV-
RPOC_LACSS      EARNPK--AIATITEVTGEVIAVE----------------ENPAEHTREITVQGETDTR-
RPOC_LEUMM      EARIPK--GRAEISEVTGTITVIE----------------ENPADRTKSVTIEGETDTR-
RPOC_STRMU      EARNPK--GEAVITEVKGQVTDIE----------------EDAATRTKKVYVKGATGEG-
RPOC_STRP7      EARNPK--GEAVITEVKGQVTAIE----------------EDASTRTKKVFVKGETGEG-
RPOC_STAS1      EARNPK--GQAVITEIEGVVDDIK----------------L-AKDRQQEIVIKGANETK-
RPOC_ARTS2      EARTPK--GVAPIAEAAGRIAIEE----------------SE--RQMRLVITPDDGSEE-
RPOC_LEIXX      EARTPK--GASPIAEAAGRIVIEE----------------TD--KSRKVILTPDNGDEP-
RPOC_CORJK      EARVPK--AKSPIASVDGKVRIED----------------DD--NFFTLTIEPDDGSDD-
RPOC_CUTAK      EARSPK--GKSPLAEAAGVIRIDE----------------SD--NRRKLVLVRDDGEDD-
RPOC_BIFLO      EARTPK--GEAPITEFAGSIKIVE----------------ND--RGRQIILTPDADSGAP
RPOC_TROWT      EARTPR--AAAPIAEADGTVSIED----------------GD--RARRLILKSDNNEEF-
RPOC_RUBXD      EARHPK--GEAVISDIDGIVSLEE----------------TDSERLVRVVVTAPDGSEA-
RPOC_DEHMC      EARPPK--VQSIISEIDGVVEVIE----------------NENGRHIRIASDEVYQDEYE
RPOC_ECOLI      EARRPK--EPAILAEISGIVSFG-----------------KETKGKRRLVITPVDGSDP-
RPOC_BUCCC      EARKPK--ELAILAEINGIVSFG-----------------KETKGKRRLILTPIDGNNI-
RPOC_PSEHT      EARKPK--EPAILAEVTGTISFG-----------------KETKGKKRLVITPDEG-DH-
RPOC_ALCBS      EARNPK--EAAILAEKTGTVSFG-----------------KETKGKVRLVITPDNSDDN-
RPOC_METCA      EARKTK--DPAILAEATGTVSFG-----------------KETKGKRRLIITDASG-EQ-
RPOC_XYLFT      EARRPK--DPAILAERSGVISFG-----------------KDTKGKQRLIIKDADG-SE-
RPOC_COXBU      EARRPK--DAAILAEISGVVSFG-----------------KDTKDKGRLIITAPDG-TT-
RPOC_PSYCK      EARRPK--DHAIMAEMTGVVSFG-----------------KETKGKNRFIITNEDG-EI-
RPOC_HYDCU      EARVPK--EPAIMAEVSGVVGFG-----------------KETKGKQRLVITQDSG-EQ-
RPOC_BURM1      EARSPK--DAGILAEVTGTVSFG-----------------KDTKGKQRLVITDLEG-NQ-
RPOC_NITMU      EARSPK--DAGVLAEVTGIVSFG-----------------KDTKGKQRLVITDLDG-VS-
RPOC_FRATT      EARRPK--DAAILSPCDGMVRLGN----------------RDTKEKQRIEIIDKNGHIV-
RPOC_SYNAS      EARKPK--DFAVISEIDGVVSYG-----------------KDAKGKRKVIVTPEIG-DE-
RPOC_PELCD      EARKPK--EYAIISEIDGVVSFG-----------------KDSKGKRKVHVTPEVG-SP-
RPOC_DESPS      EVRKPK--DPAIIARIDGKVSFG-----------------KELKGKRRVVVTPEYG-EQ-
RPOC_BDEBA      EARKPK--EAAIISEIDGYVTFG-----------------KDVKGKQRVIVTPEVG-EQ-
RPOC_LAWIP      EVRKPK--DMAVVSEIAGIVTYA-----------------GESKGKRKLIVTPEIG-DP-
RPOC_CAUVC      EARRPK--DCAVIAEMDGRVEFGK----------------DYK-NKRRIKITPDVDADGN
RPOC_RHOPB      EARKPK--DAAIIAEISGTIRFGR----------------DYK-NKRRISIEPVDTTE--
RPOC_RHOS4      EARRPK--DHAIIAENDGYVRFGK----------------DYK-NKRRITIEPVDDTL--
RPOC_ZYMMO      EARKPK--ENAIIAKVSGRVEFGK----------------DYK-AKRKVIIRPDDGSE--
RPOC_GLUOX      EARRPK--DHAIIAEGEGRIEFGK----------------DYK-SKRCVIVKNDDTGE--
RPOC_RICBR      EARRPK--DHAVIAEIDGRVEFGK----------------DYK-SKRRIIIHPVD-GSM-
RPOC_ORITB      EARKPK--NHAVIAEIDGCVKFGK----------------DYK-SKRRLILQPNDECQE-
RPOC_NEOSM      EARKAK--VNAVISEIDGYVEFAK----------------DYYKSKRKVIVRSREDKER-
RPOC_EHRRW      EARRPK--EHAIVSDIDGYVEFGK----------------DYYRSKRRIFIKPVDDKLS-
RPOC_SULDN      EGRRPK--ATALISEIDGVVSFG-----------------KSLRGKIRIIVASDNGILK-
RPOC_SULNB      EARRPK--DIALIAQIDGVVSFG-----------------KPLRGKERLIISGDNGQIT-
RPOC_GRAFK      EARNPS--NPAVVSEIDGVVSFGK----------------I-KRGNREIIVESKLG-EVK
RPOC_PORGI      EARNPS--NPAIVSEIDGEIGFGK----------------L-KRGNREITVTSKLG-EEK
RPOC_CYTH3      EARNPS--NPAVVSEIDGIVTYGA----------------I-KRGNREIFIESKDG-VKK
RPOC_SALRD      EARTPD--EPAVVSEIDGIVSFGD----------------Q-KRGSQEVIVTSRDGDMEK
RPOC_CHLTE      EARIPT--DPAIVSEIDGYVSFGS----------------Q-RRSSKEIRVKNDFG-EEK
RPOC_RHOBA      EARKPK--DPAVIAEVDGEVEILS----------------ERKRGKRTIIVRSESG-IER
RPOC_PARUW      EARKPK--DSAEIAKIDGVVDFRG----------------V-QKNKRIVVVRDEMTGMEE
RPOC_AQUAE      EARKPK--NPAILSEIDGYVKIYEDADEVIIFNPRTGETAKYSIKKDELILVRHGQFVKK
RPOC_CARRP      EARIPK--LKALLSEIDGVCKIKF------------------SHLNYIITIISKFGFYK-
RPOC_THEMA      GSE-------AILCEVDGFVKDIA----------------TDESGRTVIYIEDYAGNIH-
RPOC_MYCPE      DIIPPKQWEKSIISEIEGKVSSIKAS----------------PDNPNILVVTIKNSKES-
RPOC_MYCGA      DVVSPKEWELATIAENEGVVESITS-------------------DATARIIRIKTRLEA-
RPOC_UREPA      DCIQPQENEKAVISQVKGTVERIEKD----------------SNTNGYNVVIKYNKDNY-
RPOC_MYCPN      EVVAPKDYERCVISEVKGVVKSITT-------------------TQNAQEVLIESSVDE-
RPOC_MYCMO      DAFEKPWGLLAQISKWYGVVSEIKESKTAS------------NKLIVSIKEDFKNTLRT-
RPOC_MYCPU      DAYRSPWGRPAIISKVDGIITEIKTPKDKN------------TNLVYITYLDQDDASQT-
RPOC_MYCH2      DSHEHPWGKPAKISPYYGIITKISDLAEKNA--------ANKGFLITIEYKTSKNEKAE-
RPOC_MYCS5      DAYDQPWGTPAEISRHYGKVKKIETQKNKKGK-------ESGQFNISVEYFDEDGNKQT-
                            :    *                                          

RPOC_DEIRA      ------------------------------------------------------------
RPOC_THET8      ------------------------------------------------------------
RPOC_TREPA      ------------------------------------------------------------
RPOC_BORAP      ------------------------------------------------------------
RPOC_LEPIC      ------------------------------------------------------------
RPOC_FUSNN      ------------------------------------------------------------
RPOC_CALS4      ------------------------------------------------------------
RPOC_SYMTH      ------------------------------------------------------------
RPOC_LACSS      ------------------------------------------------------------
RPOC_LEUMM      ------------------------------------------------------------
RPOC_STRMU      ------------------------------------------------------------
RPOC_STRP7      ------------------------------------------------------------
RPOC_STAS1      ------------------------------------------------------------
RPOC_ARTS2      --------I---------------------------------------------------
RPOC_LEIXX      --------H---------------------------------------------------
RPOC_CORJK      --------V---------------------------------------------------
RPOC_CUTAK      --------V---------------------------------------------------
RPOC_BIFLO      KEDGVIKPI---------------------------------------------------
RPOC_TROWT      ------------------------------------------------------------
RPOC_RUBXD      --------R---------------------------------------------------
RPOC_DEHMC      LPSGWKTQVQSRQWVDSGMVLASPELEGKSKAVVQSDQNVVARVAGEVTVEGNLITIKYS
RPOC_ECOLI      ------------------------------------------------------------
RPOC_BUCCC      ------------------------------------------------------------
RPOC_PSEHT      ------------------------------------------------------------
RPOC_ALCBS      ------------------------------------------------------------
RPOC_METCA      ------------------------------------------------------------
RPOC_XYLFT      ------------------------------------------------------------
RPOC_COXBU      ------------------------------------------------------------
RPOC_PSYCK      ------------------------------------------------------------
RPOC_HYDCU      ------------------------------------------------------------
RPOC_BURM1      ------------------------------------------------------------
RPOC_NITMU      ------------------------------------------------------------
RPOC_FRATT      ------------------------------------------------------------
RPOC_SYNAS      ------------------------------------------------------------
RPOC_PELCD      ------------------------------------------------------------
RPOC_DESPS      ------------------------------------------------------------
RPOC_BDEBA      ------------------------------------------------------------
RPOC_LAWIP      ------------------------------------------------------------
RPOC_CAUVC      QP----------------------------------------------------------
RPOC_RHOPB      ------------------------------------------------------------
RPOC_RHOS4      ------------------------------------------------------------
RPOC_ZYMMO      ------------------------------------------------------------
RPOC_GLUOX      ------------------------------------------------------------
RPOC_RICBR      ------------------------------------------------------------
RPOC_ORITB      ------------------------------------------------------------
RPOC_NEOSM      ------------------------------------------------------------
RPOC_EHRRW      ------------------------------------------------------------
RPOC_SULDN      ------------------------------------------------------------
RPOC_SULNB      ------------------------------------------------------------
RPOC_GRAFK      ------------------------------------------------------------
RPOC_PORGI      ------------------------------------------------------------
RPOC_CYTH3      ------------------------------------------------------------
RPOC_SALRD      ------------------------------------------------------------
RPOC_CHLTE      ------------------------------------------------------------
RPOC_RHOBA      ------------------------------------------------------------
RPOC_PARUW      ------------------------------------------------------------
RPOC_AQUAE      GQKITETKVAEIDGQVRIKG-----------------------------RGFKVIVYNPE
RPOC_CARRP      ------------------------------------------------------------
RPOC_THEMA      ------------------------------------------------------------
RPOC_MYCPE      ------------------------------------------------------------
RPOC_MYCGA      ------------------------------------------------------------
RPOC_UREPA      ------------------------------------------------------------
RPOC_MYCPN      ------------------------------------------------------------
RPOC_MYCMO      ------------------------------------------------------------
RPOC_MYCPU      ------------------------------------------------------------
RPOC_MYCH2      ------------------------------------------------------------
RPOC_MYCS5      ------------------------------------------------------------
                                                                            

RPOC_DEIRA      -SSKTATKVPRVLR-----------MTVKDGERVEAGQPITRGAVNPHDLLMYK-----D
RPOC_THET8      -GFSKEYKLPKEAR-----------LLVKDGDYVEAGQPLTRGAIDPHQLLEAK-----G
RPOC_TREPA      --KEYKHLVSMSRQ-----------LLVRDGDTVEAGERLCDGCFDPHDILAI-----LG
RPOC_BORAP      --VEHKHYIPAGKH-----------LLVRDGDIVKAGDMLCDGRINPHDVLEI-----LG
RPOC_LEPIC      --EKVKVTIPIGKQ-----------IRVRNGDFVKRGDQIDDGNLDPHDILRV-----KG
RPOC_FUSNN      --EFKEYLIPMGER-----------LVVTDGLKIKAGDKITEGAISPYDVLNI-----KG
RPOC_CALS4      -----TYLIPYGSR-----------LKVRDGQWVQAGDELTEGSVNPHDLLKI-----KG
RPOC_SYMTH      -----TYSIPYGAR-----------VKVRSGQFVEAGDELTEGSVNPHDLLRV-----KG
RPOC_LACSS      -----SYSVPYTSN-----------IIVSEGDMIHRGEKITGGSVDPKQLIKV-----RD
RPOC_LEUMM      -----TYTLPLTTR-----------MRFGEGDEIKRGEAINEGPIDPKELLAV-----TD
RPOC_STRMU      -----EYTVPFTAR-----------MKVQVGDEVHRGAPLTEGSIQPKHLLEV-----RD
RPOC_STRP7      -----EYVVPFTAR-----------MRVEVGGQVARGAALTEGSIQPKRLLAV-----RD
RPOC_STAS1      -----SYLASGTSR-----------LKVEVGQSVERGEVLTEGSIEPKNYLSV-----SG
RPOC_ARTS2      -----AYPVLRRSR-----------LLIEDGQHVAVGQKLINGPVDPKQVLRI-----MG
RPOC_LEIXX      -----VYPVLKRST-----------LLVEDRQQVELGQQLIVGTVDPKEVLRV-----KG
RPOC_CORJK      -----VYEKLSKRQGLATLGTGGVERPIRDGDHVKMGQQLLKGAADPHEVLRV-----MG
RPOC_CUTAK      -----EYVVPRRAR--LEFDLDGTHRVIRDGVRVAAGEQLMGGTADPQDVLRI-----SG
RPOC_BIFLO      -----TYQVSKRVP-----------LKVADGDHIKVGTQLVEGSVDPKKILTI-----LG
RPOC_TROWT      -----SYTVLKRAQ-----------LRVKDGSRVSLGDQLVEGSLDPKEVLRV-----KG
RPOC_RUBXD      -----EYRVERQLL----------RPEIVDGAEIRANTPITEGSLYPHQILENDLRYGRG
RPOC_DEHMC      ESEEREYTIPAAMQ-----------IKVKTGDTIRAGQQLTDGSINPQDILSI-----LG
RPOC_ECOLI      ----YEEMIPKWRQ-----------LNVFEGERVERGDVISDGPEAPHDILRLR-----G
RPOC_BUCCC      ----YEEMIPKWRQ-----------LNVFEGERVEKGDIISDGPESPHDILRLR-----G
RPOC_PSEHT      ----YEEMIPKWRQ-----------LNVFEGERVSKGEVIADGPESPHDILRLR-----G
RPOC_ALCBS      ----YEELIPKWRQ-----------LNVFEGERVEKGEVVSDGPLNPHDILRLK-----G
RPOC_METCA      ----HEVMVPKWRN-----------ITVFEGEHVEQGETIAEGELTPHDILRLR-----G
RPOC_XYLFT      ----HEELIPKYRQ-----------IIVFEGEHVTKGETIVDGEPSPQDILRLL-----G
RPOC_COXBU      ----HEELIPKWRH-----------VSVFEGETVEKGEVIADGPRDPHDILRLL-----G
RPOC_PSYCK      ----HEELIPKWRQ-----------INVFENETVARGEVIADGPQNPHDILRLK-----G
RPOC_HYDCU      ----HETLIPKWRS-----------VDVFEGERVEKGDVVVDGNPNPHDILRLL-----G
RPOC_BURM1      ----HEFLIAKEKQ-----------VLVHDGQVVNKGEMIVDGPADPHDILRLQ-----G
RPOC_NITMU      ----HEYLIPKDKH-----------VTAHDGQVVNKGESIVDGPADPHDILRLL-----G
RPOC_FRATT      ----EEILLPKSRH-----------LVVFDGEQVSRGDVLADGPTDPHDLLKYK-----G
RPOC_SYNAS      ----KEYLIPKGKH-----------VSVQEGDRVIAGEALMSGVNNPHDLLMIK-----G
RPOC_PELCD      ----KEYLIPKGKH-----------ISVHEGDHIKAGEALMDGSSNPHDILRVL-----G
RPOC_DESPS      ----QEYLVPKAKH-----------IIVHEGDYVQAGEPLMEGTIVPNDILSVL-----G
RPOC_BDEBA      ----KEYLIPKGKH-----------VAVREGEYVRAGEALMDGPTNPHDILAVL-----G
RPOC_LAWIP      ----KEYLIPKGKH-----------INVSDGDFVEAGDLLTEGHPELHDILKTR-----G
RPOC_CAUVC      --EAVEFLIPKGKH-----------IAVHDGDYITKGEYIIDGNPDPHDILRIL-----G
RPOC_RHOPB      --ETREYLIPKGKH-----------IHLQDGDIVEKGDFIVEGNPAPHDILAIK-----G
RPOC_RHOS4      --NSVEYMVPKGKH-----------IPVQEGDFVQKGDYIMDGNPAPHDILRIL-----G
RPOC_ZYMMO      ---PIEYLVPKSKV-----------IDAQEGDHVKRGDNLISGSPDPHDILEVL-----G
RPOC_GLUOX      ---ETQYLIPKGKH-----------VSVQEGDFVQKGDPLVDGPRVPHDILKVM-----G
RPOC_RICBR      ---GLEYMVPKGKH-----------VVVNEGDFVKKGDLLIDGNPVLQDILKVM-----G
RPOC_ORITB      ---PIEYILPKGRH-----------VTVNEGDVVKKGDMLIEGSPVLQDILKVM-----G
RPOC_NEOSM      ---IYEYLVPKGRH-----------LIVSEGDFIRRGEPLMDGDPDLHEILRVL-----G
RPOC_EHRRW      ---PVEYLVPKGKH-----------TIVNEGDFVHKGDLLMDGDPDPHDILRVL-----G
RPOC_SULDN      -----EYFVDKSHT-----------PVVNSGDFVHAGERLTSGIISSHELLRIM-----G
RPOC_SULNB      -----EQFIDKNKV-----------ALVHTGEYVHAGEKLTDGIVSSHDILAAL-----G
RPOC_GRAFK      -----KYLVKLSNQ-----------ILVQENDYVRAGMPLSDGSITPEDILNIK-----G
RPOC_PORGI      -----KYLIPLSKQ-----------LLVQENDFVRAGTPLSDGAITPADILAIK-----G
RPOC_CYTH3      -----RYMVPLSKH-----------ILVQDNDFIRSGNPLTDGAITPSDILSIK-----G
RPOC_SALRD      -----SYMVSLSKH-----------MLVHEGDYVEAGDRLCDGQIAPHDILSIK-----G
RPOC_CHLTE      -----VYYVQVGKH-----------VLATEGDEVKAGDPLTDGAVSPQDILRIQ-----G
RPOC_RHOBA      -----EHLVPHGKH-----------FLVHTGDIVKAGQALVDGALVPHDILRVT-----G
RPOC_PARUW      -----EHLISHTKH-----------LIIQRGDHVVKGQQLTDGLVIPHEILDIC-----G
RPOC_AQUAE      TGLQREYFVPKGKF-----------LLVKEGDFVKAGDQLTDGTPVPEEILRIK-----G
RPOC_CARRP      -----EYTLSCLRK-----------LYINNGDYVKIGDILSDGKPDLNEIINLI-----S
RPOC_THEMA      -----AYKVPKRAK-----------VRVEKGQKVLRGETLTSGAIVWWKLLELE----SE
RPOC_MYCPE      ----INYKVPFDSE-----------LRVEEGDKVKPGSKITEGSIDVKELLKVA-----G
RPOC_MYCGA      ----EEYRVPFDAV-----------ISVNPKDVVYPGSKLTEGSIDIKHLLRVA-----G
RPOC_UREPA      ----VNYPTRSNAV-----------LRVKTGDEIIAGQKITEGSIDVNDLLKYA-----G
RPOC_MYCPN      ----RTYSIPFSAQ-----------LRVKVGDAVELGSKITEGSIDIRQLLRVA-----G
RPOC_MYCMO      ----EEVS--KDRK-----------LRVKVGDRVKPGSKITEGPIVLKELLKYT-----D
RPOC_MYCPU      ----EVVSVPKNRT-----------LRVKVGDKIVKGQKIIDGPIILEELLEYG-----G
RPOC_MYCH2      ----HIIRIEQSQK-----------LRVKVGDKVIPGQKLVEGPIILKELLAVS-----D
RPOC_MYCS5      ----HQYLVKSSQR-----------LRVKQGDEVVAGQKLSEGPIVLNELLESV-----D
                                                 :  .  :  *       :         

RPOC_DEIRA      TDAAQRYLVEEVQRVYRSQ-GVKVHDKHIEVIVRQMLRWVEVTDGGDTTLLEGQTVEHWE
RPOC_THET8      PEAVERYLVEEIQKVYRAQ-GVKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWD
RPOC_TREPA      ENALQNYLMNEIRDVYRVQ-GVSINDQHIGLVVRQMLRKTEVVSVGDTRFIYGQQVDKYR
RPOC_BORAP      GISLQEFLLAEIQDVYRKQ-GVSINDKHIGVIIKQMMKKVKIVAVGDTNFVYGQKVDKHT
RPOC_LEPIC      VTALQVYLVQEVQEVYRLQ-GVHINDKHIEVVVRQMLRKVLITDSGDTSFVNQQQIDRLV
RPOC_FUSNN      LVAAEQFILESVQQVYRDQ-GVTVNDKHIEIIVKQMFRKVRIIDSGASLFLEDEVIEKRV
RPOC_CALS4      IYAVQSYLLQEVQKVYRLQ-GVEINDKHIEIIIRQMMKKVKVEDPGDTSMLPGELIDMFK
RPOC_SYMTH      LRGVQRYLLREVQKVYNLQ-GVDINDKHIEIMVRQMLRKVKVEDPGDTDLLPGGFVDIFD
RPOC_LACSS      VLSTENYLLHEVQKVYRMQ-GIEIGDKHVEVMVRQMLRKVRVMDPGDTEILPGTLMDISE
RPOC_LEUMM      TLTTESYMLTEIQKVYRLQ-GIEVSDKHIEVMIRQMLRKIRVMDPGQTDLLPGTLMDIAD
RPOC_STRMU      TLSVETYLLAEVQKVYRSQ-GVEIGDKHVEVMVRQMLRKVRVMDPGDTGLLPGILMDIAD
RPOC_STRP7      VLSVETYLLGEVQKVYRSQ-GVEIGDKHIEVMVRQMIRKVRVMDPGDTDLLMGTLMDIND
RPOC_STAS1      LNATESYLLKEVQKVYRMQ-GVEIDDKHVEVMVRQMLRKVRIIEAGDTKLLPGSLVDIHN
RPOC_ARTS2      PRAAQKFLVDEVQGVYRSQ-GIGIHDKHVEVIVRQMLRRVTVIESGESDLLPGELAERSR
RPOC_LEIXX      VREVQKHLVGGVQGVYRSQ-GVPIHDKHIEVIVRQMLRKVTVVDHGDTDLLPGELVDRSR
RPOC_CORJK      RRGVQQHLINEVQKVYRDQ-GVAIHDKHIEIIVRQMLRRVTVIDSGSTEFLPGSLVDHAD
RPOC_CUTAK      VRRVQEYLVKEVQKVYNTQ-GAGIHEKHIEIVIRQMLRRITVIESGDTQMMPGELVDRGA
RPOC_BIFLO      KRAAQVNIVEEVHTVYRSQ-GVDIHDKHIEVIVHQMTRRVTIIDSGDTDLLPGELVDNAR
RPOC_TROWT      IRAVQEYLVNGVQQVYRSQ-GVPIHNKHIEVIVRQMLRKVTVVDHGDTSMLPGELIDQSR
RPOC_RUBXD      TTATERYLVDEVQKVYRAQ-GVDIHDKHIEIIVRQMLRKVLVEEPGDTRFLPEQVADRFS
RPOC_DEHMC      RDAVQKYLVEEVQKVYYSQ-GVHINDKHIEVIARQMLIKVRIDSSGDTDLVPGELVDKFR
RPOC_ECOLI      VHAVTRYIVNEVQDVYRLQ-GVKINDKHIEVIVRQMLRKATIVNAGSSDFLEGEQVEYSR
RPOC_BUCCC      VQAVTNYIVNEVQEVYRLQ-GVKINDKHIEVIIRQMLRKATIINPGDSNFLQGEQIEYSK
RPOC_PSEHT      VTHVANYIVNEVQEVYRLQ-GVKINDKHIETIIRQMLRKCTIMHGGDTDFLAGEQIEVAR
RPOC_ALCBS      ESELARYIVNEVQEVYRLQ-GVKINDKHIETIIRQMLRKVEILEVGESHFIKGEQAEYAR
RPOC_METCA      TAELASYLVKEIQDVYRLQ-GVKINDKHIEVIIRQMLRKVEITDPGDSSFLRGEQVDRSR
RPOC_XYLFT      IEPLAAYLVKEIQDVYRLQ-GVKINDKHIEVITRQMLRKVEIVDQGNSKFLNGEQVERQR
RPOC_COXBU      VNALANYIVNEVQEVYRLQ-GVKINDKHIEVIVRQMLRKVKITQPGDTDLLQNEQVERTR
RPOC_PSYCK      QTALADYIVNEVQDVYRLQ-GVKINDKHIEVIIRQMLRKVEITDGGDSNHFKGDQVEYAD
RPOC_HYDCU      VERLTKYIVDEVQDVYRLQ-GVRINDKHIETVVRQMLRKVEVRSTGDTSLIKGEQAEFAR
RPOC_BURM1      IEALSRYIVDEVQDVYRLQ-GVKINDKHIEVIVRQMLRRVQITDNGDSRFIPGEQVERSD
RPOC_NITMU      VEALARYITDEVQDVYRLQ-GVKINDKHIEVIVRQMLRRVQIVDSGDTRFIPGEQVERAE
RPOC_FRATT      LEEFADYILIEAQSVYRMQ-GVVINDKHIETIVRQMLRKAVILDEGDSKFVKDESIELVR
RPOC_SYNAS      EKALARYLVDEVQEVYRLQ-GVKINDKHMEVIVRQMLRRVKVIDPGDTPFMADEQVEKFR
RPOC_PELCD      EKELAKYLVDEVQEVYRLQ-GVKINDKHIEVIVRQMLRRVRIKEPGNTRFLADDQVERWE
RPOC_DESPS      VKALAKFLVDEIQEVYRLQ-GVKINDKHIEVIVRQMLKRVHITRANDSKFMIGENVEWWK
RPOC_BDEBA      AKALSAYLVDEIQEVYRLQ-GVGINDKHIEVIVRQMLRKVEIRDAGDSRFLAGEQVERYA
RPOC_LAWIP      EKYLAAYLVDEIQEVYRFQ-GVGIDDKHIEVIVRQMLRKITVTNPGGTTFLVGEQVDKGD
RPOC_CAUVC      VEALANFLVDEIQEVYRLQ-GVPINDKHIETIVRQMLQKVEILEPGDTGLIKGDHLDKPE
RPOC_RHOPB      IEELAAYLVNEIQEVYRLQ-GVLINDKHIEVIVRQMLQKVEVTDQGETDMISGEQIDKIE
RPOC_RHOS4      VEALANYMIDEVQEVYRLQ-GVKINDKHIEVIVRQMLQKYEILDSGETTLLKGEHVDKAE
RPOC_ZYMMO      VEALAEYLVSEIQEVYRLQ-GVKINDKHIETIVRQMLLKVEITHAGDSIFLPGEQVEKED
RPOC_GLUOX      VEALSDYLVNEIQDVYRLQ-GVKINDKHIEVIVRQMLQKVEILEPGDSTYLIGETVDRIE
RPOC_RICBR      VELLASYIVKEVQAVYRLQ-GVKIDDKHIEVIIRQMLQKVEITDSGGTTLLVGEKIDRRE
RPOC_ORITB      VEALGLYIINEIQAVYRLQ-GVKIDNKHIEVIITRMLQKVEITDSGDSNFVIEEKVNKRE
RPOC_NEOSM      LEALAEYMISEIQRVYRLQ-GVKINNKHIEVIIRKMLQKVEITDAGDTTFLIGEQIDKSR
RPOC_EHRRW      VEALANYMIAEIQQVYRLQ-GVRIDNKHIEVILRQMLQKVEIFEPGDTMYLVGENVDVEE
RPOC_SULDN      VKTLYNYLVSEVQQVYRSQ-GVNISDKHIEVIFTQMLRQVKILKSGDTKFIEGDLISKVK
RPOC_SULNB      EKALYDYIVSEVQMVYRRQ-GVNISDKHIEIVTSQMMRQVKVVESGDSNFIAGDIISRRK
RPOC_GRAFK      PNAVQQYLVNEVQEVYRLQ-GVKINDKHFEVVVRQMMRKVRIVDPGDTIFLENQLVHKAD
RPOC_PORGI      PTAVQEYIVNEVQDVYRLQ-GVKINDKHFEVIVRQMMRKVEIVDPGDTLFLEQQVVDKFE
RPOC_CYTH3      PTAVQEYLVNEIQEVYRLQ-GVKINDKHIEIIVRQMMQKVQIIEAGDTSFLTNQAVDRFK
RPOC_SALRD      PRAVQEHLLNEVQEVYRLQ-GVDIDDKHFEVVIRQMMKRVKITEPGDTNFLEEDQVDRQK
RPOC_CHLTE      PNAVQQYLVNEIQKVYQINAGVEINDKHLEVIVRQMLQKVRVEEPGDTDLLPGDLIDRST
RPOC_RHOBA      EEAVQQYLLHEIQQVYRSQ-RVEINDKHGEIIIARMLRKVKIENAGDTNLLPGSVMDRFH
RPOC_PARUW      VRELQKYLVNQVQEVYRLQ-GVDINDKHIEIIVRQMLKKVRVIDPGDTSLLYGEEVDKKE
RPOC_AQUAE      IEELEKFLLKEVQMVYKLQ-GVDINDKHFEIIIKQMLKKVRIIDPGDSRFLVGEEVDKEE
RPOC_CARRP      INYLLSYFVNEINSIYFPQ-NIYVNCKHIELILKQMTKKVKIIFSGESSCQQGDILFLED
RPOC_THEMA      KGVMTAMNLLKIIKNAYVQQGVSIHDKHFEIIFKQMLSMATIVDPGDSDYLPDQLVPLVD
RPOC_MYCPE      IEVVRNYIIKEVQKVYRLQ-GIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINT
RPOC_MYCGA      IETVRQYFLEEVQKVYRLQ-GIEIADKYVEVTIRQLTNKLQVIDVGDSDYFVGQTVDINK
RPOC_UREPA      IENVRHYIIKEVQKVYRMQ-GIEISDKYIEVIISQLTNKITITNPGDSGLFVGETISINE
RPOC_MYCPN      IQRVRQYMIVEIQKVYRIQ-GIEIADKYVEIIIRQLTSLLQVTDAGSSNLFVGQLVHSHH
RPOC_MYCMO      ARTVQKYLLKEIQRLYRMQ-GISISDKYIEIIIRQMLSKVDIVEPGDSNFFAGSIVDIFE
RPOC_MYCPU      PRKVQSYLLKEIQKIYRMQ-GIAINDKYIEIIISQMLSKIEISEPGDSDFIIGSLVNNLD
RPOC_MYCH2      ARTLQNYLLKEIQRIYRMQ-GISISDKYIEIIIRQMLSKVQIIENGDSNFFIGSIVDISD
RPOC_MYCS5      TRAVQNYILKEVQKLYRLQ-GIAIADKYIEIIIRQMLSKISIIDPGDSSFYSGSLVDAFV
                                  :    :  ::      ::     :   . :            

RPOC_DEIRA      VDQANEAL----------------------------------------------------
RPOC_THET8      VEALNERLI---------------------------------------------------
RPOC_TREPA      FHEENRR-----------------------------------------------------
RPOC_BORAP      FYEQNRK-----------------------------------------------------
RPOC_LEPIC      FNEENKR-----------------------------------------------------
RPOC_FUSNN      VDLENKK-----------------------------------------------------
RPOC_CALS4      FEEENKK-----------------------------------------------------
RPOC_SYMTH      FEDENER-----------------------------------------------------
RPOC_LACSS      FTDRNHD-----------------------------------------------------
RPOC_LEUMM      FKRANEP-----------------------------------------------------
RPOC_STRMU      FTDANRD-----------------------------------------------------
RPOC_STRP7      FTDANKD-----------------------------------------------------
RPOC_STAS1      FTDANRE-----------------------------------------------------
RPOC_ARTS2      FEDANRR-----------------------------------------------------
RPOC_LEIXX      YNEINRG-----------------------------------------------------
RPOC_CORJK      AVAASKE-----------------------------------------------------
RPOC_CUTAK      YEAANRK-----------------------------------------------------
RPOC_BIFLO      FREINRN-----------------------------------------------------
RPOC_TROWT      YQELNRE-----------------------------------------------------
RPOC_RUBXD      VLAENER-----------------------------------------------------
RPOC_DEHMC      YEDINAK-----------------------------------------------------
RPOC_ECOLI      VKIANRE-----------------------------------------------------
RPOC_BUCCC      ITSENKK-----------------------------------------------------
RPOC_PSEHT      VNIANRD-----------------------------------------------------
RPOC_ALCBS      VMEEIDR-----------------------------------------------------
RPOC_METCA      LLEENDR-----------------------------------------------------
RPOC_XYLFT      VIDENAK-----------------------------------------------------
RPOC_COXBU      VREENEK-----------------------------------------------------
RPOC_PSYCK      IKALNAK-----------------------------------------------------
RPOC_HYDCU      VLEMNEK-----------------------------------------------------
RPOC_BURM1      MLDENDR-----------------------------------------------------
RPOC_NITMU      MLAENEQ-----------------------------------------------------
RPOC_FRATT      ILEENDK-----------------------------------------------------
RPOC_SYNAS      FQEENEK-----------------------------------------------------
RPOC_PELCD      FECENRK-----------------------------------------------------
RPOC_DESPS      FEEERDR-----------------------------------------------------
RPOC_BDEBA      YMEENER-----------------------------------------------------
RPOC_LAWIP      FKEENQK-----------------------------------------------------
RPOC_CAUVC      FDKEQEK-----------------------------------------------------
RPOC_RHOPB      FDQINAK-----------------------------------------------------
RPOC_RHOS4      LDEVNQK-----------------------------------------------------
RPOC_ZYMMO      FEAVNAK-----------------------------------------------------
RPOC_GLUOX      YEGENQR-----------------------------------------------------
RPOC_RICBR      FDEINEK-----------------------------------------------------
RPOC_ORITB      VINTNKK-----------------------------------------------------
RPOC_NEOSM      VERINEV-----------------------------------------------------
RPOC_EHRRW      VLKTNSN-----------------------------------------------------
RPOC_SULDN      FAQENEK-----------------------------------------------------
RPOC_SULNB      FQEENQR-----------------------------------------------------
RPOC_GRAFK      FIEENNKLFGMKVIEDAGDS-EKLKAGQIITPRDLRD-----------------------
RPOC_PORGI      VMEENDRIWGKKVVIDAGDS-QVLKAGQIVTARKLRD-----------------------
RPOC_CYTH3      FREENDNILDKKVVVECGDS-EKLRPGMIITARQLRD-----------------------
RPOC_SALRD      MASINDDLYDKFVVKDPSD--ANVEIGEVIGRRRLRE-----------------------
RPOC_CHLTE      FIEANEAVAEKVRVIDRGDAPARIIEGQLYKQRDITK-----------------------
RPOC_RHOBA      FRKANQDLQKCIKIANPGD--TDYTEGTIVPKEAFEQ-----------------------
RPOC_PARUW      FEVENQ------------------------------------------------------
RPOC_AQUAE      LEEEIQR-----------------------------------------------------
RPOC_CARRP      AINENFS-----------------------------------------------------
RPOC_THEMA      IKRFNREILEGNAKVEENRKWVIGKTLAKRIITETEEGELVELAQKGDEVTEELLKKIIE
RPOC_MYCPE      FRKENEK-----------------------------------------------------
RPOC_MYCGA      FRKEVTN-----------------------------------------------------
RPOC_UREPA      FTEVAQN-----------------------------------------------------
RPOC_MYCPN      LNELNKS-----------------------------------------------------
RPOC_MYCMO      YQEENGR-----------------------------------------------------
RPOC_MYCPU      FYNTNNE-----------------------------------------------------
RPOC_MYCH2      YQEVNGQ-----------------------------------------------------
RPOC_MYCS5      YQKENGI-----------------------------------------------------
                                                                            

RPOC_DEIRA      ------------------AEGQTPASWKPVLLGITKSSLTTKSWLSAASFQHTTHVLTEA
RPOC_THET8      ------------------AEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEA
RPOC_TREPA      ----------------VEAEGGQPAVARPMFQGITKAALNIDSFISAASFQETNKVLTNA
RPOC_BORAP      ----------------VIEQGGEPAIASPILIGVTKTSLNIDSFISAASFQETTKVLTDA
RPOC_LEPIC      ----------------VIAEGGSPAESVPILLGLTKASLNTESFFSAASFQETTKVLTDA
RPOC_FUSNN      ----------------LEEQGKALIKYEPVIQGITKAAVNTGSFISAASFQETTKVLSNA
RPOC_CALS4      ----------------AIEKGLRPATGRRALLGITKAALATDSFLSAASFQETTRVLTDA
RPOC_SYMTH      ----------------VIMEGGVPAVARPMLLGITKASLATDSFLSAASFQETTRVLTDA
RPOC_LACSS      ----------------TLISGGVPATCRPVLLGITKASLETNSFLSAASFQETTRVLTDA
RPOC_LEUMM      ----------------ALFEGLVPATARPVLLGITKAALETNSFLSAASFQETTRVLTDA
RPOC_STRMU      ----------------IVIAGGIPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDA
RPOC_STRP7      ----------------VLIAGGVPATGRPVLMGITKASLETNSFLSAASFQETTRVLTDA
RPOC_STAS1      ----------------AFKERKRPATAKPVLLGITKASLETESFLSAASFQETTRVLTDA
RPOC_ARTS2      ----------------VVSEGKTPASGRPELMGITKASLATESWLSAASFQETTRVLTQA
RPOC_LEIXX      ----------------ALQEGKKTASARQEVMGITKASLATESWLSAASFQETTRVLTQA
RPOC_CORJK      ----------------AVKTGGRPVEVRAEIMGITKASLATESWLSAASFQETTRVLTDA
RPOC_CUTAK      ----------------AVAEGGRPAEGRPVLMGITKASLATESWLSAASFQETTKVLTDA
RPOC_BIFLO      ----------------IVKNGGRPAVGRPALMGITKASLATDSWLSAASFQETTRVLTEA
RPOC_TROWT      ----------------AQAEGRKTASARQEVTGITKASLATESWLSAASFQETTRVLTQA
RPOC_RUBXD      ----------------VEEEGGRPAEFHTILMGITKASLATESFLSAASFQETARVLTDA
RPOC_DEHMC      ----------------VLAEGGEPATAHTVLMGITRASLSTESWLAAASFQETTRVLTDA
RPOC_ECOLI      ----------------LEANGKVGATYSRDLLGITKASLATESFISAASFQETTRVLTEA
RPOC_BUCCC      ----------------LKKNKKETATFSRDLLGITKASLATESFISAASFQETTRVLTEA
RPOC_PSEHT      ----------------LEAQGKIPAKFEIQLMGITKASLATESFISAASFQETTRVLTDA
RPOC_ALCBS      ----------------LKAEDKMLPQYQRLLLGITKASLATESFISAASFQETTRVLTEA
RPOC_METCA      ----------------LEEEGKVPACYEPVLLGITKASLSTESFISAASFQETTRVLTEA
RPOC_XYLFT      ----------------LIARNELPAKYNPVLLGITKASLATESFISAASFQETTRVLTEA
RPOC_COXBU      ----------------IIKKDGTVAKVEPILLGITKASLATESFISAASFQETTRVLTAA
RPOC_PSYCK      ----------------LEAEDKFPVQFERQLLGITKASLATESFISAASFQETTRVLTAA
RPOC_HYDCU      ----------------VSDEGSVEASYQRVLLGITKASLATESFISAASFQETTRVLTEA
RPOC_BURM1      ----------------MIAEGKRPASYENVLLGITKASLSTDSFISAASFQETTRVLTEA
RPOC_NITMU      ----------------VELEGKRPATYEYMLLGITKASLSTDSFISAASFQETTRVLTEA
RPOC_FRATT      ----------------LRKQGKKEVEYELVLMGITRSSLSTESFLSAASFQETTRVLTEA
RPOC_SYNAS      ----------------AIARGEQPAIGEPVLLGITKASLSTQSFISAASFQETTRVLTEA
RPOC_PELCD      ----------------VVGEGGAPAVGEPLMLGITKASLSTESFISAASFQETTKVLTQA
RPOC_DESPS      ----------------LLAEGKKPGAAEPLLLGVTKASLSTESFISAASFQETTKVLTNA
RPOC_BDEBA      ----------------INKEGGQPATCSPLLLGITKVSLSTDSWISAASFQETTKVLTEA
RPOC_LAWIP      ----------------IVEEGLEPATAEPLVLGITQASLTTSSFISAASFQETTKVLTEA
RPOC_CAUVC      ----------------AIARGGRPAVTQPVLLGITKASLQTKSFISAASFQETTRVLTEA
RPOC_RHOPB      ----------------AKEEGKKIATGTPVLLGITKASLQTRSFFSAASFQETTRVLTEA
RPOC_RHOS4      ----------------AMDHGMRPAHAEPILLGITKASLQTRSFISAASFQETTRVLTEA
RPOC_ZYMMO      ----------------LESQGQEPAQATPILLGITKASLQTRSFISAASFQETTRVLTEA
RPOC_GLUOX      ----------------LMENGDTPAKAMPVLQGITKASLQTQSFISAASFQETTRVLTDA
RPOC_RICBR      ----------------AIKNGLRPADAQLILQGITKSSLQTRSFISAASFQETTRVLTEA
RPOC_ORITB      ----------------LKVKGLREAQYRPILQGITKASLQTQSFISAASFQETTRVLTEA
RPOC_NEOSM      ----------------MASQGLRCCSYVPVLLGITRASLQTESFISAASFQETTKVLTEA
RPOC_EHRRW      ----------------MEKIGKSPAKYIPILQGITRASLDTNSFVSAASFQETTKVLTEA
RPOC_SULDN      ----------------IIKLGGRPAIAEPFLVGITRAAVSADSIISAASFQDTTKVLTEA
RPOC_SULNB      ----------------VIALGGEPAIAEPMLVGITRAAVGADSIISAASFQDTTKVLTSA
RPOC_GRAFK      ----ENSILRREDKNLATARDVITATANPVLQGITRASLQTKSFISAASFQETTKVLNEA
RPOC_PORGI      ----ENSMLKRKDLKIVKVRDAKSATASQILQGITRAALQTKSFMSAASFQETTKVLNEA
RPOC_CYTH3      ----ENSSLKRKDQRLVVVRDAEPAVSMPTLQGITQASLDTESFISAASFQETTKVLSEA
RPOC_SALRD      ----LNSELKREDKPEIEVREARPAVGEPLLLGITKASLATDSMISAASFQETTKVLTNS
RPOC_CHLTE      ----LNRELRRNGKSLITIEPALQATSHPVLLGITSAALQTESVISAASFQETTKVLTDA
RPOC_RHOBA      ----TNAEVEAMGGTPAKGKRCKSATASTQLLGITKAAVQSNSFISAASFQETTKVLTEA
RPOC_PARUW      ---------------KVSQEGGKAAQATPVLLGITKASLSTESFISAASFQDTTRVLTEA
RPOC_AQUAE      ----------------IKLEGGKLPKAEPVLVGITRAALSTRSWISAASFQETTRVLTDA
RPOC_CARRP      ----------------TLVNSRRLSYYKRIVTGITKTSLESLSFFSAASFQETNKILVNS
RPOC_THEMA      AGIKEIDVFEKDKVVTYQILPKEPIKYKRRLLSLKKAALNYPGWLSAAAFEETAWVLTAA
RPOC_MYCPE      ---------------LILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDA
RPOC_MYCGA      ---------------MLIAN-KRPPVAINQVFGLDEAPAKTGSFLSAASFQDTKKILTDA
RPOC_UREPA      ---------------MLVNK-KKPPSAINQVFGLDHAPSKSGSFLSAASFQDTKKILTDA
RPOC_MYCPN      ---------------LLLSG-KMPVIAINQVFGIDEAASKSNSFLSAASFQDTKKILTDA
RPOC_MYCMO      ---------------LLSEG-KKPAYGKVIIKGAKQSPLLSDSFLAAASFQETAKILVHS
RPOC_MYCPU      ---------------LLEKG-LEPAKGKVVIHGAKRIPLLSNSFLAAASYQESAKILVNS
RPOC_MYCH2      ---------------LISQN-KNPAFGNVIVKGAKQIPLLSNSFLAAASYQETSKILVHS
RPOC_MYCS5      ---------------LLSQG-KKPAYGVVKIKGAKQTPLLSDSWLAAASYQETAKILVDA
                                              . .    .    . .:**:::.:  :*  :

RPOC_DEIRA      SMRGQVDDLIGLKENVILGKLIPAGTGLLTVREMQVADDRTLEKYGEGSTSSDAVTGGQR
RPOC_THET8      AIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEE--ARKEAVEAKER
RPOC_TREPA      AIAGSVDDLCGLKENVIIGHLIPAGTGMRRYRQVKLFDKNKRDLDVQMEEVIRRRKLEEE
RPOC_BORAP      SIAGKIDDLRGLKENVVIGHLIPTGTGMGLYKKIKVSENVNSEV----------------
RPOC_LEPIC      AIKGKTDNLMGLKENVIIGHMIPAGTGTKKYKDIAVFKSAYGDLDRPLEEEE------EE
RPOC_FUSNN      AIEGKVDYLEGLKENVILGKKIPAGTGFNKYKSIKVRYNTDDKPEEE-------------
RPOC_CALS4      AIKGKVDPLIGLKENVIIGKLIPAGTGLSRYRNITVVKKEDQEKKEEVKKEAVDAKASS-
RPOC_SYMTH      AIKGKRDPLLGLKENVIIGKLIPAGTGMGRYRNIKLFTEDD------VYAEHLQGADD--
RPOC_LACSS      SIRGKSDPLLGLKENVIIGKIVPAGTGMAKYRHMEPKTVGAVSENVYSISDIEAQMKQE-
RPOC_LEUMM      AIRGKNDPLVGLKENVIIGKIIPAGTGMAEYRKIKSKVVGDVIAQPESESEEASDIPKL-
RPOC_STRMU      AIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNLEPLAVNEIEVIEDSEEQE--------
RPOC_STRP7      AIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNLEPHAVNEEEYLNPPVEEEGNEETTEV
RPOC_STAS1      AIKGKRDNLLGLKENVIIGKLIPAGTGMRRYRDVEYDKAAPETEIVEEVQTTEI------
RPOC_ARTS2      AMEGKSDPLLGLKENVIIGKLIPAGTGLPRYTEVTVEPTEEAKANLFTGPSAFSDFSYDT
RPOC_LEIXX      AMEGKSDPLIGLKENVIIGKLIPAGTGLSRYRNVSVEATEEAKAERYPNRIFADDSAFSE
RPOC_CORJK      AINKRSDKLIGLKENVIIGKLIPAGTGISRYRNISVEPTEEARAAAYSLPSSFGDGFYAD
RPOC_CUTAK      AINGKTDTLVGLKENVILGKLIPAGTGLEVYRNMRVEPTAEAKAAAFTMNYDPFDYDFGS
RPOC_BIFLO      ALSEKVDDLKGLKENVIIGKLIPAGTGLARYRNAVVEPDKAIRDTIYPNFGLGGDGDLGD
RPOC_TROWT      VISGRRDPLIGLKENVIIGNLIPAGTGLSVYRDVEPEPRPEAISRMYPTRRPEIENLLEG
RPOC_RUBXD      AIEGKVDNLTGLKENVIIGKLIPAATGLPKYRRLTVTVEGYRADDVDELDIAAS------
RPOC_DEHMC      AIYGRVDKLSGLKENVIIGKLIPAQCKSCKEATIERAERIAAAASAPAMSGLPENCL---
RPOC_ECOLI      AVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEAPA---APQVTAEDASAS
RPOC_BUCCC      AVAGKKDKLRGLKENVIVGRLIPAGTGYKYHKKRLKNRIKNSVNKKNNMSSISVEEAAAN
RPOC_PSEHT      AVNGKSDELRGLKENVIVGRLIPAGTGFSYHQERMARRKQRNVVE---EQTVSAEEATQA
RPOC_ALCBS      AVTGKEDDLRGLKENVVVGRLIPAGTGYAYHMERRRQRADARGPE-----APTMDEVEAA
RPOC_METCA      AIRGSTDRLQGLKENVIVGRLIPAGTGLAYHTERRE-RAKLGEVTEPETPI----IDTAE
RPOC_XYLFT      AVRGTRDNLRGLKENVIVGRLIPAGTGQTYHSQRRY-SSVGLTESEMETLVGRSTSSGTE
RPOC_COXBU      SVAGKRDDLRGLKENVIVGRLIPAGTGFSYHQQRRAVAGKSVEEKEIEEKRVTASEAEQA
RPOC_PSYCK      AVTGKVDELRGLKENVVVGRLIPAGTGLAYHKARKEKAEQKLQDKDLNAAFDMSATTDAT
RPOC_HYDCU      AVSGKEDKLVGLKENVIVGRLIPAGTGFAYHKARKEASEKTQRELAAFMNTDDESAVQEE
RPOC_BURM1      AIMGKRDDLRGLKENVIVGRLIPAGTGLAFHKARK-AKEMSDRERFDQIAAEEAFDFGTP
RPOC_NITMU      AIMGKKDDLRGLKENVIVGRLIPAGTGLTFHNTRKRQRLMLDTGEAPPLSEEETGEIRNS
RPOC_FRATT      SINSQIDNLRGLKENVLIGRLIPTGTGLAVRKESAKIEKMREELGVEDNMVFTDLSSFNP
RPOC_SYNAS      SLAGKVDYLRGLKENVIMGRLIPAGTGLVMYRKLGIKTVADEDAESVEIEGDENSNKKSL
RPOC_PELCD      AIEGKIDYLRGLKENVIMGRLIPAGTGISKYRSAHLLIEEPEEIEEPVPEDLEDETAGAD
RPOC_DESPS      AMSGRVDELLGLKENVIMGRLISAGTGINRVD----------------------------
RPOC_BDEBA      AINSRTDHLRGLKENIIMGRLIPAGTGLTSYKRWKVSVHEDDDIGFVALPGMTSSVQPQG
RPOC_LAWIP      SLKGKMDYLRGLKENVIVGRLIPAGTGYREYMELDIVVPEQKERPNKFLEELEERPVLIE
RPOC_CAUVC      SVHGKTDTLEGLKENVIVGRLIPAGTGSYLRSLQRVAAKRDEQLAQQRED-----AMEPL
RPOC_RHOPB      AVNGKVDPLEGLKENVIVGRLIPAGTGASMAKIREVAVKRDKLILDEREKQATIVPSAPE
RPOC_RHOS4      SVQGKRDKLVGLKENVIVGRLIPAGTGGATSRVKKIAHDRDQKVIDTRRAEAESAAALAA
RPOC_ZYMMO      AVQGKIDTLSGLKENVIVGRLIPAGTGAAMKRLRVTANSRDAALRAANKAVNFEQPTIAI
RPOC_GLUOX      ATSGKVDTLNGLKENVIVGRLIPAGTGSVMNRLRSIAASQDR-------------QRVGG
RPOC_RICBR      AIAGKVDKLRGLKENVIVGRLVPAGTGFLYGQNA--------------------------
RPOC_ORITB      AIAGKVDKLEGLKENVIVGQTIPAGTGFYINEIKKIARQRDKE--------------IIA
RPOC_NEOSM      AVAGKVDRLRGLKENIIAGRLLPVGAGYFIDKLKREFTGERQ------------------
RPOC_EHRRW      AFSGKEDSLYGLKENVIVGRLIPAGTGFLMNKIKKLSLLNKDDYSMYYNSEYQDLASIEA
RPOC_SULDN      AVSAKVDDLNDLKENVIIGRTIPVGTGIYKDQEIMFGYN---------------------
RPOC_SULNB      SIAGTVDMLEDLKENVVIGRLIPVGTGMIDSDEIKFSAAE--------------------
RPOC_GRAFK      AVSGKIDYLEGLKENVIVGHRIPAGTGMRKYDSIIVGSKEEFDQMLEKKQEVNYN-----
RPOC_PORGI      AICGKTDYLEGLKENVICGHLIPAGTGLRDYEKLVVMHRDDYEKATAERKSFLSVPTAEP
RPOC_CYTH3      AVRGKVDFLKGLKENVIVGHLIPAGTGQRVFNDIIVGSKEEYDSLIASKEAFNAARKGEL
RPOC_SALRD      AIRSRTDPLEGLKENVVAGHSIPAGTGQREYRDLVVGSKSELEELQAAIGGDGESPSGDG
RPOC_CHLTE      AVAGKVDHLVGLKENVIVGKLIPAGTGLRKYRSIRLRDNEAEEAEAVEAASDEEI-----
RPOC_RHOBA      ALAGKVDKLVGLKENVILGHLIPAGTGFRIFQESEVNYRREALEELSQAPVSALEESFPL
RPOC_PARUW      ACAGKTDYLVGFKENVIMGHIIPGGTGFDRHKRVKMFVDSEQEQGLEFNFAD--------
RPOC_AQUAE      SVEGKIDELRGLKENVIIGNIIPAGTGVDEYREVDVIPAEEKVLEEKKEPKEGS------
RPOC_CARRP      AIKNRTDYLLGLKENVLVGRLIPAGTGLIKYFKKKSKSSKNNLDFKNRKKKFYINYF---
RPOC_THEMA      AIEGKVDPLIGLKENVIVGQLIPAGTGLDVFAGIQVEETPRAAVEEELA-----------
RPOC_MYCPE      CVKGQIDSLNGLKENVIFGNLIPCGTGKKSNED---IIEEGNKMYELEY-----------
RPOC_MYCGA      AVKNQIDYLVGLKENVILGNLIPAGTGFMSSEE---IIKAGEEALEKEY-----------
RPOC_UREPA      AARSQKDMLIGLKENVILGNLIPAGTGLKDVEE---VIAYGEEMYKKQY-----------
RPOC_MYCPN      AVKTQVDYLLGLKENVIIGGKIPAGTGFLTDEE---LAYLGAKTVQEEY-----------
RPOC_MYCMO      AISRKVDELSGLKENIILGHKIPSGTSSKYEVDSKYDIRDPKSFFEDESKYEYLKFEDKW
RPOC_MYCPU      SISSQQDFLVGVKENIILGKKIPAGTNSQYESKSKFDIRDPKEYFKDKSPQRHYKIEMDN
RPOC_MYCH2      VISSQIDKLEGLKENIIVGHKIPAGTNSNYEPKSKFDIRNPLSFFMKNNR----------
RPOC_MYCS5      SIAKRTDNLEGLKENIIIGYKIPAGTNSNFEENGKYNLKEFSSYFPNKYDSTPELKLEEI
                      * * ..***:: *  :.                                     

RPOC_DEIRA      YDDTRPGSSINPGYGD--------------------------------------
RPOC_THET8      PAARRGVKREQPGKQA--------------------------------------
RPOC_TREPA      ALAQAVAGMEGEPEGEA-------------------------------------
RPOC_BORAP      ------------------------------------------------------
RPOC_LEPIC      EIPQAIAEESDAEE----------------------------------------
RPOC_FUSNN      ------------------------------------------------------
RPOC_CALS4      ------------------------------------------------------
RPOC_SYMTH      ------------------------------------------------------
RPOC_LACSS      ------ETKE--------------------------------------------
RPOC_LEUMM      ------DDVAKTFDN---------------------------------------
RPOC_STRMU      ------DTVEE-------------------------------------------
RPOC_STRP7      VVDTAVETVEETVE----------------------------------------
RPOC_STAS1      ------------------------------------------------------
RPOC_ARTS2      LGG----DGAPEFHAIPLDDYDLGSDFR--------------------------
RPOC_LEIXX      ND-----LSFVDFDSFSSDDYTPGTYN---------------------------
RPOC_CORJK      DT-----YGEFTGAAVPLDDIDLM------------------------------
RPOC_CUTAK      GS----------GEAVPLDDLDLGDLG---------------------------
RPOC_BIFLO      ASFSDADLSDLNFSNLEFGDLKLGDDFNPDDFYSDQGGQPDIEE----------
RPOC_TROWT      DS----VDPEFDFSSLTQG-LELPDDYPVQ------------------------
RPOC_RUBXD      ------------------------------------------------------
RPOC_DEHMC      ------------------------------------------------------
RPOC_ECOLI      LAELLNAGLGGSDNE---------------------------------------
RPOC_BUCCC      LSELLNSTENINNRI---------------------------------------
RPOC_PSEHT      LTDALNADLSGNQ-----------------------------------------
RPOC_ALCBS      LSEALSSSGE--------------------------------------------
RPOC_METCA      VEEALKQAFSL-------------------------------------------
RPOC_XYLFT      VTSPSKDAIPLGG-----------------------------------------
RPOC_COXBU      LSEALKSSAPQEAKAAQKDE----------------------------------
RPOC_PSYCK      DFASFDEAFAQELNQGNH------------------------------------
RPOC_HYDCU      VVEETISVTESVEQTTE-------------------------------------
RPOC_BURM1      STPAEEPQHPAAE-----------------------------------------
RPOC_NITMU      GYAV--------------------------------------------------
RPOC_FRATT      EEISFDSIQSQKEDKDINEDIEESLRNALESLDF--------------------
RPOC_SYNAS      DMHAAN------------------------------------------------
RPOC_PELCD      SAQAASEESVAEGKD---------------------------------------
RPOC_DESPS      ------------------------------------------------------
RPOC_BDEBA      ------------------------------------------------------
RPOC_LAWIP      IDS---------------------------------------------------
RPOC_CAUVC      PAEIALSDAE--------------------------------------------
RPOC_RHOPB      PEPLALPTPEQS------------------------------------------
RPOC_RHOS4      PTDGVIDLGSEDSGLVETVENREE------------------------------
RPOC_ZYMMO      ESDNTDTPDAAE------------------------------------------
RPOC_GLUOX      ASPKAVEDAAE-------------------------------------------
RPOC_RICBR      ------------------------------------------------------
RPOC_ORITB      AKDAELQENNTEA-----------------------------------------
RPOC_NEOSM      GKQVSVGVGGDLTST---------------------------------------
RPOC_EHRRW      GHACSVSPSQGVSDTSGAVDY---------------------------------
RPOC_SULDN      ------------------------------------------------------
RPOC_SULNB      ------------------------------------------------------
RPOC_GRAFK      ------------------------------------------------------
RPOC_PORGI      AMEEAPSE----------------------------------------------
RPOC_CYTH3      QQS---------------------------------------------------
RPOC_SALRD      AAGDGAPSEEDVEQIEASGSEN--------------------------------
RPOC_CHLTE      ------------------------------------------------------
RPOC_RHOBA      LGGDGEPASTTSSTTEGE------------------------------------
RPOC_PARUW      ------------------------------------------------------
RPOC_AQUAE      ------------------------------------------------------
RPOC_CARRP      ------------------------------------------------------
RPOC_THEMA      ------------------------------------------------------
RPOC_MYCPE      ------------------------------------------------------
RPOC_MYCGA      ------------------------------------------------------
RPOC_UREPA      ------------------------------------------------------
RPOC_MYCPN      ------------------------------------------------------
RPOC_MYCMO      IA----------------------------------------------------
RPOC_MYCPU      EVSDMFNEFRISQNK---------------------------------------
RPOC_MYCH2      ------------------------------------------------------
RPOC_MYCS5      TDENIEEEFDYLKENTISEEEFENLDDDTMYHLETSDEFEDESFGEDDFEYSEE