CLUSTAL format seed alignment for MF_01323

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      ------------------------------------------------------------
RPOC1_PHATC      ------------------------------------------------------------
RPOC1_TRICV      ------------------------------------------------------------
RPOC1_NEPOL      MSGEVAQDQPPIRSPRSTRRSQEIVNSAITVQSSAKLDTDKSGAQADKVSSKKSRTTSPE
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ------------------------------------------------------------
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      -----------------------------------------------MIKKNLFKDFSRF
RPOC1_OLTVI      ------------------------------------------------------------
RPOC1_TUPAK      ------------------------------------------------------------
RPOC1_TETOB      ----------MKNFKNQNFQKENLNLSFSQKRKKFSGKIGICFFEYNFFQKNFHVQNFPI
RPOC1_BIGNA      ------------------------------------------------------------
                                                                             

RPOC1_MESVI      ----------------------------MIPKKL-------VHFEYIQINLASPERILQW
RPOC1_CHLAT      ----------------------------MIPMKR-------VHFEYIQIHLASPERIRKW
RPOC1_CYAP4      -----------------------------MPKLE-------QRFDYVKIGLASPDRIRLW
RPOC1_ACAM1      -----------------------------MPKLE-------QRFDYVKIGLASPERIRQW
RPOC1_THEEB      -----------------------------MPRLE-------QRFDYVKVSLASPERIIQW
RPOC1_TRIV2      ----------------------------MRPAQT-------NQFDYVKIGLASPERIRQW
RPOC1_NOSS1      ----------------------------MRPAQT-------NQFDYVKIGLASPERIRQW
RPOC1_NOSP7      ----------------------------MRPAQT-------NQFDYVKIGLASPERIRQW
RPOC1_NOSCO      ----------------------------MRPAQT-------NQFDYVKIGLASPERIRQW
RPOC1_SYNE7      -----------------------------MAKQE-------QRFDYVKIALASPERIRQW
RPOC1_SYNP6      -----------------------------MAKQE-------QRFDYVKIALASPERIRQW
RPOC1_RIPO1      ----------------------------MKAQAD-------SRFDYVKINLASPERIRQW
RPOC1_CROS5      ----------------------------MKPAQD-------TRFDYVKIGLASPERVRQW
RPOC1_MICAN      ----------------------------MKTPTD-------QRFDYVKIGLASPERIRQW
RPOC1_SYNY3      ----------------------------MKAQSE-------PRFDYVKIAIASPERIRQW
RPOC1_GLOC7      ----------------------------MKQPTE-------QRFDYVKIGLASPDRIRQW
RPOC1_SYNP2      ----------------------------MKSQQE-------QHFDYVKIGIASPERVRQW
RPOC1_TRIEI      -----------------------------MPKLE-------QRFDYVKIGLASPDRIRGW
RPOC1_SYNJA      -----------------------------MAKTE-------QRFDYVKIGLASPERIIEW
RPOC1_SYNJB      -----------------------------MAKTE-------QRFDYVKIGLASPERIMEW
RPOC1_GLOVI      -----------------------------MPRME-------QRFDYIKISIASPERVMAW
RPOC1_PROMT      ----------------MTNS---------NLRTE-------NHFDYVKIKLASPERVMEW
RPOC1_PROM1      ----------------MTNS---------NLRTE-------NHFDYVKIKLASPERVMEW
RPOC1_SYNS3      ----------------MTNS---------NLRTE-------NHFDYVKITLASPDRVMEW
RPOC1_SYNPW      ----------------MTNS---------NLRTE-------NHFDYVKITLASPDRVMEW
RPOC1_SYNPX      ----------------MTNS---------NLRTE-------NHFDYVKITLASPERVMEW
RPOC1_SYNS9      ----------------MTNS---------NLRTE-------NHFDYVKITLASPERVMEW
RPOC1_SYNSC      ----------------MTNS---------NLRTE-------NHFDYVKITLASPDRVMEW
RPOC1_PROMM      ----------------MTNS---------NLRTE-------NHFDYVKITLASPDRVMEW
RPOC1_PROM3      ----------------MTNS---------NLRTE-------NHFDYVKITLASPDRVMEW
RPOC1_PROMA      ----------------MTNS---------NLRTE-------NHFDYVKITLASPERVMSW
RPOC1_PROM4      ----------------MTNS---------NLRTE-------NHFDYVKITLASPERVMSW
RPOC1_SYNR3      ----------------MTNS---------NTRTE-------SHFDYVKIKLASPERIREW
RPOC1_PROM0      ----------------MTNS---------NLRTE-------NHFDYVKISIASPQRIMDW
RPOC1_PROM2      ----------------MTNS---------NLRTE-------NHFDYVKISIASPQRIMDW
RPOC1_PROMS      ----------------MTNS---------NLRTE-------NHFDYVKISIASPQRIMDW
RPOC1_PROM9      ----------------MTNS---------NLRTE-------NHFDYVKISIASPQRIMDW
RPOC1_PROM5      ----------------MTNS---------NLRTE-------NHFDYVKISIASPQRIMDW
RPOC1_PROMP      ----------------MTNS---------NLRTE-------NHFDYVKISIASPQRIMDW
RPOC1_PAUCH      ----------------MTNNSGNNSGNSNNPRTE-------NHFDYVRITLASPERIMEW
RPOC1_PYRYE      -----------------------------MTKFE-------QYFDYVKISLASPEKIRQW
RPOC1_PORPU      -----------------------------MTNFE-------QYFDYVKISLASPEKIRQW
RPOC1_GRATL      -----------------------------MTKFD-------HHFDYVKISLASPSKIRSW
RPOC1_GUITH      -----------------------------MSKLE-------QYFDYVKINLASPQRIKKW
RPOC1_RHDSA      -----------------------------MAKLE-------QYFDYVKINLASPERIRKW
RPOC1_CYAPA      -----------------------------MPKHE-------QYFDYVKINLASPERIRQW
RPOC1_EMIHU      --------------------------------MD-------RSFDYVKINLASPSRIREW
RPOC1_CYACA      ---------------------------MVSHQFL-------PYLDYIKICLASPERIRVW
RPOC1_THAPS      -----------------------------MIRSE-------KEFDYIKIKLASPMRILQW
RPOC1_PHATC      -----------------------------MVEST-------KEFDYIKIKLASPFRILQW
RPOC1_TRICV      -----------------------------MLQSE-------KEFDYINIKLASPLRILQW
RPOC1_NEPOL      LLEDQVVSNESKTSKKKETKASQLFSKRKEIFST-------RDLRFLKLRIASPTRIRSW
RPOC1_OSTTA      -----------------------------------------MSIEYVQLQLASPSEIKRW
RPOC1_PHYPA      -----------------------------MIHRE--------KYHHLRIRLASPEQIRSW
RPOC1_MARPO      -----------------------------MTYQK--------KHQHLRIELASPEQIRNW
RPOC1_ANTAG      -----------------------------MIYQE--------ENQHLRIGLASPEEIRGW
RPOC1_ANEMR      -----------------------------MIHRI--------KYQRLRIELASPEQIRNW
RPOC1_PSINU      -----------------------------MIHKN--------NYQQLRIGLASPEQIRAW
RPOC1_ANGEV      -----------------------------MIHHN--------NYPQLRIELASPEQIRAW
RPOC1_ADICA      -----------------------------MIHRT--------NYQQLRIGLASPEQIRSW
RPOC1_CUCSA      -----------------------------MIDRY--------KHQQLRIGLVSPQQISAW
RPOC1_MORIN      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_SOLBU      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_SOLTU      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_SOLLC      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_NICSY      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_TOBAC      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_ATRBE      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_NICTO      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_CUSEX      ----------------------MNNNFSSMIDRY--------KHQQLQIGSVSPQQISAW
RPOC1_CUSRE      ----------------------MNKNFSSMIDRY--------KHQQLRIGLVSPQQISAW
RPOC1_IPOPU      ----------------------MNPNFSSMIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_COFAR      -----------------------------MIDRY--------KHQQLRIGLVSPQQISAW
RPOC1_JASNU      -----------------------------MIDRY--------KHQQLRIGLVSPEQISAW
RPOC1_SPIOL      -----------------------------MIDQY--------KHQQLRIGSVSPQQISAW
RPOC1_SILLA      -----------------------------MIDQY--------KHQQLRIGLVSPKQISAW
RPOC1_FAGEA      -----------------------------MIDQY--------KHQQLRIGLVSPQQISAW
RPOC1_LEPVR      -----------------------------MIDRY--------KHQQLRIGLVSPQQISAW
RPOC1_CAPBU      -----------------------------MIDRY--------KHQQLRIGLVSPQQISAW
RPOC1_BARVE      -----------------------------MIDRY--------KHQQLRIGLVSPQQISAW
RPOC1_NASOF      -----------------------------MIDRY--------KHQQLRIGLVSPQQISAW
RPOC1_ARATH      -----------------------------MIDRY--------KHQQLRIGLVSPQQISAW
RPOC1_OLIPU      -----------------------------MIDRY--------KHQQLRIGLVSPQQISAW
RPOC1_DRANE      -----------------------------MIDRY--------KHQQLRIGLVSPQQISAW
RPOC1_LOBMA      -----------------------------MIDRY--------KHQQLRIGLVSPQQISAW
RPOC1_ARAHI      -----------------------------MIDRY--------KHQQLRIGLVSPQQISAW
RPOC1_SINAL      -----------------------------MIDRY--------KHQQLRIGLVSPQQISAW
RPOC1_CRUWA      -----------------------------MIDRY--------KHQQLRIGLVSPQQISAW
RPOC1_AETCO      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_AETGR      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_CARPA      -----------------------------MIDRY--------KHQQLRIGLVSPQQISAW
RPOC1_GOSHI      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_GOSBA      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_POPTR      ----------------------MNQNFSSMIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_POPAL      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_MANES      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_CITSI      -----------------------------MIDRY--------KHQQLRIGSVSPQQIRAW
RPOC1_VITVI      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_PHAAO      -----------------------------MIDQY--------KHQQLRIGSVSPQQIRAW
RPOC1_DIOEL      -----------------------------MIDQY--------KHQQLRIGPVSPQQIRAW
RPOC1_LEMMI      ----------------------MNQNFYSMIDRY--------KHQQLRIGPVSPQQISAW
RPOC1_ACOAM      -----------------------------MIDRY--------KHQQLQIGSVSPQQISAW
RPOC1_ACOCL      -----------------------------MIDRY--------KHQQLQIGSVSPQQISAW
RPOC1_ACOGR      -----------------------------MIDRY--------KHQQLQIGSVSPQQISAW
RPOC1_NYMAL      -----------------------------MIDQY--------KHQQLRIGLVSPKQIRAW
RPOC1_NUPAD      ----------------------MNQNFSSMIDQY--------KHQQLRIGSVSPKQIHAW
RPOC1_AMBTC      -----------------------------MIDRY--------KHQQLRIGLVSPQQITAW
RPOC1_ILLOL      ----------------------MNQNFSSMIDRY--------KYQQLRIGSVSPQQISAW
RPOC1_CHLSC      -----------------------------MIDRY--------KHQQLRIGSVSPQQITAW
RPOC1_CALFG      -----------------------------MIDRY--------KHQQLRIGSVSPQQIRAW
RPOC1_LIRTU      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_DRIGR      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_CERDE      -----------------------------MIDRY--------KHQQLRIGSVSPQQIINW
RPOC1_PIPCE      -----------------------------MIDRY--------KHQQLRIGPVSPQQISAW
RPOC1_NANDO      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_RANMC      -----------------------------MIDRY--------KHQQLQIGLVSPQQIITW
RPOC1_PLAOC      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_BUXMI      -----------------------------MIDRY--------KHQQLRIGLVSPQQISAW
RPOC1_OENAR      -----------------------------MIDRY--------KHQQLRIGSVSPQQISTW
RPOC1_OENBI      -----------------------------MIDRY--------KHQQLRIGSVSPQQISTW
RPOC1_OENPA      -----------------------------MIDRY--------KHQQLRIGSVSPQQISTW
RPOC1_OENEH      -----------------------------MIDRY--------KHQQLRIGSVSPQQISTW
RPOC1_OENGL      -----------------------------MIDRY--------KHQQLRIGSVSPQQISTW
RPOC1_EUCGG      -----------------------------MIDRY--------KHQQLRIGSVSPQQISAW
RPOC1_PANGI      -----------------------------MIDRY--------KHQQLRIGSVSPQQISTW
RPOC1_DAUCA      -----------------------------MIDQY--------KHQQLRIGSVSPQQISTW
RPOC1_SOYBN      -----------------------------MIDQY--------KHQQLRIGSVSPQQISAW
RPOC1_PHAVU      -----------------------------MIDQY--------KHQQLRIGSVSPQQMSAW
RPOC1_LOTJA      -----------------------------MIDQY--------KHQQLRIGSVSPQQISAW
RPOC1_HELAN      -----------------------------MIDRY--------THQQLRIGLVSPQQISTW
RPOC1_GUIAB      ----------------------MKQKFSSMIDRY--------THQQLRIGLVSPQQISTW
RPOC1_LACSA      -----------------------------MIDRY--------THQQLRIGLVSPQQISTW
RPOC1_AGRST      -----------------------------MIDQY--------KHQQLQIGLVSPQQIKAW
RPOC1_BRADI      -----------------------------MIDQY--------KHQQLQIGLVSPQQIKAW
RPOC1_WHEAT      -----------------------------MIDQY--------KHQQLQIGLVSPQQIKAW
RPOC1_HORVU      -----------------------------MIDQY--------KHQQLQIGLVSPQQIKAW
RPOC1_LOLPR      -----------------------------MIDQY--------KHQQLQIGLVSPQQIKAW
RPOC1_ORYNI      -----------------------------MIDQY--------KHQQLQIGLVSPQQIKAW
RPOC1_ORYSA      -----------------------------MIDQY--------KHQQLQIGLVSPQQIKAW
RPOC1_ORYSI      -----------------------------MIDQY--------KHQQLQIGLVSPQQIKAW
RPOC1_ORYSJ      -----------------------------MIDQY--------KHQQLQIGLVSPQQIKAW
RPOC1_SACHY      -----------------------------MIDQY--------KHKQLQIGLVSPQQIKAW
RPOC1_SACOF      -----------------------------MIDQY--------KHKQLQIGLVSPQQIKAW
RPOC1_SORBI      -----------------------------MIDQY--------KHKQLQIGLVSPQQIKAW
RPOC1_MAIZE      -----------------------------MIDQY--------KHKQLQIGLVSPQQIKAW
RPOC1_PELHO      -----------------------------MIDKYQE-----PKHHQLRIGLVSPQQIMAW
RPOC1_PINKO      -----------------------------MIEQN--------KHQQLRIGLASPEQICAW
RPOC1_PINTH      -----------------------------MIDQN--------KHQQLRIGLASPEQICAW
RPOC1_CYCTA      -----------------------------MIDRD--------KHQQLRIGLASPEQICAW
RPOC1_WELMI      -----------------------------MIDSK-------KKHQKLKITLVSPEQIRAW
RPOC1_GNEPA      -----------------------------MIDSQ-------KEHQKLKITLVSPEQIRVW
RPOC1_CRYJA      ------------------------------MSDQ-------DKHEQLRIGLVSPEQILAW
RPOC1_HUPLU      --------------------------------MK-------NKHQFFRIGLASPEQIRAW
RPOC1_CHAGL      -----------------------------MFDKQ--------KNRYIRVELASPDQIRNW
RPOC1_STAPU      -----MTYSNKPTGSSLRSSRNSTLEPQSLVHREESKRQEGPKGQNLRIGLASPEQIRNW
RPOC1_ZYGCR      -----------------------------MIPEDHL--------QYIRIGLASPEQIRSW
RPOC1_CHAVU      -----------------------------MIHQK--------GYQFLQIGLASPKQIRKW
RPOC1_OEDCA      SFVQSSIKNNVRCHSKLKLVQPFFIKTKQERNKKFLSSYKFSEIQLITIDLASPEKIKEW
RPOC1_OLTVI      ---------MPTGSPVDATEGSNHSTRRGVLKKRVASFSNGIHIKSIRIGLASPERIRQW
RPOC1_TUPAK      -----MSSDLKYSLSSEPPQPQVQSPLLKILKGEVSETTELKKLHSFRLCLSSPKIIKQW
RPOC1_TETOB      KKCRLLAQVSEQTPQISSFRQTSNFTPNLIKKKLLNGYSKIHELKLVTIELASPEKIKAW
RPOC1_BIGNA      ------------------------------MNYYSIQNSRDSSISSIEIRICSSKSIVKK
                                                               . :   *.  :   

RPOC1_MESVI      GQRTLSNGEIVGEVTRSETINYR----TLKPEMDGLFCERIFGPVKDWECHCGRYK----
RPOC1_CHLAT      GERTLSNGEVVGEVTRSETINYR----TLKPEMDGLFCERIFGPVKDWECHCGQYK----
RPOC1_CYAP4      GERTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCERIFGPAKDWECHCGKYK----
RPOC1_ACAM1      GERTLPNNQVVGEVTKPETINYR----TLKPEMDGLFCERIFGPAKDWECHCGKYK----
RPOC1_THEEB      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCERIFGPAKDWECHCGKYK----
RPOC1_TRIV2      GERTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCERIFGPAKDWECHCGKYK----
RPOC1_NOSS1      GERTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCERIFGPAKDWECHCGKYK----
RPOC1_NOSP7      GERTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCERIFGPAKDWECHCGKYK----
RPOC1_NOSCO      GERTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCERIFGP-KDWECHCGKYK----
RPOC1_SYNE7      GERTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPAKDWECHCGKYK----
RPOC1_SYNP6      GERTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPAKDWECHCGKYK----
RPOC1_RIPO1      GERSLPNGVVVGEVTKPETINYR----TLKPEMDGLFCERIFGPSKDWECWCGKYK----
RPOC1_CROS5      GERTLPNGVVVGEVTKPETINYR----TLKPEMDGLFCERIFGPSKDWECWCGKYK----
RPOC1_MICAN      GERTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECWCGKYK----
RPOC1_SYNY3      GERTLPNGTVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECWCGKYK----
RPOC1_GLOC7      GERTLPNGILVGEVTKPETINYR----TLKPEMDGLFCERIFGPSKDWECWCGKYK----
RPOC1_SYNP2      GERTLPNGQTVGEVTKPETINYR----TLKPEMDGLFCERIFGPAKDWECHCGKYK----
RPOC1_TRIEI      GERTLPNGTVVGEVTKPETINYR----TLKPEMDGLFCERIFGPAKDWECHCGKYK----
RPOC1_SYNJA      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCERIFGPVKDWECHCGKYK----
RPOC1_SYNJB      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCERIFGPAKDWECHCGKYK----
RPOC1_GLOVI      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCERIFGPSKDWECYCGKYK----
RPOC1_PROMT      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECHCGKYK----
RPOC1_PROM1      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECHCGKYK----
RPOC1_SYNS3      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECHCGKYK----
RPOC1_SYNPW      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECHCGKYK----
RPOC1_SYNPX      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECHCGKYK----
RPOC1_SYNS9      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECHCGKYK----
RPOC1_SYNSC      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECHCGKYK----
RPOC1_PROMM      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECHCGKYK----
RPOC1_PROM3      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECHCGKYK----
RPOC1_PROMA      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECHCGKYK----
RPOC1_PROM4      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECHCGKYK----
RPOC1_SYNR3      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECHCGKYK----
RPOC1_PROM0      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECHCGKYK----
RPOC1_PROM2      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECHCGKYK----
RPOC1_PROMS      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECHCGKYK----
RPOC1_PROM9      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECHCGKYK----
RPOC1_PROM5      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECHCGKYK----
RPOC1_PROMP      GQRTLPNGQVVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECHCGKYK----
RPOC1_PAUCH      GQRTLPNGQIVGEVTKPETINYR----TLKPEMDGLFCEKIFGPSKDWECHCGKYK----
RPOC1_PYRYE      GERSLPNGQIVGEITKPETINYR----TLKPEMDGLFCEKIFGPVKDWECHCGKYK----
RPOC1_PORPU      GERSLPNGQIVGEITKPETINYR----TLKPEMDGLFCEKIFGPVKDWECHCGKYK----
RPOC1_GRATL      GERTLPNGQIVGEVTKPETINYR----TLKPEMDGLFCERIFGPVKDWECHCGKYK----
RPOC1_GUITH      GERRLPNGQVVGEVTKPETINYR----TLKPEMDGLFCERIFGPVKDWECHCGKYK----
RPOC1_RHDSA      GERTLPNGQIVGEVTKPETINYR----TLKPEMDGLFCERIFGPVKDWECHCGKYK----
RPOC1_CYAPA      GERILKNGEIVGKITKPETINYR----TLKPEMDGLFCEKIFGPVKDWECHCGKYK----
RPOC1_EMIHU      GERKLPNGQVVGEITKPETINYR----TLKPEMNGLFCERVFGPVNDWECHCGKYK----
RPOC1_CYACA      AQRILPNGQIVGEVTKPETINYR----TLKPEMDGLFCERIFGPIKNWECHCGKYK----
RPOC1_THAPS      SHRKLPNGQFVGEVQKSETINYR----TFKPEMDGLFCERIFGPSKSLECACGKYK----
RPOC1_PHATC      ANRKLPNGQFVGEVQKSETINYR----TFKPEMDGLFCERIFGPSKSLECACGKYK----
RPOC1_TRICV      SYRRLPNGQFIGEVQKSETINYR----TFKPEMDGLFCERIFGPSRSFECACGKYK----
RPOC1_NEPOL      GTHKLPNGKQVGRITKAETINYR----TYKPEMDGLFCERAFGPVKDWECHCGRTKG---
RPOC1_OSTTA      SQRILPTGEVVGEISKADTINYR----TFKPERGGLFCERIFGSTSNGECSCGKTKRRKL
RPOC1_PHYPA      AERVLPNGEIVGQVTKPYTLHYK----THKPEKDGLFCERIFGPIKSGICACGKYQI---
RPOC1_MARPO      AERVLPNGEIVGQVTKPYTLHYK----THKPEKDGLFCEKIFGPIKSGICACGKYQG---
RPOC1_ANTAG      AERTLPNGEVVGRITEPYTLHYK----THKPEKDGLFCERIFGPIKSGICACGKYRS---
RPOC1_ANEMR      AERKLPDGEIVGRVTKPYTLHYK----THKPEKDGLFRERIFGPVRSGVCICGRYKG---
RPOC1_PSINU      AERILPTGEIVGKVTQPYTLHYK----THKPERDGLFCERIFGPIKSGFCACGNYQA---
RPOC1_ANGEV      AERRLPNGEVVGQVTQASTFHYK----THKPERDGLFCEKIFGPIRSGICSCGNSKS---
RPOC1_ADICA      AERELPNGDVIGQVDQPYTLHYK----THKPERDGLFCERIFGPTKSGVCACGNCRS---
RPOC1_CUCSA      ANKTLPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_MORIN      AKKILPNGEIIGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_SOLBU      ATKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_SOLTU      ATKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_SOLLC      ATKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_NICSY      ATKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_TOBAC      ATKILPNGEIVGEVTKPYTFHYK----TNKPEKMDYFVKN-FGPIKSGICACGNYRV---
RPOC1_ATRBE      ATKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_NICTO      ATKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_CUSEX      ATKILPNGEIVGEVKKPYTFLYK----TNKPEKEGLFCERIFGPIKSGICACGNYRV---
RPOC1_CUSRE      ATKILPNGEIVGEVKKPYTFLYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_IPOPU      ATKILPNGEIVGEVKKPYTFLYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_COFAR      ATKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_JASNU      ATKILPNGEIVGEVTKPSILHYK----TNKAEKGGLFCERIFGPQKSGICACGNYRV---
RPOC1_SPIOL      ATKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_SILLA      ATKILPNREIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_FAGEA      ATKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNFRI---
RPOC1_LEPVR      ATKIIPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_CAPBU      ATKIIPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_BARVE      ATKIIPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_NASOF      ATKIIPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_ARATH      ATKIIPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_OLIPU      ATKIIPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_DRANE      ATKKIPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_LOBMA      ATKKIPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_ARAHI      ATKKIPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_SINAL      ATKKIPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_CRUWA      ATKIIPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_AETCO      ATKIIPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_AETGR      ATKIIPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_CARPA      ANRILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_GOSHI      AKKILPNGETVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_GOSBA      AKKILPNGETVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_POPTR      TNKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_POPAL      TNKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_MANES      ANKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_CITSI      ANKILPNGEIIGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRI---
RPOC1_VITVI      ANKILPNGEIIGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_PHAAO      AKKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERISGPIKSGICACGNYRG---
RPOC1_DIOEL      ANKILPNGEIIGEVTKPYTFHYK----TNKPEKDGLFCERISGPIKSGICACGNYRV---
RPOC1_LEMMI      ANKILPNGEVVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_ACOAM      ANKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_ACOCL      ANKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_ACOGR      ANKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_NYMAL      ANKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_NUPAD      ANKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_AMBTC      ANKILPNGEMVGEVTKPYTFHYK----SNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_ILLOL      ANKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERISGPIKSGICACGNYRV---
RPOC1_CHLSC      ANKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_CALFG      ANKTLPNGEIIGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_LIRTU      ANKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_DRIGR      ANKILPNGEMVGEVTKPYTFHYK----TNKPEKDGLFCERISGPIKSGICACGNYRV---
RPOC1_CERDE      GKKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERISGPIKSGICACGNYRV---
RPOC1_PIPCE      ANKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERISGPIKSGICACGNYRV---
RPOC1_NANDO      AKKILPNGEMVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_RANMC      AEKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_PLAOC      AKKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_BUXMI      ANKILPNGEIVGEVTKPYTFHYK----TNKPERDGLFCERIFGPIKSGICACGNYRV---
RPOC1_OENAR      ANKILPNGEIVGEVTKPYTFHYK----TNKPERDGLFCERIFGPIKSGICACGTYRV---
RPOC1_OENBI      ANKILPNGEIVGEVTKPYTFHYK----TNKPERDGLFCERIFGPIKSGICACGTYRV---
RPOC1_OENPA      ANKILPNGEIVGEVTKPYTFHYK----TNKPERDGLFCERIFGPIKSGICACGTYRV---
RPOC1_OENEH      ANKILPNGEIVGEVTKPYTFHYK----TNKPERDGLFCERIFGPIKSGICACGTYRV---
RPOC1_OENGL      ANKILPNGEIVGEVTKPYTFHYK----TNKPERDGLFCERIFGPIKSGICACGTYRV---
RPOC1_EUCGG      AKKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_PANGI      ANKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_DAUCA      ANKILPNGERVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_SOYBN      AKKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_PHAVU      AKRILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_LOTJA      ATKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICTCGNYRV---
RPOC1_HELAN      SKKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_GUIAB      SKKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_LACSA      SKKILPNGEIVGEVTKPYTFHYK----TNKPEKDGLFCERIFGPIKSGICACGNYRV---
RPOC1_AGRST      ANKNLPNGEVVGEVTRPSTFHYK----TDKPEKDGLFCERIFGPIKSGICACGNSRP---
RPOC1_BRADI      ANKNLPNGEVIGQVTRPSTFHYK----TDKPEKDGLFCERIFGPIKSGICACGNSRA---
RPOC1_WHEAT      ANKNLPNGEVVGEVTRPSTFHYK----TDKPEKDGLFCERIFGPIKSGICACGNSRA---
RPOC1_HORVU      ANKNLPNGEAVGEVTRPSTFHYK----TDKPEKDGLFCERIFGPIKSGICGCGNSRA---
RPOC1_LOLPR      ANKNLPNGEVVGEVTRPSTFHYK----TDKPEKDGLFCERIFGPIKSGICACGNSRA---
RPOC1_ORYNI      ANKTLPNGEVVGEVTRPSTFHYK----TDKPEKDGLFCERIFGPIKSRICACGNSRA---
RPOC1_ORYSA      ANKTLPNGEVVGEVTRPSTFHYK----TDKPEKDGLFCERIFGPIKSRICACGNSRA---
RPOC1_ORYSI      ANKTLPNGEVVGEVTRPSTFHYK----TDKPEKDGLFCERIFGPIKSRICACGNSRA---
RPOC1_ORYSJ      ANKTLPNGEVVGEVTRPSTFHYK----TDKPEKDGLFCERIFGPIKSRICACGNSRA---
RPOC1_SACHY      AKKILPNGEVVGEVTRPSTFHYK----TDKPEKDGLFCERIFGPIKSGICACGNSRA---
RPOC1_SACOF      AKKILPNGEVVGEVTRPSTFHYK----TDKPEKDGLFCERIFGPIKSGICACGNSRA---
RPOC1_SORBI      AKKILPNGEVVGEVTRPSTFHYK----TDKPEKDGLFCERIFGPIKSGICACGNSRA---
RPOC1_MAIZE      AKKILPNGEVVGEVTRPSTFHYK----TDKPEKDGLFCERIFGPIKSGICACGNSRA---
RPOC1_PELHO      ANKTLPTGEIVGEVKNYRTFSYDRDSETYKPERDGLFCERIFGPIKSGVCACGESRK---
RPOC1_PINKO      SEKILPNGEIVGQVTKPYTLHYE----TNKPERDGSFCERIFGPIKSRVCACGNSPG---
RPOC1_PINTH      SEKILPNGEIVGQVTKPHTLHYE----TNKPERDGSFCERIFGPIKSGVCSCGNSPG---
RPOC1_CYCTA      SKRILPNGRIVGQVTKPYTLHYK----TNEPEKDGSFCERIFGPIKSGVCACGNSRV---
RPOC1_WELMI      SETILPNGKRVGEVTNPDTLDPT----TKKPQRDGLYCERIFGPVKSGVCACEKKPGQKK
RPOC1_GNEPA      SETILPNGKRIGEVTNPKTIDLA----TNKPERNGSFCERIFGPVKSKKCACENKFGEDK
RPOC1_CRYJA      SERILPNGERVGQVTTERTLDYR----TYEPVRDGLFCERIFGPKKRGVCACVKPRMMEN
RPOC1_HUPLU      AERVLPTGEIVGEVTQPDTFSFG----DNRPEKDGIFSEKIFGPIQTGVCACGKYKKQVE
RPOC1_CHAGL      AERTLPNGEIVGKVTKPYTLHYN----SHKPEKDGLFCERIFGPIKSGICACGKYHG---
RPOC1_STAPU      AERILPNGEIVGRVLKPHTIHYQ----THKPEKDGLFCERIFGPIKSGFCSCGKYKG---
RPOC1_ZYGCR      AERRLPNGELIGRVSKPYTIHYQ----THKPEKDGLFCERVFGPIKSGVCACGKYQG---
RPOC1_CHAVU      AERILPNGDVVGEVKEPHTLHYR----NQKPEKDGLFCEKIFGPIKSGRCACGKYER---
RPOC1_OEDCA      AEKKLPNGKIFGQVTNPNTLHYK----TLKPLKGGLFCERIFGPIKDFECACGIQKQKP-
RPOC1_OLTVI      AERVLPDGTVVGQVTNPQTVNYK----TLKPEKGGLFCEQIFGSIQDTDLTTTRD-----
RPOC1_TUPAK      AQRTLPNGEIVGSITNAQTVNYK----TLKPEKGGLFCERVFGPVKDFYCSCGKQKT---
RPOC1_TETOB      AEKELPNGKIFGEVTNANTFHYR----TFKPSKGGLFCEHIFGPLKDFECACGKRQR---
RPOC1_BIGNA      SSRILPNGNIVGEIKTAQTMNYK----TLKPENSGLFCEQTFGPIKDFECACGKKYE---
                     :     .* :     .         ..   . : :.  *.                

RPOC1_MESVI      -------RVRYNKN-------SEISIVCERCGVEV-IESGVRRHRMGHIKLASPVTHVWY
RPOC1_CHLAT      -------RVRYNTD-------LKNDIVCERCGVEV-TESGVRRHRMGHIKLAAPVTHVWY
RPOC1_CYAP4      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGYIKLAAPVTHVWY
RPOC1_ACAM1      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGYIKLAAPVTHVWY
RPOC1_THEEB      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGYIKLAAPVTHVWY
RPOC1_TRIV2      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGYIKLAAPVAHVWY
RPOC1_NOSS1      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGYIKLAAPVAHVWY
RPOC1_NOSP7      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGYIKLAAPVAHVWY
RPOC1_NOSCO      -------ESVIE------------VLSVSAVVLEV-TESRVRRHRMGYIKLAAPVAHVGY
RPOC1_SYNE7      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGFIKLAAPVAHVWY
RPOC1_SYNP6      -------RVQHR------------GIVCERCGVEV-TEPRVRRHRMGFIKLAAPVAHVWY
RPOC1_RIPO1      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGFIKLAAPVTHVWY
RPOC1_CROS5      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGYIKLAAPVTHVWY
RPOC1_MICAN      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGFIKLAAPVTHVWY
RPOC1_SYNY3      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGYIKLAAPVTHVWY
RPOC1_GLOC7      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGFIKLAAPVTHVWY
RPOC1_SYNP2      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGYIKLAAAVTHVWY
RPOC1_TRIEI      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGHIKLAAPVTHVWY
RPOC1_SYNJA      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGYIKLAAPVTHVWY
RPOC1_SYNJB      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGYIKLAAPVTHVWY
RPOC1_GLOVI      -------RVRHR------------GIVCERCGVEV-TESKVRRHRMGYIKLAAPVTHVWY
RPOC1_PROMT      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGFIKLAAPVSHVWY
RPOC1_PROM1      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGFIKLAAPVSHVWY
RPOC1_SYNS3      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGFIKLAAPVSHVWY
RPOC1_SYNPW      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGFIKLAAPVSHVWY
RPOC1_SYNPX      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGFIKLAAPVSHVWY
RPOC1_SYNS9      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGFIKLAAPVSHVWY
RPOC1_SYNSC      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGFIKLAAPVSHVWY
RPOC1_PROMM      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGFIKLAAPVSHVWY
RPOC1_PROM3      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGFIKLAAPVSHVWY
RPOC1_PROMA      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGFINLAAPVSHVWY
RPOC1_PROM4      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGFIKLAAPVSHVWY
RPOC1_SYNR3      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGFIKLAAPVSHVWY
RPOC1_PROM0      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGYIKLAAPVSHVWY
RPOC1_PROM2      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGYIKLAAPVSHVWY
RPOC1_PROMS      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGYIKLAAPVSHVWY
RPOC1_PROM9      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGYIKLAAPVSHVWY
RPOC1_PROM5      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGYIKLAAPVSHVWY
RPOC1_PROMP      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGYIKLAAPVSHVWY
RPOC1_PAUCH      -------RVRHR------------GIVCERCGVEV-TESRVRRHRMGFIKLAAPVSHVWY
RPOC1_PYRYE      -------RFRYK------------GIVCERCGVEV-TESRVRRHRMAYIELASPVTHVWY
RPOC1_PORPU      -------RFRYK------------GIVCERCGVEV-TESRVRRHRMAYIELASPVTHVWY
RPOC1_GRATL      -------RFRYK------------GVVCERCGVEV-TESKVRRHRMAYIELAAPVTHVWY
RPOC1_GUITH      -------RVRYK------------GIVCERCGVEV-AESKVRRHRMGYIELAAPVTHVWY
RPOC1_RHDSA      -------RVRYK------------GIICERCGVEV-AESKVRRHRMGHIELAAPVTHVWY
RPOC1_CYAPA      -------SIFYR------------GVICERCGVEI-TESQVRRHRMGYIELAAPVTHIWY
RPOC1_EMIHU      -------RIRHK------------GIVCERCGVEI-IDSKVRRHRMGFIELASSVTHVWY
RPOC1_CYACA      -------RIKDK------------GIICERCGVEV-TESKVRRHRMGYIELSAPVVHIWY
RPOC1_THAPS      -------RVRYE------------GLICERCGVEL-TESRVRRHRMGHINLIYPVTHVWY
RPOC1_PHATC      -------RVRYE------------GLICERCGVEL-TESRVRRHRMGYINLIYPVTHVWY
RPOC1_TRICV      -------LIRYE------------GLICERCGVEL-TESRVRRHRMGHINLIYPVAHVWY
RPOC1_NEPOL      -------QERNKDG-------IPIPRVCTHCGVEL-RDSKIRRHRMGYIELVYPVVHIWY
RPOC1_OSTTA      IVPVNFNRLTLQKRNAELEATQAIIEVCPSCGVEP-TNSKVRRYRMGCISLKKPVAHMWY
RPOC1_PHYPA      ------IEKYS--------------KFCEQCGVEF-VESRVRRYRMGYIKLACPVTHVWY
RPOC1_MARPO      ------IEKKKEN-----------IKFCEQCGVEF-IESRIRRYRMGYIKLACSVTHVWY
RPOC1_ANTAG      ------IENQREY-----------SKICEQCGVEF-TESRVRRYRMGYIELACPVTHVWY
RPOC1_ANEMR      ------IASGKET-----------TKFCEHCGVDL-TRSRIRRYRMGYIELACPVTHVWY
RPOC1_PSINU      ------VDNGKEF-----------SSFCKQCGVEF-TESRVRRYQMGYIELACPVTHVWY
RPOC1_ANGEV      ------VDEKKEY-----------SNFCKQCGVEF-TDSRVRRYRMGYIKLACPVTHVWY
RPOC1_ADICA      ------VNDEGES-----------SRFCKHCGVEF-TDSRVRRYRMGYIKLACPVTHVWF
RPOC1_CUCSA      ------IGDKKED-----------SKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_MORIN      ------IGNDKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_SOLBU      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_SOLTU      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_SOLLC      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_NICSY      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_TOBAC      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_ATRBE      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_NICTO      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_CUSEX      ------IGDEKEE-----------QKFCEQCGVEF-VDSRIRRYRMGCIKLACPVTHVWY
RPOC1_CUSRE      ------IGDEKEE-----------PKFCEQCGVEF-VDSRIRRYRMGCIKLACPVTHVWY
RPOC1_IPOPU      ------IGDEKEE-----------PKFCEQCGVEF-IDSRIRRYQMGYIKLACPVTHVWY
RPOC1_COFAR      ------IGDEKED-----------PKFCEQCGVQF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_JASNU      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_SPIOL      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_SILLA      ------IRNEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_FAGEA      ------IGDETEE-----------PKFCEQCAVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_LEPVR      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLTCPVTHVWY
RPOC1_CAPBU      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLTCPVTHVWY
RPOC1_BARVE      ------IGDEKDD-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLTCPVTHVWY
RPOC1_NASOF      ------IGDEKDD-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLTCPVTHVWY
RPOC1_ARATH      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLTCPVTHVWY
RPOC1_OLIPU      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLTCPVTHVWY
RPOC1_DRANE      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLTCPVTHVWY
RPOC1_LOBMA      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLTCPVTHVWY
RPOC1_ARAHI      ------IGDEKED-----------SKFCEQCGVEF-IDSRIRRYQMGYIKLTCPVTHVWY
RPOC1_SINAL      ------IGDEKGD-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLTCPVTHVWY
RPOC1_CRUWA      ------IGDENED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLTCPVTHVWY
RPOC1_AETCO      ------IGDEKED-----------PKFCEQCGVEF-VGSRIRRYQMGYIKLTCPVTHVWY
RPOC1_AETGR      ------IGDEKED-----------PKFCEQCGVEF-VGSRIRRYQMGYIKLTCPVTHVWY
RPOC1_CARPA      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_GOSHI      ------IGNQKEG-----------PKFCEQCGVEF-VDSRIRRYQMGYIRLACPVTHVWY
RPOC1_GOSBA      ------IGNQKEG-----------PKFCEQCGVEF-VDSRIRRYQMGYIRLACPVTHVWY
RPOC1_POPTR      ------IGDEKEE-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_POPAL      ------IGDEKEE-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_MANES      ------IRNEKED-----------QKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_CITSI      ------IGDEKED-----------PQFCEQCGVEF-VDSRIRRYQMGYIKLGCPVTHVWY
RPOC1_VITVI      ------IGDEKDD-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_PHAAO      ------IGTEKED-----------PKFCEECGVEF-VDSRIRRYQMGYIKLTCPVTHVWY
RPOC1_DIOEL      ------IGAEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPATHVWY
RPOC1_LEMMI      ------IGAEKED-----------PKFCEQCGVEF-VDSRVRRYQMGYIKLACPVTHVWY
RPOC1_ACOAM      ------IGAEKED-----------PKFCEQCGVEF-IDSRIRRYQMGYIKLACPVTHVWY
RPOC1_ACOCL      ------IGAEKED-----------PKFCEQCGVEF-IDSRIRRYQMGYIKLACPVTHVWY
RPOC1_ACOGR      ------IGAEKED-----------PKFCEQCGVEF-IDSRIRRYQMGYIKLACPVTHVWY
RPOC1_NYMAL      ------IGGEKEE-----------PKFCEQCGVES-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_NUPAD      ------IGGEKEE-----------PKFCEQCGVES-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_AMBTC      ------IGDEKED-----------PKFCEQCGVES-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_ILLOL      ------IGDEKEG-----------PKFCEQCGVES-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_CHLSC      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_CALFG      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_LIRTU      ------IGNEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_DRIGR      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_CERDE      ------IGDKKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_PIPCE      ------IGDEKED-----------PNFCEQCGVEF-ADSRARRYQMGYIKLTCPVTHVWY
RPOC1_NANDO      ------IGDKKED-----------PKFCEQCGVEF-VDSRVRRYQMGYIKLACPVTHVWY
RPOC1_RANMC      ------IGNEKED-----------PKFCEQCGVEF-VDSRVRRYQMGYIKLACPVTHVWY
RPOC1_PLAOC      ------IGDEKED-----------PKFCEQCGVEF-VDSRVRRYQMGYIKLACPVTHVWY
RPOC1_BUXMI      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_OENAR      ------IGDKKED-----------PNFCEQCGVEF-VDSRIRRYQMGYIKLACPATHVWY
RPOC1_OENBI      ------IGDKKED-----------PNFCEQCGVEF-VDSRIRRYQMGYIKLACPATHVWY
RPOC1_OENPA      ------IGDKKED-----------PNFCEQCGVEF-VDSRIRRYQMGYIKLACPATHVWY
RPOC1_OENEH      ------IGDKKED-----------PNFCEQCGVEF-VDSRIRRYQMGYIKLACPATHVWY
RPOC1_OENGL      ------IGDKKED-----------PNFCEQCGVEF-VDSRIRRYQMGYIKLACPATHVWY
RPOC1_EUCGG      ------IGDEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_PANGI      ------IGNEKED-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_DAUCA      ------IGDKKKD-----------RKSCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_SOYBN      ------IRDKKDD-----------PKFCEQCGVEF-IDSRIRRYQMGYIKLACLVTHVWY
RPOC1_PHAVU      ------IRDKKDD-----------PKFCEQCGVEF-IDSRIRRYQMGYIKLACLVTHAWY
RPOC1_LOTJA      ------IGDKKDE-----------PKFCEQCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_HELAN      ------IGDEKED-----------PQFCEQCGVEF-VDSRIRRYQMGYIKLAYPVMHVWY
RPOC1_GUIAB      ------IGDEKED-----------PQFCEQCGVEF-VDSRIRRYQMGYIKLAYPVMHVWY
RPOC1_LACSA      ------IGDEKED-----------PQFCEQCGVEF-VDSRIRRYQMGYIKLAYPVMHVWY
RPOC1_AGRST      ------SGAENED-----------ERFCQKCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_BRADI      ------SGAENED-----------ERFCQKCGVEF-ADSRIRRYQMGYIKLACPVTHVWY
RPOC1_WHEAT      ------SGAENED-----------ERFCQKCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_HORVU      ------SGAENED-----------ERFCQKCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_LOLPR      ------SGAENED-----------ERFCQKCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_ORYNI      ------SGAENED-----------ERFCQKCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_ORYSA      ------SGAENED-----------ERFCQKCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_ORYSI      ------SGAENED-----------ERFCQKCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_ORYSJ      ------SGAENED-----------ERFCQKCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_SACHY      ------SVAENED-----------ERFCQKCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_SACOF      ------SVAENED-----------ERFCQKCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_SORBI      ------SVAENED-----------ERFCQKCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_MAIZE      ------SVRENED-----------ERFCQKCGVEF-VDSRIRRYQMGYIKLACPVTHVWY
RPOC1_PELHO      ------IGDEKEK-----------RTFCEKCGVEF-VDSRIRRYQMGYIKLASPMAHVWY
RPOC1_PINKO      ------IGNEKID-----------SKFCTQCGVEF-VDSRIRRYQMGYIKLACPVVHVWY
RPOC1_PINTH      ------IGNEKID-----------AKFCTQCGVEF-VDSRIRRYQMGYIKLACPVVHVWY
RPOC1_CYCTA      ------IGNEKEN-----------SKFCEQCGVEF-VDSRIRRYRMGYIELACPVVHVWY
RPOC1_WELMI      KGFAFVDRKKKKD-----------SNFCKYCEVEL-VDSRIRRYRMGYIKLACPVAHIWY
RPOC1_GNEPA      KGFAFVDRKKTND-----------SGLCEHCGVEF-MDSRIRRYRMGYIKLASPVTHIWY
RPOC1_CRYJA      D-------KENYN-----------SNFCTQCGVELAIDPRIRRYRMGYIKLACPVVHIWY
RPOC1_HUPLU      D------EEEEED-----------SNFCKECGVEF-VESRVRRYRMGYIRLACAVTHVWY
RPOC1_CHAGL      ------FVKNLPE-----------VKFCKQCGVEF-TDSKVRRYRMGYIQLAYPATHIWY
RPOC1_STAPU      ------TRDN-DS-----------PPFCEQCGVEL-TESRVRRHRMGYIQLSSPVTHVWY
RPOC1_ZYGCR      ------TISTKDS-----------PKYCEKCGVEF-TEARVRRHRMGYIDLQCPVTHVWY
RPOC1_CHAVU      ------IPEQGEG-----------KKFCKKCWVEF-TYSRVRRYRMGYISLGCPVAHVWY
RPOC1_OEDCA      ----FNRIISFQN-----------KQFCSKCDIEY-TWSDIRRYQLGYIQLVTPVTHLWY
RPOC1_OLTVI      -----------------------------------------RRSRLGYIQLVSPVTHVWY
RPOC1_TUPAK      ----------KQH-----------PKVCPTCGVQY-ISSQSRRYKMGYIELVSPVTHIWY
RPOC1_TETOB      --------PSALESRKILEHQKTSRYFCPNCDVEY-TWSIIRRYQLGYIKLNAPVTHLWY
RPOC1_BIGNA      --------NEFIG-------------FCAICGIEY-ASSQVRRNRLGYIKLVSPVVHIWY
                                                          ** ::. * *     *  :

RPOC1_MESVI      LKGIPSYISVILGMPRKDV-----------------------------------------
RPOC1_CHLAT      LKGIPSYISIILGLPRKEV-----------------------------------------
RPOC1_CYAP4      LKGIPSYMATLLDMPLRDV-----------------------------------------
RPOC1_ACAM1      LKGIPSYMATLLDMPLRDV-----------------------------------------
RPOC1_THEEB      LKGIPSYMAILLDMPLRDV-----------------------------------------
RPOC1_TRIV2      LKGIPSYISILLDMPLRDV-----------------------------------------
RPOC1_NOSS1      LKGIPSYISILLDMPLRDV-----------------------------------------
RPOC1_NOSP7      LKGIPSYISILLDMPLRDV-----------------------------------------
RPOC1_NOSCO      SKAFLA-IFHSVGYALRDV-----------------------------------------
RPOC1_SYNE7      LKGIPSYIAILLDMPLRDV-----------------------------------------
RPOC1_SYNP6      LKGIPSYIAILLDMPLRDV-----------------------------------------
RPOC1_RIPO1      LKGIPSYLSILLDMALRDV-----------------------------------------
RPOC1_CROS5      LKGIPSYMSILLDMALRDV-----------------------------------------
RPOC1_MICAN      LKGIPSYLSILLDMPLRDV-----------------------------------------
RPOC1_SYNY3      LKGIPSYLSILLDMALRDV-----------------------------------------
RPOC1_GLOC7      LKGIPSYLSILLDMPLRDV-----------------------------------------
RPOC1_SYNP2      LKGIPSYLSILLDMALRDV-----------------------------------------
RPOC1_TRIEI      LKGIPSYMAILLDMPLRDV-----------------------------------------
RPOC1_SYNJA      LKGIPSHIATLLDMPLRDV-----------------------------------------
RPOC1_SYNJB      LKGIPSHIATLLDMPLRDV-----------------------------------------
RPOC1_GLOVI      LKGIPSYISTLLDMPLRDV-----------------------------------------
RPOC1_PROMT      LKGIPSYVAILLDMPLRDV-----------------------------------------
RPOC1_PROM1      LKGIPSYVAILLDMPLRDV-----------------------------------------
RPOC1_SYNS3      LKGIPSYVAILLDMPLRDV-----------------------------------------
RPOC1_SYNPW      LKGIPSYVAILLDMPLRDV-----------------------------------------
RPOC1_SYNPX      LKGIPSYVAILLDMPLRDV-----------------------------------------
RPOC1_SYNS9      LKGIPSYVAILLDMPLRDV-----------------------------------------
RPOC1_SYNSC      LKGIPSYVAILLDMPLRDV-----------------------------------------
RPOC1_PROMM      LKGIPSYVAILLDMPLRDV-----------------------------------------
RPOC1_PROM3      LKGIPSYVAILLDMPLRDV-----------------------------------------
RPOC1_PROMA      LKGIPSYVAILLDMPLRDV-----------------------------------------
RPOC1_PROM4      LKGIPSYVAILLDMPLRDV-----------------------------------------
RPOC1_SYNR3      LKGIPSYVAILLDMPLRDV-----------------------------------------
RPOC1_PROM0      LKGIPSYVAILLDIPLRDV-----------------------------------------
RPOC1_PROM2      LKGIPSYVAILLDIPLRDV-----------------------------------------
RPOC1_PROMS      LKGIPSYVAILLDIPLRDV-----------------------------------------
RPOC1_PROM9      LKGIPSYVAILLDIPLRDV-----------------------------------------
RPOC1_PROM5      LKGIPSYVAILLDIPLRDV-----------------------------------------
RPOC1_PROMP      LKGIPSYVAILLDIPLRDV-----------------------------------------
RPOC1_PAUCH      LKGIPSYVAILLDMPLRDV-----------------------------------------
RPOC1_PYRYE      LKGSTSYIALALDLKVKEV-----------------------------------------
RPOC1_PORPU      LKGSTSYIALALDLKVKEV-----------------------------------------
RPOC1_GRATL      LKGTTSYIALALDLTVKDL-----------------------------------------
RPOC1_GUITH      LKSLPSYISILLDIPLKDV-----------------------------------------
RPOC1_RHDSA      LKSLPSYISILLDIPLKDV-----------------------------------------
RPOC1_CYAPA      LKGIPSYISILLNKKVKEI-----------------------------------------
RPOC1_EMIHU      VKGRPSKIALILGMTVKEL-----------------------------------------
RPOC1_CYACA      LKGMPSYISVFLDMAAKEI-----------------------------------------
RPOC1_THAPS      TNSRPNYIALLLEVEQCEKRLDTGWT----------------------------------
RPOC1_PHATC      INSRPNFMALLLEVEEFEKKLDTTYT----------------------------------
RPOC1_TRICV      TNSRPNYMALLLEVEQCEKNLNTSWQILRFSLPGIYDQVLRPILLSDHWPDSSIDEYLKT
RPOC1_NEPOL      LKSIPSYLGVLLDKPRREL-----------------------------------------
RPOC1_OSTTA      FRNSPNVLAALLNMRSQEI-----------------------------------------
RPOC1_PHYPA      LKRLPSYIANLLAKPLKELESLVYCD----------------------------------
RPOC1_MARPO      LKRLPSYIANLLAKPLKELESLVYCD----------------------------------
RPOC1_ANTAG      LKRLPSYIANLLAKPLKELESLVYCD----------------------------------
RPOC1_ANEMR      LKRLPSCIANLLDKPLKELESLVHCD----------------------------------
RPOC1_PSINU      LKRLPSYIANLLAKPLNDLESLVYCDI---------------------------------
RPOC1_ANGEV      LKRLPSYIANILAKPLKELENLVYGD----------------------------------
RPOC1_ADICA      LKRIPSYIANLLAKPLKELESLVYCD----------------------------------
RPOC1_CUCSA      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_MORIN      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_SOLBU      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_SOLTU      LKRLPSYIANLLDKPLKELEGLVYCDIESY------------------------------
RPOC1_SOLLC      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_NICSY      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_TOBAC      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_ATRBE      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_NICTO      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_CUSEX      LKRLPSYIANILDKPLKELEGLVYCD----------------------------------
RPOC1_CUSRE      LKRLPSYIANILDKPIKELEGLVYCD----------------------------------
RPOC1_IPOPU      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_COFAR      LKRLPSYIANLLDKSLKELEGLVYCDYL--------------------------------
RPOC1_JASNU      LKRLPSYIANLLDKPLKELEGLVYRD----------------------------------
RPOC1_SPIOL      LKRLPSYIANFLDKPLKELEGLVYCD----------------------------------
RPOC1_SILLA      LKRLPSYIANFLDKPLKELEGLVYCDYP--------------------------------
RPOC1_FAGEA      LKRLPSYIANFLDKPLKELEGLVYCD----------------------------------
RPOC1_LEPVR      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_CAPBU      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_BARVE      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_NASOF      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_ARATH      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_OLIPU      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_DRANE      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_LOBMA      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_ARAHI      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_SINAL      LKRLPSYIANLLDKPLKELEGLVYCDVCFD------------------------------
RPOC1_CRUWA      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_AETCO      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_AETGR      LKRLPSYIANLLDKPLKELESLVYCD----------------------------------
RPOC1_CARPA      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_GOSHI      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_GOSBA      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_POPTR      LKRLPSYIANLLDKPLKQLEGLVYCD----------------------------------
RPOC1_POPAL      LKRLPSYIANLLDKPLKQLEGLVYCD----------------------------------
RPOC1_MANES      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_CITSI      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_VITVI      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_PHAAO      LKRLPSYIANLLDKPLRELEGLVYCD----------------------------------
RPOC1_DIOEL      LKRLPSYIANLLDKPLKELEGLVYCDV---------------------------------
RPOC1_LEMMI      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_ACOAM      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_ACOCL      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_ACOGR      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_NYMAL      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_NUPAD      LKRLPSYIANLSDKPLKELEGLVYCD----------------------------------
RPOC1_AMBTC      LKRLPSYIANLSDRPLKELEGLVYCD----------------------------------
RPOC1_ILLOL      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_CHLSC      LKRLPSYIANLLDKPLKELEGLVYCDVYPN------------------------------
RPOC1_CALFG      LKRLPSYIANLLDKPLKEFEGLVYCD----------------------------------
RPOC1_LIRTU      LKRLPSYIASLLDKPLKELEGLVYCD----------------------------------
RPOC1_DRIGR      FKRLPSYIANLLDKPLKELESLVYCD----------------------------------
RPOC1_CERDE      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_PIPCE      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_NANDO      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_RANMC      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_PLAOC      LKRLPSYIANLLDKPLRELEGLVYCD----------------------------------
RPOC1_BUXMI      LKRIPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_OENAR      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_OENBI      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_OENPA      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_OENEH      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_OENGL      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_EUCGG      LKRLPSYIANILDKPLKELEGLVYCD----------------------------------
RPOC1_PANGI      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_DAUCA      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_SOYBN      LKRLPSYIANLLDKSLKELESLVYCD----------------------------------
RPOC1_PHAVU      LKRLPSYIANLLDKPLKELESLVYGD----------------------------------
RPOC1_LOTJA      LKRLPSYIANLLDKPLKELEGLVYCD----------------------------------
RPOC1_HELAN      LKRLPSYIVNLLDKPLNELEDLVYCG----------------------------------
RPOC1_GUIAB      LKRLPSYIVNLLDKPLNELEDLVYCG----------------------------------
RPOC1_LACSA      LKRLPSYIVTLLDKPLNELEDLVYCN----------------------------------
RPOC1_AGRST      LKGLPSYIANLLDKPLKKLEGLVYGD----------------------------------
RPOC1_BRADI      LKGLPSYIANLLDKPLKKLEGLVYGD----------------------------------
RPOC1_WHEAT      LKGLPSYIANLLDKPLKKLEGLVYGD----------------------------------
RPOC1_HORVU      LKGLPSYIANLLDKPLKKLEGLVYGD----------------------------------
RPOC1_LOLPR      LKGLPSYIANLLDKPLKKLEGLVYGD----------------------------------
RPOC1_ORYNI      LKGLPSYIANLLDKPLKKLEGLVYGD----------------------------------
RPOC1_ORYSA      LKGLPSYIANLLDKPLKKLEGLVYGD----------------------------------
RPOC1_ORYSI      LKGLPSYIANLLDKPLKKLEGLVYGD----------------------------------
RPOC1_ORYSJ      LKGLPSYIANLLDKPLKKLEGLVYGD----------------------------------
RPOC1_SACHY      LKGLPSYIANLLDKPLKKLEGLVYGD----------------------------------
RPOC1_SACOF      LKGLPSYIANLLDKPLKKLEGLVYGD----------------------------------
RPOC1_SORBI      LKGLPSYIANLLDKPLKKLEGLVYGD----------------------------------
RPOC1_MAIZE      LKGLPSYIANLLDKPLKKLEGLVYGD----------------------------------
RPOC1_PELHO      LKRIPSYIANLLDEKIKDLENLVYRD----------------------------------
RPOC1_PINKO      LKRLPSYIANLLAKTRKELEGPVYCD----------------------------------
RPOC1_PINTH      LKRLPSYIANLLAKTRKELEGPVYCD----------------------------------
RPOC1_CYCTA      SKRLPSYIANLLAKPLKESEGPVYCD----------------------------------
RPOC1_WELMI      IKRVPSYIPTLIGKKKSEVIDLVYCN----------------------------------
RPOC1_GNEPA      IKRVPSYIATLIGKQNSEIKDLVYCN----------------------------------
RPOC1_CRYJA      FKRRPSYIADLLDKTRKELEDPVYCD----------------------------------
RPOC1_HUPLU      LRNIPSYIATILSKPLQELENLAYCD----------------------------------
RPOC1_CHAGL      LKRLPSHIATLLKMSLKEVESLVYCD----------------------------------
RPOC1_STAPU      LKNRPSVISHLLEMPLKDVESLVYCGSFIIGPGTYSKFRLLGTLRIGTHERAYKRIL---
RPOC1_ZYGCR      LKNRPSVIARLLNQPLQDIESLVYYDSFL-------------------------------
RPOC1_CHAVU      LKSTPSHIANLLGQKLKDIESLAYYN----------------------------------
RPOC1_OEDCA      LKGMPSYIRSVLGAKKKHIEAIAYCSEIVTIDQAWKPNRLIPFPETISSVALSSKKRNTF
RPOC1_OLTVI      LKALPSYIAILLDLPKKHVESISYCTETLSVPVAVHQT----------------------
RPOC1_TUPAK      LKSSPSYISLLLNLKKKNLEALTYCSENLSLNIKSFQNELLFQNVLHLLKANPFALEKGL
RPOC1_TETOB      FKTNPSYLSILFDMKRRHLESIIYCTETITIENTWKYSQQTSILNRSPKDLYLTWQKFFT
RPOC1_BIGNA      LK----YISILLDIPLKSIESIVYSTDGIIFKNFFQKPKKNQILKKET------------
                  .     :                                                    

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      ----------------------------------------------EFADLRDIKEKDNK
RPOC1_PHATC      ----------------------------------------------THSE----------
RPOC1_TRICV      ICKDFSTIALESSNIWAKKSKAWYQKIFEIYQELLYAKIETIYQFIEFIDNIDLTKQPTS
RPOC1_NEPOL      ------------------------------------------------------------
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ------------------------------------------------------------
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      VNKEIVNIQLTYNNFKKFNVNNTRSLYVSINKKLFKKQFSNNSYNCTCVDNEIQNPIFFL
RPOC1_OLTVI      ------------------------------------------TGTLAPNTSTGRATTETN
RPOC1_TUPAK      KKRKKRFLVNSNWFSFIFDNSYLIKANSGFQLKVKDFPFFLITKNQNLQNFMGVCSQSAN
RPOC1_TETOB      LEEQLQQYNRIYQNKHQHQKQRKLEFRNLSILQNKISPQINWKNFDQQIVEKNQNNSVFA
RPOC1_BIGNA      ------------------------------------------------------------
                                                                             

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      DIPEYPSSEIECRNYLASPKAILNCKEFLKEKSKAK------------------------
RPOC1_PHATC      -----------------------NCKKC--DGLKLT------------------------
RPOC1_TRICV      VNFIFDYLENEKILDLMNPISLTNEITASQDPAQIDLVDPSRDIFLFLNTFPKKQHKELF
RPOC1_NEPOL      ------------------------------------------------------------
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ------------------------------------------------------------
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      KYFNINFLKPQNLKELKVLYINPDFYKVENYPYKNQVKFEFYQKICRSFIKTSLNNHKPI
RPOC1_OLTVI      GD----------------------------------------------------------
RPOC1_TUPAK      GNEQILPEMEKQGKNTFQFSPFLTTVQKHGSSENGSFPELKREKD---------------
RPOC1_TETOB      KNFQTFENIETFGLKRKHSIFENISMQKQKKFGTYFFEEIWKIILQKSYKNSFLFLNSQE
RPOC1_BIGNA      ------------------------------------------------------------
                                                                             

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      ------------------------------------------------------------
RPOC1_PHATC      ------------------------------------------------------------
RPOC1_TRICV      RKLIR-------------------------------------------------------
RPOC1_NEPOL      ------------------------------------------------------------
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ------------------------------------------------------------
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      YALNYLSHSFLNSKVKIFSHFEHIDIHTMYVFNEEILINRFSNLARLKKNGKSKKKIGYI
RPOC1_OLTVI      ------------------------------------------------------------
RPOC1_TUPAK      ------------------------------ELELFKLIDSFSSKSPSKKKDFFRSEILTA
RPOC1_TETOB      CFSEHFFQNIYRISNIFLFSSKKIQKFLK-------------------------------
RPOC1_BIGNA      ------------------------------------------------------------
                                                                             

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      ------------------------------------------------------------
RPOC1_PHATC      ------------------------------------------------------------
RPOC1_TRICV      ------------------------------------------------------------
RPOC1_NEPOL      ------------------------------------------------------------
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ------------------------------------------------------------
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      HSKKIHININKHLLYFKNKKLKNLQLSNNLKLIIIISNNASLNYFKNWSNTFNCMNTLIL
RPOC1_OLTVI      -------------RGHASPISVELNPSTN-------------------------------
RPOC1_TUPAK      FYKKYSKFHFSRFRSNKKSFLISLFSSSNNWYFNKNQNIGYFSIFNKNFKIFFSLLNYQI
RPOC1_TETOB      ------------------------------------------------------------
RPOC1_BIGNA      ------------------------------------------------------------
                                                                             

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      ------------------------------------------------------------
RPOC1_PHATC      ------------------------------------------------------------
RPOC1_TRICV      ------------------------------------------------------------
RPOC1_NEPOL      ------------------------------------------------------------
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ------------------------------------------------------------
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      KMQFVNKKLHFQYYRSFFNTHTIERVYFNFFSLDYLKNSNFFVNFSKLLALNLLKFMKSN
RPOC1_OLTVI      ------------------------------QNSMELFDAPRLTKSSSN------------
RPOC1_TUPAK      LLKTIDKNSLANLLSPLFDNYLNDDSQVLFDDSIKKLNLTKNFRSNEDQELSTLLNSCFF
RPOC1_TETOB      ------------------------------------------------------------
RPOC1_BIGNA      ------------------------------------------------------------
                                                                             

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      ------------------------------------------------------------
RPOC1_PHATC      ------------------------------------------------------------
RPOC1_TRICV      ------------------------------------------------------------
RPOC1_NEPOL      ------------------------------------------------------------
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ------------------------------------------------------------
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      LFNIFIIPIPTILDNFIFKLSLDSQFQRLLNSLSIQKQKVLNSNSVISKSNKIFKKQFFI
RPOC1_OLTVI      ------------------------------------------------------------
RPOC1_TUPAK      LNKIGAIAQSPFSLAFYTQKSEKFYCFSPSFLNPFEKDSLSGKIFSLKKKKILPSQKMFE
RPOC1_TETOB      ------------------------------------------------------------
RPOC1_BIGNA      ------------------------------------------------------------
                                                                             

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      ------------------------------------------------------------
RPOC1_PHATC      ------------------------------------------------------------
RPOC1_TRICV      ------------------------------------------------------------
RPOC1_NEPOL      ------------------------------------------------------------
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ------------------------------------------------------------
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      KNFSLYDEAIEILWQRFWKFGYYFTSNNMNNKLCKIITKFNKNNNGLRSTLPSWLKLIKK
RPOC1_OLTVI      ---------------------------------------------------LKLTSDLGK
RPOC1_TUPAK      LKPLTLFCSKKTKRNEVESENPNSNHMLPFIAFSKKQRCEEKADFFKQLRMIELESEKSR
RPOC1_TETOB      ----------------------------------------------------------FH
RPOC1_BIGNA      ------------------------------------------------------------
                                                                             

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      ------------------------------------------------------------
RPOC1_PHATC      ------------------------------------------------------------
RPOC1_TRICV      ------------------------------------------------------------
RPOC1_NEPOL      ------------------------------------------------------------
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ------------------------------------------------------------
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      LIKKTQIDKKSNQNLLNFRVNVIHTNTQNKFSLFVNLIKIYLKKVLFLFQIAPENIKNIY
RPOC1_OLTVI      AKQPLLLWES---------------SSRSKWLRGNHGDFQANSNLIFQL-----------
RPOC1_TUPAK      SPKDLLFLNKFPFKNEKKLKYNLQKRNKLHTLKNPIGNFKFRKYFSLRLDSSLKRSLLIY
RPOC1_TETOB      EIFIFGNTESLNKTILELKNKKRTVNFFSKDFTPFFIDQNVFESHNSLKIKKQYWKSFFF
RPOC1_BIGNA      ------------------------------------------------------------
                                                                             

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      ----------------------------------------------KSNIVNFYDERIKR
RPOC1_PHATC      ----------------------------------------------TSTVVDLWDERVKR
RPOC1_TRICV      ----------------------------------------------KSNTVKSLDDRIKR
RPOC1_NEPOL      ------------------------------------------------------------
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ---------------------------------------------------TRKRLRTRK
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      IKKSIFIFQELRNKNFKYRNFRTQIKKIVIKLFGLELLPWVLSQFIFTSKIFYQFQKSKF
RPOC1_OLTVI      -----------------NEKCLWFNTFYNSLKLEKS------------------WNLEFP
RPOC1_TUPAK      QIKNFKNGFEHSDFYSENQTSTNFTKFLVSRELEKSSKFSNSLFSFENFAQLLIFIFDFP
RPOC1_TETOB      LFEFTRFFLSKKNTKIQNLNVLSKKDFLFLVNLIPFLKKLALFQNLQVFKKNTKKSHAFY
RPOC1_BIGNA      -----------------------------------------------------------F
                                                                             

RPOC1_MESVI      ------------ENIVYYNNNDSISFKNI-------------------------------
RPOC1_CHLAT      ------------EGIVYYNNYETTGSKEI-------------------------------
RPOC1_CYAP4      ------------EQIVYFNAYVVLNPGN--------------------------------
RPOC1_ACAM1      ------------EQIVYFNAYVVLDPGN--------------------------------
RPOC1_THEEB      ------------EQIVYFNSYVVLDPGN--------------------------------
RPOC1_TRIV2      ------------EQIVYFNSYVVLSPGN--------------------------------
RPOC1_NOSS1      ------------EQIVYFNSYVVLSPGN--------------------------------
RPOC1_NOSP7      ------------EQIVYFNSYVVLSPGN--------------------------------
RPOC1_NOSCO      ------------EQIVYFNSYVVLSPGN--------------------------------
RPOC1_SYNE7      ------------EQIVYFNSYVVLNPGN--------------------------------
RPOC1_SYNP6      ------------EQIVYFNSYVVLNPDN--------------------------------
RPOC1_RIPO1      ------------EQIVYFNSYVVLDPGN--------------------------------
RPOC1_CROS5      ------------EQIVYFNAYVVLDPGN--------------------------------
RPOC1_MICAN      ------------EQIVYFNAYVVLDPGN--------------------------------
RPOC1_SYNY3      ------------EQIVYFNAYVVLNPGN--------------------------------
RPOC1_GLOC7      ------------EQIVYFNAYVVLDPGN--------------------------------
RPOC1_SYNP2      ------------EQIVYFNAYVVLDPGN--------------------------------
RPOC1_TRIEI      ------------EQIVYFNAYVVLEPGN--------------------------------
RPOC1_SYNJA      ------------EQVVYFNAYVVVDPGN--------------------------------
RPOC1_SYNJB      ------------EQVVYFNAYVVVDPGN--------------------------------
RPOC1_GLOVI      ------------EQVVYFNAYVVLNPGN--------------------------------
RPOC1_PROMT      ------------EQIVYFNCYVVLDIGD--------------------------------
RPOC1_PROM1      ------------EQIVYFNCYVVLDIGD--------------------------------
RPOC1_SYNS3      ------------EQIVYFNCYVVLDAGD--------------------------------
RPOC1_SYNPW      ------------EQIVYFNCYVVLDPGD--------------------------------
RPOC1_SYNPX      ------------EQIVYFNCYVVLDPGD--------------------------------
RPOC1_SYNS9      ------------EQIVYFNCYVVLDPGD--------------------------------
RPOC1_SYNSC      ------------EQIVYFNCYVVLDPGD--------------------------------
RPOC1_PROMM      ------------EQIVYFNCYVVLDPGD--------------------------------
RPOC1_PROM3      ------------EQIVYFNCYVVLDPGD--------------------------------
RPOC1_PROMA      ------------EQIVYFNCYVVLDEGD--------------------------------
RPOC1_PROM4      ------------EQIVYFNCYVVLDQGD--------------------------------
RPOC1_SYNR3      ------------EQIVYFNCYVVLDPGD--------------------------------
RPOC1_PROM0      ------------EQIVYFNCYVVLDPGD--------------------------------
RPOC1_PROM2      ------------EQIVYFNCYVVLDPGD--------------------------------
RPOC1_PROMS      ------------EQIVYFNCYVVLDPGD--------------------------------
RPOC1_PROM9      ------------EQIVYFNCYVVLDPGD--------------------------------
RPOC1_PROM5      ------------EQIVYFNCYVVLDVGD--------------------------------
RPOC1_PROMP      ------------EQIVYFNCYVVLDVGD--------------------------------
RPOC1_PAUCH      ------------EQIVYFNCYTVLSPGD--------------------------------
RPOC1_PYRYE      ------------EKIVYFHSYVVTQSNT--------------------------------
RPOC1_PORPU      ------------EKIVYFHSYVVTQSSE--------------------------------
RPOC1_GRATL      ------------EKIVYFHSYVVINPGN--------------------------------
RPOC1_GUITH      ------------EQVVYFNSYVVTKPGN--------------------------------
RPOC1_RHDSA      ------------EQIVYFNSYIVTRPGN--------------------------------
RPOC1_CYAPA      ------------EQVVYFNAYVVLNPGK--------------------------------
RPOC1_EMIHU      ------------EQIVYFNSYVVTKANK--------------------------------
RPOC1_CYACA      ------------EQVVYFNTYIITHSTAE-------------------------------
RPOC1_THAPS      IKLASLAYFIAEDEIAFYGLHWDLQQYRR-------------------------------
RPOC1_PHATC      IKLASLAYFIAEDEISFYGIHWDLQQYRR-------------------------------
RPOC1_TRICV      IKLASLAYFIAEDEISYYGLHWDLQQYRR-------------------------------
RPOC1_NEPOL      ------------EAITYCTNYASSQDSMAFSASLLFPT----------------------
RPOC1_OSTTA      ------------DETIHFQTYTPSKYGTQNYC----------------------------
RPOC1_PHYPA      --------LFLARPISKKPILLKLR-----------------------------------
RPOC1_MARPO      --------LFLARPITKKPTLLKLQ-----------------------------------
RPOC1_ANTAG      --------LFLARPIAKKPTLLKLR-----------------------------------
RPOC1_ANEMR      --------LFTARPINEKPTLLKLH-----------------------------------
RPOC1_PSINU      ----TYPNLYLARPIAEKPTLLQLK-----------------------------------
RPOC1_ANGEV      ----TYPNLFLARPVAKKPNLLRLR-----------------------------------
RPOC1_ADICA      --------LFLARPVAERPALLRLR-----------------------------------
RPOC1_CUCSA      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_MORIN      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_SOLBU      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_SOLTU      ----P--NFSFARPITKKPTFLRLR-----------------------------------
RPOC1_SOLLC      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_NICSY      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_TOBAC      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_ATRBE      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_NICTO      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_CUSEX      --------FSFARPITNKPTFLRLR-----------------------------------
RPOC1_CUSRE      --------FYFARPITKKPTFLRLR-----------------------------------
RPOC1_IPOPU      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_COFAR      -------NFSFARPITKKPTFLRLR-----------------------------------
RPOC1_JASNU      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_SPIOL      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_SILLA      -------NFSFARPIAKKPTFLRLR-----------------------------------
RPOC1_FAGEA      --------FAFARPIAKKPTFLRLR-----------------------------------
RPOC1_LEPVR      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_CAPBU      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_BARVE      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_NASOF      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_ARATH      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_OLIPU      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_DRANE      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_LOBMA      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_ARAHI      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_SINAL      ----RNPNFSFARPITKKPTFLRLR-----------------------------------
RPOC1_CRUWA      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_AETCO      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_AETGR      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_CARPA      --------FSFARPITKKPTFLRLR-----------------------------------
RPOC1_GOSHI      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_GOSBA      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_POPTR      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_POPAL      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_MANES      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_CITSI      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_VITVI      --------FSFARPIEKKPTFLRLR-----------------------------------
RPOC1_PHAAO      --------FSFARSIAKKPTFLRLR-----------------------------------
RPOC1_DIOEL      --------FSFARPISKKPTFLRLR-----------------------------------
RPOC1_LEMMI      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_ACOAM      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_ACOCL      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_ACOGR      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_NYMAL      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_NUPAD      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_AMBTC      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_ILLOL      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_CHLSC      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_CALFG      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_LIRTU      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_DRIGR      --------FSFARPIVKKPTFLRLR-----------------------------------
RPOC1_CERDE      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_PIPCE      --------FSFARPVAKKPTFLRLR-----------------------------------
RPOC1_NANDO      --------FLFARPVAKKPTFLRLR-----------------------------------
RPOC1_RANMC      --------FSFARPVVKNPTFLRLR-----------------------------------
RPOC1_PLAOC      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_BUXMI      --------FSFARPVAKKPTFLRLR-----------------------------------
RPOC1_OENAR      --------FSFARPVAKKPTFLRLR-----------------------------------
RPOC1_OENBI      --------FSFARPVAKKPTFLRLR-----------------------------------
RPOC1_OENPA      --------FSFARPVAKKPTFLRLR-----------------------------------
RPOC1_OENEH      --------FSFARPVAKKPTFLRLR-----------------------------------
RPOC1_OENGL      --------FSFARPVAKKPTFLRLR-----------------------------------
RPOC1_EUCGG      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_PANGI      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_DAUCA      --------FSFARPIAKKPTFLRLR-----------------------------------
RPOC1_SOYBN      --------FSFARPVVKKPTFLRLR-----------------------------------
RPOC1_PHAVU      --------VSFARPVVKKPTFLRLR-----------------------------------
RPOC1_LOTJA      --------FSFARPVVKKPTFLRLR-----------------------------------
RPOC1_HELAN      --------FYFARPIDKKPTFLRLR-----------------------------------
RPOC1_GUIAB      --------FYFARPIDKKPTFLRLR-----------------------------------
RPOC1_LACSA      --------FYFARPIDKKPTFLRLR-----------------------------------
RPOC1_AGRST      --------FSFARPSTKKPTFLRLR-----------------------------------
RPOC1_BRADI      --------FSFARPSTKKPTFLRLR-----------------------------------
RPOC1_WHEAT      --------FSFARPSTKKPTFLRLR-----------------------------------
RPOC1_HORVU      --------FSFARPSTKKPTFLRLR-----------------------------------
RPOC1_LOLPR      --------FSFARPSTKKPTFLRLR-----------------------------------
RPOC1_ORYNI      --------FSFARPSAKKPTFLRLR-----------------------------------
RPOC1_ORYSA      --------FSFARPSAKKPTFLRLR-----------------------------------
RPOC1_ORYSI      --------FSFARPSAKKPTFLRLR-----------------------------------
RPOC1_ORYSJ      --------FSFARPSAKKPTFLRLR-----------------------------------
RPOC1_SACHY      --------FSFARPSAKKPTFLRLR-----------------------------------
RPOC1_SACOF      --------FSFARPSAKKPTFLRLR-----------------------------------
RPOC1_SORBI      --------FSFARPSAKKPTFLRLR-----------------------------------
RPOC1_MAIZE      --------FSFARPSAKKPTFLRLR-----------------------------------
RPOC1_PELHO      --------FIFAGPLTKKPTLLRLR-----------------------------------
RPOC1_PINKO      --------LFLARPIAKKPTLLRSR-----------------------------------
RPOC1_PINTH      --------LFLARPIANKPTLLRSR-----------------------------------
RPOC1_CYCTA      --------LFIARPIANKPTSLRSR-----------------------------------
RPOC1_WELMI      --------LFITRPAANRPTILRFR-----------------------------------
RPOC1_GNEPA      --------LFLARPAVNKPTILRFR-----------------------------------
RPOC1_CRYJA      --------VCITRPTAKKPTLLRFQ-----------------------------------
RPOC1_HUPLU      --------HFFAGPVTNKPTLFGLKP----------------------------------
RPOC1_CHAGL      --------LFLPRPIIKKPNLLKVK-----------------------------------
RPOC1_STAPU      HFLQTKNISLASRSVTLEKSQEKVNDS---------------------------------
RPOC1_ZYGCR      -----------ARPVTNEPTL---------------------------------------
RPOC1_CHAVU      --------HCLGNPSTNYPTLLFIK-----------------------------------
RPOC1_OEDCA      SFYHNSNFLTFSRRHSGRNLIKKIKESSFLNFQIGVNNINTIFHYKYSFNCLPSCHIPNY
RPOC1_OLTVI      ESA---RNSFVKKKPSKSPTGPSNTSSGDSLGKDGTMDH-----------VSPHKANLWG
RPOC1_TUPAK      AALERQRQSFSLRSYSKSANFRSQTSARGEVGGNFNLEVKQSQNYFLDWKLTNNYRNFYQ
RPOC1_TETOB      IQNLSKKNKSLKKKIFLKKNLFTEQNLISFQNQVQKNKIFSVEPNFSEKIFSTFFSNDFL
RPOC1_BIGNA      EITENLNNTYFKDSINLKYSLHVQKNIISYLKNLKQ------------------------
                                                                             

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      ------------------------------------------------------------
RPOC1_PHATC      ------------------------------------------------------------
RPOC1_TRICV      ------------------------------------------------------------
RPOC1_NEPOL      ------------------------------------------------------------
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ------------------------------------------------------------
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      KCRQKFFIYKNKIENILKLKKFRLFFNIWLSRFLKNNISVLNVVVNLKLNNINSNNLQTL
RPOC1_OLTVI      SSPLKREG-------WVKSAQQTLTQGSQSYPYANGLSFNEGKSKE------------MG
RPOC1_TUPAK      SSEIQNLNCFFISNFLVKNAIPVSPLSLEQFVFNNETQKNLHLGNEDSRFFANLKKPIKK
RPOC1_TETOB      NSNQTFEFNLFNLFFDVSLNFGKILAFLKLYYEIDFCSFVQKHSFDFEKNYSFKNSFSTK
RPOC1_BIGNA      ------------------------------------------------------------
                                                                             

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      ------------------------------------------------------------
RPOC1_PHATC      ------------------------------------------------------------
RPOC1_TRICV      ------------------------------------------------------------
RPOC1_NEPOL      ------------------------------------------------------------
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ------------------------------------------------------------
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      NLLFYQKKWLLKKKQIFYNYAMLKEFHSKLLIVGTLHDFSNFIKLIYSSSYKNETLINIF
RPOC1_OLTVI      VGALRPQGSENSLFGTHDPFDHLSTHQVKS------------------------------
RPOC1_TUPAK      LGLLKNSFLAETLANAKANAHNLKENRTPV------------------------------
RPOC1_TETOB      QFELFSNQSTLVSMYETVFFDYFSFFFHFLKIFKFSNFN---------------------
RPOC1_BIGNA      ------------------------------------------------------------
                                                                             

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      ------------------------------------------------------------
RPOC1_PHATC      ------------------------------------------------------------
RPOC1_TRICV      ------------------------------------------------------------
RPOC1_NEPOL      ------------------------------------------------------------
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ------------------------------------------------------------
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      SIQIQPFYKFNFIQKIRKYLNSEYYNSFDSGRTKHYLRKFLNKDSDNLFFKQFNYVYYFI
RPOC1_OLTVI      ------------------------------------------------------------
RPOC1_TUPAK      ------------------------------------------------------------
RPOC1_TETOB      ------------------------------------------------------------
RPOC1_BIGNA      ------------------------------------------------------------
                                                                             

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      ------------------------------------------------------------
RPOC1_PHATC      ------------------------------------------------------------
RPOC1_TRICV      ------------------------------------------------------------
RPOC1_NEPOL      ------------------------------------------------------------
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ------------------------------------------------------------
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      LFSSIISTQTIERGSLTSLNNQQFFLNLLCFFKLAKKNIFKKYSWLTSIQKYFYSRQIIK
RPOC1_OLTVI      ------------------------------------------------------------
RPOC1_TUPAK      ------------------------------------------------------------
RPOC1_TETOB      ------------------------------------------------------------
RPOC1_BIGNA      ------------------------------------------------------------
                                                                             

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      ------------------------------------------------------------
RPOC1_PHATC      ------------------------------------------------------------
RPOC1_TRICV      ------------------------------------------------------------
RPOC1_NEPOL      ------------------------------------------------------------
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ------------------------------------------------------------
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      YKKKQQQKSMLKFVKKKTFFNKFLDLINSFIYDYQKRLKLLKKHSIIQLILKKKMYIFYF
RPOC1_OLTVI      ------------------------------------------------------------
RPOC1_TUPAK      ------------------------------------------------------------
RPOC1_TETOB      ------------------------------------------------------------
RPOC1_BIGNA      ------------------------------------------------------------
                                                                             

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      ------------------------------------------------------------
RPOC1_PHATC      ------------------------------------------------------------
RPOC1_TRICV      ------------------------------------------------------------
RPOC1_NEPOL      ------------------------------------------------------------
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ------------------------------------------------------------
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      LKKLQNKLINEIQKYYFYEFEKKKFINIEFNLNNFKNIVIFMNLKKKILFLNSVLFQSQT
RPOC1_OLTVI      ------------------------------------------------------------
RPOC1_TUPAK      ------------------------------------------------------------
RPOC1_TETOB      ------------------MSNSVSLEFLNDSEKENIFYSQNFRTQKNFFFSLKALSFLLV
RPOC1_BIGNA      ------------------------------------------------------------
                                                                             

RPOC1_MESVI      ------------------------------------SQFLTENRFFSNS-----------
RPOC1_CHLAT      ------------------------------------ARFIKDKQLLERK-----------
RPOC1_CYAP4      ------------------------------------HESLTYKQLLSED-----------
RPOC1_ACAM1      ------------------------------------ADTLSYKQLLTED-----------
RPOC1_THEEB      ------------------------------------HPGLSYKQLLSED-----------
RPOC1_TRIV2      ------------------------------------AETLTYKQLLSED-----------
RPOC1_NOSS1      ------------------------------------AETLTYKQLLSED-----------
RPOC1_NOSP7      ------------------------------------AETLTYKQLLSED-----------
RPOC1_NOSCO      ------------------------------------AETLTYKQLLSED-----------
RPOC1_SYNE7      ------------------------------------HSELQYKQLLNED-----------
RPOC1_SYNP6      ------------------------------------HSELQYKQLLNED-----------
RPOC1_RIPO1      ------------------------------------ASNLSYKQLLTED-----------
RPOC1_CROS5      ------------------------------------ASNLSYKQLLTED-----------
RPOC1_MICAN      ------------------------------------AGNLSYKQLLSED-----------
RPOC1_SYNY3      ------------------------------------ASNLQYKQLLTED-----------
RPOC1_GLOC7      ------------------------------------SGNLQYKQLLTED-----------
RPOC1_SYNP2      ------------------------------------ATNLSYKQLLTED-----------
RPOC1_TRIEI      ------------------------------------HESLSYKQLLSED-----------
RPOC1_SYNJA      ------------------------------------APNLSYKQLLTED-----------
RPOC1_SYNJB      ------------------------------------AQNLSYKQLLTED-----------
RPOC1_GLOVI      ------------------------------------AENLYYKQLLTED-----------
RPOC1_PROMT      ------------------------------------SKDLKYKQLLTED-----------
RPOC1_PROM1      ------------------------------------SKDLKYKQLLTED-----------
RPOC1_SYNS3      ------------------------------------HKDLKYKQLLTED-----------
RPOC1_SYNPW      ------------------------------------HKDLKYKQLLTED-----------
RPOC1_SYNPX      ------------------------------------HKELKYKQLLTED-----------
RPOC1_SYNS9      ------------------------------------HKDLKYKQLLTED-----------
RPOC1_SYNSC      ------------------------------------HKDLKYKQLLTED-----------
RPOC1_PROMM      ------------------------------------HKELKYKQLLTED-----------
RPOC1_PROM3      ------------------------------------HKELKYKQLLTED-----------
RPOC1_PROMA      ------------------------------------HKDLKYKQLLTED-----------
RPOC1_PROM4      ------------------------------------HKDLKYKQLLTED-----------
RPOC1_SYNR3      ------------------------------------HKTLKYKQLLTED-----------
RPOC1_PROM0      ------------------------------------HKELKYKQLLTED-----------
RPOC1_PROM2      ------------------------------------HKELKYKQLLTED-----------
RPOC1_PROMS      ------------------------------------HKELKYKQLLTED-----------
RPOC1_PROM9      ------------------------------------HKELKYKQLLTED-----------
RPOC1_PROM5      ------------------------------------HKDLKYKQLLTED-----------
RPOC1_PROMP      ------------------------------------HKDLKYKQLLTED-----------
RPOC1_PAUCH      ------------------------------------NSNLFYQQLLTED-----------
RPOC1_PYRYE      ------------------------------------DINLKYKQLLEGY-----------
RPOC1_PORPU      ------------------------------------ETNLKYKQLLEGY-----------
RPOC1_GRATL      ------------------------------------YHKLNYKQLLEGY-----------
RPOC1_GUITH      ------------------------------------CTNLRYKQLLSED-----------
RPOC1_RHDSA      ------------------------------------CPNLRYKQLLSED-----------
RPOC1_CYAPA      ------------------------------------SDLLNYGVILTEDDE---------
RPOC1_EMIHU      ------------------------------------DLNLSYQQLLSEA-----------
RPOC1_CYACA      ------------------------------------NKQIKYKQLLTED-----------
RPOC1_THAPS      ------------------------------------CRELGFTGYPLKPH----------
RPOC1_PHATC      ------------------------------------SRELGYTGYPLKPY----------
RPOC1_TRICV      ------------------------------------SRELGFTAYPLKPE----------
RPOC1_NEPOL      -----------------------------------TGSFRQSKDSMKWEYL---------
RPOC1_OSTTA      -----------------------------------LHGGVQWYVNHWEPMH---------
RPOC1_PHYPA      -------------------------------------GLFKYEDQSW-------------
RPOC1_MARPO      -------------------------------------GLFKYEDQSW-------------
RPOC1_ANTAG      -------------------------------------GLFKYEDQSW-------------
RPOC1_ANEMR      -------------------------------------GLFKYEDQSW-------------
RPOC1_PSINU      -------------------------------------GFFKYEDQSW-------------
RPOC1_ANGEV      -------------------------------------GLCNYDNQSW-------------
RPOC1_ADICA      -------------------------------------GLFNYEDRAW-------------
RPOC1_CUCSA      -------------------------------------GSFEYEIQSW-------------
RPOC1_MORIN      -------------------------------------GSFEYEIQSW-------------
RPOC1_SOLBU      -------------------------------------GLFEYEIQSW-------------
RPOC1_SOLTU      -------------------------------------GLFEYEIQSW-------------
RPOC1_SOLLC      -------------------------------------GLFEYEIQSW-------------
RPOC1_NICSY      -------------------------------------GLFEYEIQSW-------------
RPOC1_TOBAC      -------------------------------------GLFEYEIQSW-------------
RPOC1_ATRBE      -------------------------------------GLFEYEIQSW-------------
RPOC1_NICTO      -------------------------------------GLFEYEIQSW-------------
RPOC1_CUSEX      -------------------------------------GLLKYEIQSW-------------
RPOC1_CUSRE      -------------------------------------GLLKYEIQSW-------------
RPOC1_IPOPU      -------------------------------------GLFEYEIQSW-------------
RPOC1_COFAR      -------------------------------------GSFKYEIQSW-------------
RPOC1_JASNU      -------------------------------------GLFEYEIKSW-------------
RPOC1_SPIOL      -------------------------------------GLFEYEIQSW-------------
RPOC1_SILLA      -------------------------------------GLFEYEIQSW-------------
RPOC1_FAGEA      -------------------------------------GLFEYEIQSW-------------
RPOC1_LEPVR      -------------------------------------GSFEYEIQSW-------------
RPOC1_CAPBU      -------------------------------------GSFEYEIQSW-------------
RPOC1_BARVE      -------------------------------------GSFEYEIQSW-------------
RPOC1_NASOF      -------------------------------------GSFEYEIQSW-------------
RPOC1_ARATH      -------------------------------------GSFEYEIQSW-------------
RPOC1_OLIPU      -------------------------------------GSFEYEIQSW-------------
RPOC1_DRANE      -------------------------------------GSFEYEIQSW-------------
RPOC1_LOBMA      -------------------------------------GSFEYEIQSW-------------
RPOC1_ARAHI      -------------------------------------GSFEYEIQSW-------------
RPOC1_SINAL      -------------------------------------GSFEYEIQSW-------------
RPOC1_CRUWA      -------------------------------------GSFEYEIQSW-------------
RPOC1_AETCO      -------------------------------------GSFEYEIQSW-------------
RPOC1_AETGR      -------------------------------------GSFEYEIQSW-------------
RPOC1_CARPA      -------------------------------------GSFEYEIQSW-------------
RPOC1_GOSHI      -------------------------------------GSFEYEIQSW-------------
RPOC1_GOSBA      -------------------------------------GSFEYEIQSW-------------
RPOC1_POPTR      -------------------------------------GSFEYEIQSW-------------
RPOC1_POPAL      -------------------------------------GSFEYEIQSW-------------
RPOC1_MANES      -------------------------------------GSFEYEIQSW-------------
RPOC1_CITSI      -------------------------------------GSFEYEIQSW-------------
RPOC1_VITVI      -------------------------------------GSFEYEIQSW-------------
RPOC1_PHAAO      -------------------------------------GSFEYEIQSW-------------
RPOC1_DIOEL      -------------------------------------GSFEYEIQSW-------------
RPOC1_LEMMI      -------------------------------------GSFEYEIQSW-------------
RPOC1_ACOAM      -------------------------------------GLFEYEIQSW-------------
RPOC1_ACOCL      -------------------------------------GLFEYEIQSW-------------
RPOC1_ACOGR      -------------------------------------GLFEYEIQSW-------------
RPOC1_NYMAL      -------------------------------------GSFEYEIQSR-------------
RPOC1_NUPAD      -------------------------------------GSFEYEIQSR-------------
RPOC1_AMBTC      -------------------------------------GSFEYEIQSR-------------
RPOC1_ILLOL      -------------------------------------GSFEYEIQSR-------------
RPOC1_CHLSC      -------------------------------------GSFEYEIQSW-------------
RPOC1_CALFG      -------------------------------------GSFESEIQSR-------------
RPOC1_LIRTU      -------------------------------------GSFESEIQSR-------------
RPOC1_DRIGR      -------------------------------------GSFEYEIQSR-------------
RPOC1_CERDE      -------------------------------------GSFEYEIQSR-------------
RPOC1_PIPCE      -------------------------------------GLFEYEIQSR-------------
RPOC1_NANDO      -------------------------------------GSFEYEIQSW-------------
RPOC1_RANMC      -------------------------------------GSFEYEIQSW-------------
RPOC1_PLAOC      -------------------------------------GSFEYEIQSW-------------
RPOC1_BUXMI      -------------------------------------GSFEYEIQSR-------------
RPOC1_OENAR      -------------------------------------GLFEYEIQSW-------------
RPOC1_OENBI      -------------------------------------GLFEYEIQSW-------------
RPOC1_OENPA      -------------------------------------GLFEYEIQSW-------------
RPOC1_OENEH      -------------------------------------GLFEYEIQSW-------------
RPOC1_OENGL      -------------------------------------GLFEYEIQSW-------------
RPOC1_EUCGG      -------------------------------------GLFEYEIQSW-------------
RPOC1_PANGI      -------------------------------------GSFEYEIQSW-------------
RPOC1_DAUCA      -------------------------------------GLFEYEIQSW-------------
RPOC1_SOYBN      -------------------------------------GSFEYEIQSW-------------
RPOC1_PHAVU      -------------------------------------GSFEYEIQSW-------------
RPOC1_LOTJA      -------------------------------------GLFEYEIQSW-------------
RPOC1_HELAN      -------------------------------------GLLEYEIQPW-------------
RPOC1_GUIAB      -------------------------------------GLLEYEIQPW-------------
RPOC1_LACSA      -------------------------------------GLLEYEIQPW-------------
RPOC1_AGRST      -------------------------------------GLFEEEISSC-------------
RPOC1_BRADI      -------------------------------------GLFEEEIASC-------------
RPOC1_WHEAT      -------------------------------------GLFEEEIASC-------------
RPOC1_HORVU      -------------------------------------GLFEEEIASC-------------
RPOC1_LOLPR      -------------------------------------GLFEEEIASC-------------
RPOC1_ORYNI      -------------------------------------GLFEDEISSC-------------
RPOC1_ORYSA      -------------------------------------GLFEDEISSC-------------
RPOC1_ORYSI      -------------------------------------GLFEDEISSC-------------
RPOC1_ORYSJ      -------------------------------------GLFEDEISSC-------------
RPOC1_SACHY      -------------------------------------GLFEDEISSC-------------
RPOC1_SACOF      -------------------------------------GLFEDEISSC-------------
RPOC1_SORBI      -------------------------------------GLFEDEISSC-------------
RPOC1_MAIZE      -------------------------------------GLFEDEISSC-------------
RPOC1_PELHO      -------------------------------------GSFPESKTKFSG-----------
RPOC1_PINKO      -------------------------------------GTFNYEIQSW-------------
RPOC1_PINTH      -------------------------------------GTFDYEIQSW-------------
RPOC1_CYCTA      -------------------------------------GPFKYEIQSW-------------
RPOC1_WELMI      ------------------------------------GLLQDENLPSW-------------
RPOC1_GNEPA      ------------------------------------GLLQHGEITSW-------------
RPOC1_CRYJA      ------------------------------------GLRP-SKYESW-------------
RPOC1_HUPLU      -----------------------------------SSFEYDEEDEFW-------------
RPOC1_CHAGL      -------------------------------------KLFNYDDQLW-------------
RPOC1_STAPU      -------------------------LKLSQRIIIARKRLLRLAAKPILE-----------
RPOC1_ZYGCR      -----------------------------IRLLPTQSKLYKDRSQSTFD-----------
RPOC1_CHAVU      -------------------------------------KYFQYSSLAWL------------
RPOC1_OEDCA      NFFNKHANLNIFNNSYNYMYIDFNNFLSIGQFWQILINIFKNKINKYYL-----------
RPOC1_OLTVI      ------------------------EQN------LFKTPTFDNSKQSNTAENRD-------
RPOC1_TUPAK      ------------------------IQDKENESQTFSQLFFDQIDQKEGSSLKSKDLNFTN
RPOC1_TETOB      GFNYENKQNLLSDPFDSGFEIFPNQNSVFMTQNFFSSKLFFKEKKQKKNNSKKLKKQLEI
RPOC1_BIGNA      -------------------------------------AVFILKTKQDQ------------
                                                                             

RPOC1_MESVI      --------------------------------TD--ILDDLLNIKEK-------------
RPOC1_CHLAT      --------------------------------DRKIIDQSFFSLDEE-------------
RPOC1_CYAP4      --------------------------------QWIEIEDQIYSEDS--------------
RPOC1_ACAM1      --------------------------------QWIEIEDQIYSEDS--------------
RPOC1_THEEB      --------------------------------QWQDIEEEIYREDS--------------
RPOC1_TRIV2      --------------------------------QWLEIEDQIYSEDS--------------
RPOC1_NOSS1      --------------------------------QWLEIEDQIYSEDS--------------
RPOC1_NOSP7      --------------------------------QWLEIEDQIYSEDS--------------
RPOC1_NOSCO      --------------------------------QWLEIEDQIYSEDS--------------
RPOC1_SYNE7      --------------------------------QWMEIEDQIYAEES--------------
RPOC1_SYNP6      --------------------------------QWMEIEDQIYAEES--------------
RPOC1_RIPO1      --------------------------------QWIEIEEQIYAEDS--------------
RPOC1_CROS5      --------------------------------QWIEIEDQIYAEDS--------------
RPOC1_MICAN      --------------------------------QWLEIEEEIYAEDS--------------
RPOC1_SYNY3      --------------------------------QWVEIEDQIYAEDS--------------
RPOC1_GLOC7      --------------------------------QWLEIEEQIYAEDS--------------
RPOC1_SYNP2      --------------------------------QWLEIEEQLYSEDS--------------
RPOC1_TRIEI      --------------------------------VWLEIEDQIYSEDS--------------
RPOC1_SYNJA      --------------------------------QYLEIEDQMYEEGSEL------------
RPOC1_SYNJB      --------------------------------QFLEIEDQMYEEGSEL------------
RPOC1_GLOVI      --------------------------------QYIEVEDQIFAEDSSL------------
RPOC1_PROMT      --------------------------------EWLEIEDEIYAEDST-------------
RPOC1_PROM1      --------------------------------EWLEIEDEIYAEDST-------------
RPOC1_SYNS3      --------------------------------EWLEIEDEIYAEDSE-------------
RPOC1_SYNPW      --------------------------------EWLEIEDEIYAEDSE-------------
RPOC1_SYNPX      --------------------------------EWLEIEDEIYAEESE-------------
RPOC1_SYNS9      --------------------------------EWLEIEDEIYAEESE-------------
RPOC1_SYNSC      --------------------------------EWLEIEDEIYAEDSE-------------
RPOC1_PROMM      --------------------------------EWLEIEDEIYAEDST-------------
RPOC1_PROM3      --------------------------------EWLEIEDEIYAEDST-------------
RPOC1_PROMA      --------------------------------EWLEVEDEIYAEDST-------------
RPOC1_PROM4      --------------------------------EWLEIEDEIYAEDST-------------
RPOC1_SYNR3      --------------------------------EWLEIEDEIYAEDSE-------------
RPOC1_PROM0      --------------------------------EWLEIEDEIYAEDST-------------
RPOC1_PROM2      --------------------------------EWLEIEDEIYAEDSI-------------
RPOC1_PROMS      --------------------------------EWLEIEDEIYAEDST-------------
RPOC1_PROM9      --------------------------------EWLEIEDEIYAEDST-------------
RPOC1_PROM5      --------------------------------EWLEIEDEIYAEDST-------------
RPOC1_PROMP      --------------------------------EWLEIEDEVYAEDST-------------
RPOC1_PAUCH      --------------------------------EWLEIEDETYAEDSK-------------
RPOC1_PYRYE      --------------------------------EWKSLEEEIYQNQDE-------------
RPOC1_PORPU      --------------------------------EWKSLEEEIYQNQDE-------------
RPOC1_GRATL      --------------------------------EWRNLEEKLSSHSSN-------------
RPOC1_GUITH      --------------------------------EWIAIEDQLYQEDSE-------------
RPOC1_RHDSA      --------------------------------EWIEIEDQLYQEDSN-------------
RPOC1_CYAPA      --------------------------------KWPYIEEKLYTKELM-------------
RPOC1_EMIHU      --------------------------------DWLAID---YNDDFS-------------
RPOC1_CYACA      --------------------------------EWVLIEDQIYRNEIQ-------------
RPOC1_THAPS      --------------------------------SKS--RNRRRNTPKYL------------
RPOC1_PHATC      --------------------------------PKP--QNRRYSTPKYL------------
RPOC1_TRICV      --------------------------------PKPKLQNRRYNTPKYL------------
RPOC1_NEPOL      --------------------------------NWFHIETYLGLKEATNSALVHYGK----
RPOC1_OSTTA      --------------------------------PYFAGDIDVSMDKAASWNSKS-------
RPOC1_PHYPA      ----------------------------------REIFPRYFSSR---------------
RPOC1_MARPO      ----------------------------------KDIFPRFFSPR---------------
RPOC1_ANTAG      ----------------------------------KEIFPRFFSPR---------------
RPOC1_ANEMR      ----------------------------------RDVFPRFFSCG---------------
RPOC1_PSINU      ----------------------------------RYLFPRFFSTR---------------
RPOC1_ANGEV      ----------------------------------IKILSRFFSTR---------------
RPOC1_ADICA      ----------------------------------RNILPTFFSTQ---------------
RPOC1_CUCSA      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_MORIN      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_SOLBU      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_SOLTU      ----------------------------------KYSIPLFFTTK---------------
RPOC1_SOLLC      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_NICSY      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_TOBAC      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_ATRBE      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_NICTO      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_CUSEX      ----------------------------------KSSIPLFFTTQ---------------
RPOC1_CUSRE      ----------------------------------KSSIPLFFTTQ---------------
RPOC1_IPOPU      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_COFAR      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_JASNU      ----------------------------------KYSIPLFFTIQ---------------
RPOC1_SPIOL      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_SILLA      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_FAGEA      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_LEPVR      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_CAPBU      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_BARVE      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_NASOF      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_ARATH      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_OLIPU      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_DRANE      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_LOBMA      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_ARAHI      ----------------------------------KYSLPLFFTTQ---------------
RPOC1_SINAL      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_CRUWA      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_AETCO      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_AETGR      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_CARPA      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_GOSHI      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_GOSBA      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_POPTR      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_POPAL      ----------------------------------KYSIPLFLTTQ---------------
RPOC1_MANES      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_CITSI      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_VITVI      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_PHAAO      ----------------------------------QYSIPLFFTTQ---------------
RPOC1_DIOEL      ----------------------------------KYSIPLFFTNQ---------------
RPOC1_LEMMI      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_ACOAM      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_ACOCL      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_ACOGR      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_NYMAL      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_NUPAD      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_AMBTC      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_ILLOL      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_CHLSC      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_CALFG      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_LIRTU      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_DRIGR      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_CERDE      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_PIPCE      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_NANDO      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_RANMC      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_PLAOC      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_BUXMI      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_OENAR      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_OENBI      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_OENPA      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_OENEH      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_OENGL      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_EUCGG      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_PANGI      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_DAUCA      ----------------------------------KYSIPLFFTTQ---------------
RPOC1_SOYBN      ----------------------------------KHSIPLFFTTQ---------------
RPOC1_PHAVU      ----------------------------------KHSIPLFFTTR---------------
RPOC1_LOTJA      ----------------------------------KYSIPLFFATH---------------
RPOC1_HELAN      ----------------------------------KYRIPIFFTTR---------------
RPOC1_GUIAB      ----------------------------------KYRIPIFFTTR---------------
RPOC1_LACSA      ----------------------------------KYRIPIFFTTR---------------
RPOC1_AGRST      ----------------------------------NHSISPFFSTP---------------
RPOC1_BRADI      ----------------------------------NHSISPFFSTP---------------
RPOC1_WHEAT      ----------------------------------NHSISPFFSTP---------------
RPOC1_HORVU      ----------------------------------NHSISPFFSTP---------------
RPOC1_LOLPR      ----------------------------------NHSISPFFSTP---------------
RPOC1_ORYNI      ----------------------------------NHSISPFFSTP---------------
RPOC1_ORYSA      ----------------------------------NHSISPFFSTP---------------
RPOC1_ORYSI      ----------------------------------NHSISPFFSTP---------------
RPOC1_ORYSJ      ----------------------------------NHSISPFFSTP---------------
RPOC1_SACHY      ----------------------------------NHSISPFFSTP---------------
RPOC1_SACOF      ----------------------------------NHSISPFFSTP---------------
RPOC1_SORBI      ----------------------------------NHSISPFFSTP---------------
RPOC1_MAIZE      ----------------------------------NHSISPFFSTP---------------
RPOC1_PELHO      ---------------------------------SRDILSQFLKTK---------------
RPOC1_PINKO      ----------------------------------KDIIPHYLSARPHYLF----------
RPOC1_PINTH      ----------------------------------REIIPHYLSARPYYLF----------
RPOC1_CYCTA      ----------------------------------RDIIPHYFSAR---------------
RPOC1_WELMI      ----------------------------------IGILFPYISS----------------
RPOC1_GNEPA      ----------------------------------MEILVPYISG----------------
RPOC1_CRYJA      ----------------------------------AEKIAYYLS-----------------
RPOC1_HUPLU      ----------------------------------NEIIPCFFYSFSYS------------
RPOC1_CHAGL      ----------------------------------KETLPRFFSTR---------------
RPOC1_STAPU      ---------------------------------PKLICNRFYVPWRIALELFLS------
RPOC1_ZYGCR      ---------------------------------KPLELFLFDEPWQSALSNFFS------
RPOC1_CHAVU      ----------------------------------LHILLCFFSFK---------------
RPOC1_OEDCA      ---------------------------------LSRSLPFIISNDYVKIDPLIKKFHDDL
RPOC1_OLTVI      --------------------------SFSRTSARSWIINNYYSVLQTCRWKSPSD-----
RPOC1_TUPAK      WNNKKITRFIEL-------------LEKTLFLKKPGLVNNYYTISQSLQWPCQKD-----
RPOC1_TETOB      FISNKPLLSRQNFTERKKQIQNKKVQKFFDFDSMTENFECSFSSEKK-------------
RPOC1_BIGNA      -------------------------QLKYNFSYLYYTLNNFYSLSYS-------------
                                                                             

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      ------------------------------------------------------------
RPOC1_PHATC      ------------------------------------------------------------
RPOC1_TRICV      ------------------------------------------------------------
RPOC1_NEPOL      ------------------------------------------------------------
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ------------------------------------------------------------
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      KHQVCFNSFLIKLTFYNSTLLYPLQNIIKNNNKVLQTRQQYYKIIKSNNLFLTNYFKKIR
RPOC1_OLTVI      ------------------------------------------------------------
RPOC1_TUPAK      ------------------------------------------------------------
RPOC1_TETOB      ------------------------------------------------------------
RPOC1_BIGNA      ------------------------------------------------------------
                                                                             

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      ------------------------------------------------------------
RPOC1_PHATC      ------------------------------------------------------------
RPOC1_TRICV      ------------------------------------------------------------
RPOC1_NEPOL      ------------------------------------------------------------
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ------------------------------------------------------------
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      GNFTELSIKKFENIHTIVSCIGYFGYQDILYHQIRELKKNDYFRNFYLKFIKHDLSNNFN
RPOC1_OLTVI      ------------------------------------------------------------
RPOC1_TUPAK      ------------------------------------------------------------
RPOC1_TETOB      ------------------------------------------------------------
RPOC1_BIGNA      ------------------------------------------------------------
                                                                             

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      ------------------------------------------------------------
RPOC1_PHATC      ------------------------------------------------------------
RPOC1_TRICV      ------------------------------------------------------------
RPOC1_NEPOL      ------------------------------------------------------------
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ------------------------------------------------------------
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      EAIFSVISESRISYNDSIFWNNIYSLSNRYSWKSDIELNIFLCYMLSPETPSDILIPLYK
RPOC1_OLTVI      -----------------------------------------------WDLFLFYMTSSVN
RPOC1_TUPAK      -----------------------------------------------WARFLNYMTNTAD
RPOC1_TETOB      -----------------------------------------------------------F
RPOC1_BIGNA      -----------------------------------------------------------F
                                                                             

RPOC1_MESVI      ---------------------EEEISGGEAIYKMLKNFDLK----------ATAQKIRED
RPOC1_CHLAT      ---------------------SELFSGAQAIQTMLSSLDLK----------TTAQNIREE
RPOC1_CYAP4      -----------------QLVDIEVGIGAEAVQRLLQDLELE----------TEAEALRSE
RPOC1_ACAM1      -----------------QLEGIEVGIGAEAVQRLLQDIKLE----------TEAETLRED
RPOC1_THEEB      -----------------ELEGVEVGIGAEAIQRLLRDLDLQ----------AEADQLRQE
RPOC1_TRIV2      -----------------QLQGVEVGIGAEALLRLLADINLE----------QEAESLREE
RPOC1_NOSS1      -----------------QLQGVEVGIGAEALLRLLADINLE----------QEAESLREE
RPOC1_NOSP7      -----------------VLQGVEVGIGAEALLRLLADINLE----------QEAESLREE
RPOC1_NOSCO      -----------------LLQGVEVGIGAEALLRLLADINLE----------QEAESLREE
RPOC1_SYNE7      -----------------DLEGIEVGIGAEALQQLLQDLNLN----------EESEKLRQE
RPOC1_SYNP6      -----------------DLEGIEVGIGAEALQQLLQDLNLN----------EESEKLRQE
RPOC1_RIPO1      -----------------ELYGIEVGIGAEAIQRLLQEINLE----------EVAEKLREE
RPOC1_CROS5      -----------------DLYGIEVGIGAEAIQRLLQEMNLE----------EIAEILREE
RPOC1_MICAN      -----------------ELVGIEVGIGAEAIQRLLQEINLE----------EEAERLRTE
RPOC1_SYNY3      -----------------ELEGIEVGIGAEAVQRLLAELQLE----------EVAEKLREE
RPOC1_GLOC7      -----------------ELYGIEVGIGAEAIERLLQELNLD----------EEAEKLREE
RPOC1_SYNP2      -----------------QLEDVEVGIGAEAIERLLQELELE----------AVAEELREG
RPOC1_TRIEI      -----------------EIVGVDVGIGAEALQVLLANLDLE----------VEAEKLREE
RPOC1_SYNJA      -----------------QLPENWAMIGAEAIERLLKDIDLE----------KEAEQLREE
RPOC1_SYNJB      -----------------QLPENWAMIGAEAIERLLKDIDLE----------KEAEQLREE
RPOC1_GLOVI      -----------------ELPEGWAKMGAEAIHELLAAIEME----------SEAERLRAD
RPOC1_PROMT      -----------------IENEPIVGIGAEALKQLLEDLNLK----------EVAEQLRED
RPOC1_PROM1      -----------------IENEPIVGIGAEALKQLLEDLNLK----------EVAEQLRED
RPOC1_SYNS3      -----------------IENEPVVGIGAEALKQLLEDLQLN----------AVAEQLREE
RPOC1_SYNPW      -----------------IENEPVVGIGAEALKQLLEDLTLD----------EVAEQLREE
RPOC1_SYNPX      -----------------IENEPVVGIGAEALKQLLEDLNLE----------EVAEQLREE
RPOC1_SYNS9      -----------------IENEPVVGIGAEALKQLLEDLSLE----------EVAQQLRED
RPOC1_SYNSC      -----------------IENEPVVGIGAEALKQLLEDLTLD----------EVAEQLREE
RPOC1_PROMM      -----------------IENEPMVGIGAEALKQLLEDLDLP----------DVAEQLREE
RPOC1_PROM3      -----------------IENEPIVGIGAEALKQLLEDLNLA----------EVAEQLRED
RPOC1_PROMA      -----------------IENEPVVGIGAEALKQLLEDLDLQ----------EVAEQLREE
RPOC1_PROM4      -----------------IENEPVVGIGAEALQQLLEDLDLK----------EIAETLREE
RPOC1_SYNR3      -----------------IETEPEVGIGAEALKALLEDLELT----------EIAEQLRED
RPOC1_PROM0      -----------------IENEPFVGIGAEALKQLLEDLDLN----------QVAEELREE
RPOC1_PROM2      -----------------IENEPIVGIGAEALKQLLEDLDLN----------QVAEELREE
RPOC1_PROMS      -----------------IENEPFVGIGAEALKQLLEDLDLH----------QIAEELREE
RPOC1_PROM9      -----------------IENEPFVGIGAEALKQLLEDLDLN----------QIAEELREE
RPOC1_PROM5      -----------------IENEPFVGIGAEALKQLLEDLDLN----------QIAEELREE
RPOC1_PROMP      -----------------IENEPVVGIGAEALKQLLEDLDLN----------QIAEELREE
RPOC1_PAUCH      -----------------IISEPIVGIGAEALKYLLKELDLP----------FIGDGLRQE
RPOC1_PYRYE      ------------------NNQVEVGIGAEAIQKLLKDLDLE----------HIAETLRSE
RPOC1_PORPU      ------------------NNQIEVGIGAEAIQKLLKDLDLE----------YIAETLRLE
RPOC1_GRATL      ------------------IFGIEVGIGAEAIYKLLDNINLQ----------NTVEILREE
RPOC1_GUITH      ------------------LTGVEVGIGAEAIQKLLRDIDLE----------VEAESLREE
RPOC1_RHDSA      ------------------LYGVEVGIGAEAIQKLLKDVDLE----------VEAESLRED
RPOC1_CYAPA      --------------------DVELGIGAEAIQRLLSDLDLQ----------AEAKTIREI
RPOC1_EMIHU      ------------------LKENTISIGAEAIKTLLKNVDLQ----------QSASEIREL
RPOC1_CYACA      -------------------GEIEIGIGASAILKMLKDLDLS----------LESDLLRTK
RPOC1_THAPS      -----------------LRSTPNYLIGAVLIKRELEKLNLD----------QEIIKTRNF
RPOC1_PHATC      -----------------LRATPNFLIGAPLIKRELEKLNLK----------SEIFRMRYF
RPOC1_TRICV      -----------------LRMTPTYLIGAVLIKKELEDLDII----------KEIQRTRKF
RPOC1_NEPOL      ----RIQDSPIEVGLPLSEDPRQFSIGAQAIACQLRALNLR----------SVSRLLSRD
RPOC1_OSTTA      -------------TFMPSQIKTIENCGGEALQELLTRLDLV----------FLQRMLSRK
RPOC1_PHYPA      ----GFEAFQNK----------EIATGGDAIKKQLSNLDLQ-------GVLDYAYIEWKE
RPOC1_MARPO      ----GFEVFQNR----------EIATGGDAIQKQLTNLNLQ-------NVINLAHLEWKE
RPOC1_ANTAG      ----GFEAFQDR----------EVATGGNAIEKGLASLNLQ-------IVMDRAYMEWRN
RPOC1_ANEMR      ----GFEIFRDR----------EIATGGDAIKKQLIDLDLQ-------SVMSHAHSEWEE
RPOC1_PSINU      ----GFEAFKSR----------EIATGGDAVRKELASLNLK-------TVMECTYLEWKD
RPOC1_ANGEV      ----GFEIFQGR----------EIATGGHAIKKQLASLDLK-------SVFNSAYLEWKE
RPOC1_ADICA      ----NYEMLRKN----------EIVTGGDAIREGLASLDLQ-------SFLNCAYLEWQA
RPOC1_CUCSA      ----GFDTFRNR----------EISTGAGAIREQLADLDLR-------LIIDYSLVEWKE
RPOC1_MORIN      ----GFDAFRNR----------EISTGAGAIREQLADLDLP-------IIIDYSLVEWKE
RPOC1_SOLBU      ----GFDTFRNR----------EISTGAGAIREQLADLDLR-------IIIENSLVEWEE
RPOC1_SOLTU      ----GFDTFRNR----------EIYTGAGAIREQLADLDLR-------IIIENSLVEWEE
RPOC1_SOLLC      ----GFDTFRNR----------EISTGAGAIREQLADLDLR-------IIIENSLVEWEE
RPOC1_NICSY      ----GFDTFRNR----------EISTGAGAIREQLADLDLR-------IIIENSLVEWEE
RPOC1_TOBAC      ----GFDTFRNR----------EISTGAGAIREQLADLDLR-------IIIENSLVEWEE
RPOC1_ATRBE      ----GFDTFRNR----------EISTGAGAIREQLADLDLR-------IIIENSLVEWEE
RPOC1_NICTO      ----GFDTFRNR----------EISTGAGAIREQLADLDLR-------IIIENSLVEWEE
RPOC1_CUSEX      ----GFDTFRNR----------EISTGAGAIREQLADLDLR-------ILLENSLLEWKD
RPOC1_CUSRE      ----GFDTFRNR----------EISTGAGAIREQLADLDLK-------ISLENSLLEWKY
RPOC1_IPOPU      ----GFDTFRNR----------EISTGAGAIREQLADLDLR-------IIIENSLLEWKD
RPOC1_COFAR      ----GFDTFRNR----------EISTGAVAIREQLADLDLR-------IILENSLVEWKE
RPOC1_JASNU      ----GFDTFRNR----------EISTGAGAIREQLVDLDLR-------IILDNSLVEWKE
RPOC1_SPIOL      ----GFDTFRNR----------EISTGAGAIREQLADLDLR-------TIIDYSFAEWKE
RPOC1_SILLA      ----GFDAFRNR----------EISTGAGAIREQLADLDLR-------TIIDYSFAEWKE
RPOC1_FAGEA      ----GFDTFRNR----------EISTGASTIREQLADLDLR-------TILDSSLSEWKE
RPOC1_LEPVR      ----GFDIFRNR----------EISTGAGAIREQLADLDLR-------IIIENSLVEWKQ
RPOC1_CAPBU      ----GFDIFRNR----------EISTGAGAIREQLADLDLR-------IIIENSLVEWKQ
RPOC1_BARVE      ----GFDIFRNR----------EISTGAGAIREQLADLDLR-------IIIENSLVEWKQ
RPOC1_NASOF      ----GFDIFRNR----------EISTGASAIREQLADLDLR-------IIIENSLVEWKQ
RPOC1_ARATH      ----GFDIFRNR----------EISTGAGAIREQLADLDLR-------IIIENSLVEWKQ
RPOC1_OLIPU      ----GFDIFRNR----------EISTGAGAIREQLADLDLR-------IIIENSLVEWKQ
RPOC1_DRANE      ----GFDIFRNR----------EISTGAGAIREQLADLDLR-------IIIENSLVEWKQ
RPOC1_LOBMA      ----GFDIFRNR----------EISTGAGAIREQLADLDLR-------IIIENSLVEWKQ
RPOC1_ARAHI      ----GFDIFRNR----------EISTGAGAIREQLADLDLR-------IIIENSLVEWKQ
RPOC1_SINAL      ----GFEIFRNR----------EISTGAGAIREQLADLDLR-------IIIENSLVEWKQ
RPOC1_CRUWA      ----GFDIFRNR----------EISTGAGAIRDQLADLDLR-------IIIENSLVEWKQ
RPOC1_AETCO      ----GFDIFRNR----------EISTGAGAIREQLADLDLR-------IIIENSLVEWKQ
RPOC1_AETGR      ----GFDIFRNR----------EISTGAGAIREQLADLDLR-------IIIENSLVEWKL
RPOC1_CARPA      ----GFDTFRNR----------EISTGAGAIREQLADLDLQ-------IIIDYSFLEWKE
RPOC1_GOSHI      ----GFDTFRSR----------EISTGAGAIREQLADLDLR-------ILIDYSVVEWKE
RPOC1_GOSBA      ----GFDTFRSR----------EISTGAGAIREQLADLDLR-------ILIDYSVVEWKE
RPOC1_POPTR      ----GFDTFRNR----------EISTGAGAIRELLADLDLR-------IILDYSSLEWKE
RPOC1_POPAL      ----GFDTFRNR----------EISTGAGAIRELLADLDLR-------IILDYSSLEWKE
RPOC1_MANES      ----CFDTFRNR----------EISTGAGAIREQLADLDLR-------IIIDYSSVEWKE
RPOC1_CITSI      ----GFDKFRNR----------EISTGAVAIREQLADLDLR-------IILDNSLLEWKE
RPOC1_VITVI      ----GFDTFRNR----------EISTGAGAIREQLDDLDLR-------IIIDYSLVEWKE
RPOC1_PHAAO      ----GFETFRNR----------EISTGAGAIREQLADSDLR-------IITDNSLLEWKE
RPOC1_DIOEL      ----SFETFRNR----------EISTGAGAIREQLADSDLQ-------IILNNSLVEWKE
RPOC1_LEMMI      ----GFETFRNR----------EISTGAGAIREQLADLDLR-------IITDNSLIEWKE
RPOC1_ACOAM      ----GFDTFRNR----------EISTGAGAIREQLADLDLR-------IVIDNSSVEWKD
RPOC1_ACOCL      ----GFDTFRNR----------EISTGAGAIREQLADLDLR-------IVIDNSSVEWKD
RPOC1_ACOGR      ----GFDTFRNR----------EISTGAGAIREQLADLDLR-------IVIDNSSVEWKE
RPOC1_NYMAL      ----GFDTFRNR----------EISTGATAIREQLADLDLR-------IIIDRSLVEWKE
RPOC1_NUPAD      ----GFDTFRNR----------EISTGATAIREQLADPDLR-------IIIDRSLVEWKE
RPOC1_AMBTC      ----CFNLFRNR----------EISTGAGAIREQLADPDLR-------IITDRSLVEWKE
RPOC1_ILLOL      ----GFDTFRNR----------EISTGASAIREQLADPDLR-------IIMDRSLVEWKE
RPOC1_CHLSC      ----GFDTFRNR----------EISTGAGAIREQLADPDLR-------TITDHSLVEWKE
RPOC1_CALFG      ----GFDTFRNR----------EISTGASAIREQLADPDLR-------IITDHSLVEWKE
RPOC1_LIRTU      ----DFDTFRNR----------EISTGAGAIKEQLADPDLR-------IITDHSLVEWKE
RPOC1_DRIGR      ----GFDTFRNR----------EISTGASAIREQLADPDLR-------IITDHSLVEWKE
RPOC1_CERDE      ----GFDTFRNR----------EIATGAGAIREQLADLDLR-------IIIDHSLVEWKE
RPOC1_PIPCE      ----GFDTFRNR----------EISTGASAIREQLADLDLR-------IIIDRSLVEWKE
RPOC1_NANDO      ----GFDTFRNR----------EISTGAGAIREQLADLDLR-------LITDSSLVEWKE
RPOC1_RANMC      ----GFDTFRNR----------EISTGASAIREQLADLDLR-------LIIDCSLLEWKE
RPOC1_PLAOC      ----GFDTFRNR----------EISTGAGAIREQLADLDLR-------IITAYSLVEWKE
RPOC1_BUXMI      ----GFDTFRNR----------EISTGAGAIREQLADPDLR-------IITDYSLGEWKE
RPOC1_OENAR      ----GFDTFRNR----------EISTGAGAIREQLAGLDLR-------VIIDYSLVEWKE
RPOC1_OENBI      ----GFDTFRNR----------EISTGAGAIREQLAGLDLR-------VIIDYSLVEWKE
RPOC1_OENPA      ----GFDTFRNR----------EISTGAGAIREQLAGLDLR-------VIIDYSLVEWKE
RPOC1_OENEH      ----GFDTFRNR----------EISTGAGAIREQLAGLDLR-------VIIDYSLVEWKE
RPOC1_OENGL      ----GFDTFRNR----------EISTGAGAIREQLAGLDLR-------VIIDYSLVEWKE
RPOC1_EUCGG      ----GFDTFRNR----------EISTGAGAIREQLADLDLR-------IIIDYSLVEWKE
RPOC1_PANGI      ----GFDTFRNR----------EISTGAGAIREQLADLDLR-------IIIDSSLVEWKE
RPOC1_DAUCA      ----GFDTFRNR----------EISTGAGAIREQLADLDLR-------IIIDSSLVEWKE
RPOC1_SOYBN      ----GFDIFRNR----------EISSGAGAIREQLADLDLR-------ILMDSSLIEWKE
RPOC1_PHAVU      ----GFDIFRNR----------EISSGAVAIREQLADLDLR-------IIMDYSLIEWKE
RPOC1_LOTJA      ----GFDTFRNR----------EISSGAGAIREQLVDLDLR-------IVIDSSLVEWKE
RPOC1_HELAN      ----SFDTFRNR----------EMSTGGGSIRQQLANLDLR-------MIIDYSLVEWKE
RPOC1_GUIAB      ----SFDTFRNR----------EMSTGGGSIRQQLANLDLR-------MIIDYSLVEWKE
RPOC1_LACSA      ----SFDTFRNR----------EMSTGGGSIRQQLANLDLR-------IIIDYSLVEWKE
RPOC1_AGRST      ----GFATFRNR----------EIATGAGAIREQLADLDLR-------IIIENSLVEWKE
RPOC1_BRADI      ----SFTTFRNR----------EIATGAGAIREQLADLDLQ-------IIIENSLVEWKE
RPOC1_WHEAT      ----GFATFRNR----------EIATGAGAIREQLADLDLR-------IIIENSLVEWKE
RPOC1_HORVU      ----GFATFRNR----------EIATGAGAIREQLADLDLR-------IIIENSLVEWKE
RPOC1_LOLPR      ----GFATFRNR----------EIATGAGAIREQLADLDLR-------IIIENSLVEWKE
RPOC1_ORYNI      ----GFTTFRNR----------EIATGAGAIREQLADLDLR-------IILENSSVEWKE
RPOC1_ORYSA      ----GFTTFRNR----------EIATGAGAIREQLADLDLR-------IILENSSVEWKE
RPOC1_ORYSI      ----GFTTFRNR----------EIATGAGAIREQLADLDLR-------IILENSSVEWKE
RPOC1_ORYSJ      ----GFTTFRNR----------EIATGAGAIREQLADLDLR-------IILENSSVEWKE
RPOC1_SACHY      ----GFATFRNR----------EIATGAGAIREQLADLDLR-------IIIENSLVEWKE
RPOC1_SACOF      ----GFATFRNR----------EIATGAGAIREQLADLDLR-------IIIENSLVEWKE
RPOC1_SORBI      ----GFATFRNR----------EIATGAGAIREQLADLDLR-------IIIENSLVEWKE
RPOC1_MAIZE      ----GFATFRNR----------EIATGAGAIREQLADLDLR-------IIIENSLVEWKE
RPOC1_PELHO      ----SFQKLRDR----------EFSAGAGAIRKRLANLDLE-------VIIYSSLAEWKK
RPOC1_PINKO      --ARGSGTFKER----------EIATGGDAIGEQLTGLDLQ-------MIIDRSHMEWKN
RPOC1_PINTH      --PRGSGTFKER----------EIATGGDAIGKQLMGLDLQ-------MIIDRSHMEWKN
RPOC1_CYCTA      ----GFGAFRHR----------EIATGGDAIREQLAGLNLQ-------ILMDRSYMEWKR
RPOC1_WELMI      ---WNFVEFQER----------ELATGGNAIQKRLTGLDLR-------ILLTHSYMEWKK
RPOC1_GNEPA      ---WNFVEFQER----------ELATGGTSIQKQLIGLNLR-------ALLNHSYMEWRK
RPOC1_CRYJA      ---WDFGLVQER----------EIATGGKAIREQLAGLDLQ-------MIIDRSYIEWKE
RPOC1_HUPLU      ---PEFNEFMGR----------EMATGGDAIQKLLANLKLK-------DIKDGIHREWKF
RPOC1_CHAGL      ----SFESFQNR----------EMATGGDAIHKRLSSLNLQ-------KLIFQSYNEWEK
RPOC1_STAPU      ---KWYRDCESR----------EIITGGYGIQRMLINLNLQ-------NKLVSLQKNWER
RPOC1_ZYGCR      --PKWFHLIQIR----------EMLTGADVIHKLLSGLNLT-------NAMFHARNQWKH
RPOC1_CHAVU      ----GFEALEDR----------EIATGGDAIKRLLSELDLQ-------NTIDESRKACEE
RPOC1_OEDCA      QRIHSSNVLREE----------PPIAGGGIILKLLKELDLP-------EMKKIDIQLQTI
RPOC1_OLTVI      SLDKPIPCYQNRIYDSSGLPFDFPISGGAAIRNLLLNFDPV--REDLSLIARQIENQSAK
RPOC1_TUPAK      KTDSLIPSYLER-----GISFDLVLTGAGSIKKLLSLFTPMGKKASIEIVAKQINGTLLK
RPOC1_TETOB      KLFQKKVSNSSLQLTQIQKKFKEPFLYKFIKQKNQKKKKFNNFHVFLSTKANSNLFFFEK
RPOC1_BIGNA      QWEAKKQWNTIIWFFKYKQRMKENFIKIDPLQKKLNDEYFEKTFLFGTSILYCWLKYFDY
                                                                             

RPOC1_MESVI      LAENEAAWTQS-------------------------------------------------
RPOC1_CHLAT      LAATE-------------------------------------------------------
RPOC1_CYAP4      IDVSK-------------------------------------------------------
RPOC1_ACAM1      IGNAK-------------------------------------------------------
RPOC1_THEEB      ILNSK-------------------------------------------------------
RPOC1_TRIV2      IGSAK-------------------------------------------------------
RPOC1_NOSS1      IGSAK-------------------------------------------------------
RPOC1_NOSP7      IGNAK-------------------------------------------------------
RPOC1_NOSCO      IGNAK-------------------------------------------------------
RPOC1_SYNE7      IAESK-------------------------------------------------------
RPOC1_SYNP6      IAESK-------------------------------------------------------
RPOC1_RIPO1      ILESK-------------------------------------------------------
RPOC1_CROS5      IAQSK-------------------------------------------------------
RPOC1_MICAN      IVESK-------------------------------------------------------
RPOC1_SYNY3      ILASK-------------------------------------------------------
RPOC1_GLOC7      IIESK-------------------------------------------------------
RPOC1_SYNP2      IANSK-------------------------------------------------------
RPOC1_TRIEI      IANSK-------------------------------------------------------
RPOC1_SYNJA      IASAR-------------------------------------------------------
RPOC1_SYNJB      ITSAR-------------------------------------------------------
RPOC1_GLOVI      LGESK-------------------------------------------------------
RPOC1_PROMT      IATSK-------------------------------------------------------
RPOC1_PROM1      IATSK-------------------------------------------------------
RPOC1_SYNS3      IAGSK-------------------------------------------------------
RPOC1_SYNPW      IAGSK-------------------------------------------------------
RPOC1_SYNPX      INGSK-------------------------------------------------------
RPOC1_SYNS9      INGSK-------------------------------------------------------
RPOC1_SYNSC      INGSK-------------------------------------------------------
RPOC1_PROMM      ISSSK-------------------------------------------------------
RPOC1_PROM3      ISSSK-------------------------------------------------------
RPOC1_PROMA      ITGSK-------------------------------------------------------
RPOC1_PROM4      ITGSK-------------------------------------------------------
RPOC1_SYNR3      ISGSK-------------------------------------------------------
RPOC1_PROM0      ITNSK-------------------------------------------------------
RPOC1_PROM2      ITNSK-------------------------------------------------------
RPOC1_PROMS      ITNSK-------------------------------------------------------
RPOC1_PROM9      ITQSK-------------------------------------------------------
RPOC1_PROM5      ITNSK-------------------------------------------------------
RPOC1_PROMP      ITNSK-------------------------------------------------------
RPOC1_PAUCH      ITGSK-------------------------------------------------------
RPOC1_PYRYE      ATNPPK------------------------------------------------------
RPOC1_PORPU      ATNPPK------------------------------------------------------
RPOC1_GRATL      SLRPPK------------------------------------------------------
RPOC1_GUITH      ILVVK-------------------------------------------------------
RPOC1_RHDSA      VLSAK-------------------------------------------------------
RPOC1_CYAPA      LISNSD------------------------------------------------------
RPOC1_EMIHU      LPFAK-------------------------------------------------------
RPOC1_CYACA      LVNLK-------------------------------------------------------
RPOC1_THAPS      IMLCSKVLH---------------------------------------------------
RPOC1_PHATC      ILVCTKVLN---------------------------------------------------
RPOC1_TRICV      IVICSKILH---------------------------------------------------
RPOC1_NEPOL      LYIIDARETRF-------------------------------------------------
RPOC1_OSTTA      LKNTIEKKK---------------------------------------------------
RPOC1_PHYPA      LVEQK-------------------------------------------------------
RPOC1_MARPO      FAEQK-------------------------------------------------------
RPOC1_ANTAG      LTEQK-------------------------------------------------------
RPOC1_ANEMR      LTKQE-------------------------------------------------------
RPOC1_PSINU      LAKQK-------------------------------------------------------
RPOC1_ANGEV      LSEVE-------------------------------------------------------
RPOC1_ADICA      SVKQK-------------------------------------------------------
RPOC1_CUCSA      LGEEG-------------------------------------------------------
RPOC1_MORIN      LGEER-------------------------------------------------------
RPOC1_SOLBU      LGEEG-------------------------------------------------------
RPOC1_SOLTU      LGEEG-------------------------------------------------------
RPOC1_SOLLC      LGEEG-------------------------------------------------------
RPOC1_NICSY      LGEEG-------------------------------------------------------
RPOC1_TOBAC      LGEEG-------------------------------------------------------
RPOC1_ATRBE      LGEEG-------------------------------------------------------
RPOC1_NICTO      LGEEG-------------------------------------------------------
RPOC1_CUSEX      LGEEE-------------------------------------------------------
RPOC1_CUSRE      LGEEE-------------------------------------------------------
RPOC1_IPOPU      LGEEE-------------------------------------------------------
RPOC1_COFAR      LGEEG-------------------------------------------------------
RPOC1_JASNU      LGEEG-------------------------------------------------------
RPOC1_SPIOL      LGEEG-------------------------------------------------------
RPOC1_SILLA      LGEED-------------------------------------------------------
RPOC1_FAGEA      ----G-------------------------------------------------------
RPOC1_LEPVR      LGEEG-------------------------------------------------------
RPOC1_CAPBU      LGEEG-------------------------------------------------------
RPOC1_BARVE      LGEEG-------------------------------------------------------
RPOC1_NASOF      LGEEG-------------------------------------------------------
RPOC1_ARATH      LGEEG-------------------------------------------------------
RPOC1_OLIPU      LGEEG-------------------------------------------------------
RPOC1_DRANE      LGEEG-------------------------------------------------------
RPOC1_LOBMA      LGEEG-------------------------------------------------------
RPOC1_ARAHI      LGEEG-------------------------------------------------------
RPOC1_SINAL      LGEEG-------------------------------------------------------
RPOC1_CRUWA      LGEEG-------------------------------------------------------
RPOC1_AETCO      LGEEG-------------------------------------------------------
RPOC1_AETGR      LGEEG-------------------------------------------------------
RPOC1_CARPA      LGEEG-------------------------------------------------------
RPOC1_GOSHI      LGEEG-------------------------------------------------------
RPOC1_GOSBA      LGEEG-------------------------------------------------------
RPOC1_POPTR      LGEEG-------------------------------------------------------
RPOC1_POPAL      LGEEG-------------------------------------------------------
RPOC1_MANES      LGEEG-------------------------------------------------------
RPOC1_CITSI      LGEEG-------------------------------------------------------
RPOC1_VITVI      LGEEG-------------------------------------------------------
RPOC1_PHAAO      LGDEE-------------------------------------------------------
RPOC1_DIOEL      LGDEEV------------------------------------------------------
RPOC1_LEMMI      LGDEG-------------------------------------------------------
RPOC1_ACOAM      LGDEG-------------------------------------------------------
RPOC1_ACOCL      LGDEG-------------------------------------------------------
RPOC1_ACOGR      LGDEG-------------------------------------------------------
RPOC1_NYMAL      LGEEG-------------------------------------------------------
RPOC1_NUPAD      LGEEG-------------------------------------------------------
RPOC1_AMBTC      LGEER-------------------------------------------------------
RPOC1_ILLOL      LGEEG-------------------------------------------------------
RPOC1_CHLSC      LGEKG-------------------------------------------------------
RPOC1_CALFG      LGEEG-------------------------------------------------------
RPOC1_LIRTU      LGEEG-------------------------------------------------------
RPOC1_DRIGR      LGEEG-------------------------------------------------------
RPOC1_CERDE      LGEEG-------------------------------------------------------
RPOC1_PIPCE      LGEEG-------------------------------------------------------
RPOC1_NANDO      LGEEG-------------------------------------------------------
RPOC1_RANMC      LGEEG-------------------------------------------------------
RPOC1_PLAOC      LGEEG-------------------------------------------------------
RPOC1_BUXMI      LGEEG-------------------------------------------------------
RPOC1_OENAR      LGEER-------------------------------------------------------
RPOC1_OENBI      LGEER-------------------------------------------------------
RPOC1_OENPA      LGEER-------------------------------------------------------
RPOC1_OENEH      LGEER-------------------------------------------------------
RPOC1_OENGL      LGEER-------------------------------------------------------
RPOC1_EUCGG      LGEER-------------------------------------------------------
RPOC1_PANGI      LGEDG-------------------------------------------------------
RPOC1_DAUCA      LGEDG-------------------------------------------------------
RPOC1_SOYBN      LGEEGS------------------------------------------------------
RPOC1_PHAVU      LGKEGS------------------------------------------------------
RPOC1_LOTJA      LGEERS------------------------------------------------------
RPOC1_HELAN      LEEEE-------------------------------------------------------
RPOC1_GUIAB      LEEEE-------------------------------------------------------
RPOC1_LACSA      LEEEE-------------------------------------------------------
RPOC1_AGRST      LEDEG-------------------------------------------------------
RPOC1_BRADI      LEDEG-------------------------------------------------------
RPOC1_WHEAT      LEDEG-------------------------------------------------------
RPOC1_HORVU      LEDEG-------------------------------------------------------
RPOC1_LOLPR      LEDEG-------------------------------------------------------
RPOC1_ORYNI      LEDEG-------------------------------------------------------
RPOC1_ORYSA      LEDEG-------------------------------------------------------
RPOC1_ORYSI      LEDEG-------------------------------------------------------
RPOC1_ORYSJ      LEDEG-------------------------------------------------------
RPOC1_SACHY      LEDEG-------------------------------------------------------
RPOC1_SACOF      LEDEG-------------------------------------------------------
RPOC1_SORBI      LEDEG-------------------------------------------------------
RPOC1_MAIZE      LEDEG-------------------------------------------------------
RPOC1_PELHO      RKEQKAEIEIK-------------------------------------------------
RPOC1_PINKO      LVELKWNRLEE-------------------------------------------------
RPOC1_PINTH      LVELKWNRLEE-------------------------------------------------
RPOC1_CYCTA      LGK---------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      IDEVISILFSE-------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      LSLQR-------------------------------------------------------
RPOC1_STAPU      LVEQTEKMWF--------------------------------------------------
RPOC1_ZYGCR      LAKKAPESQSE-------------------------------------------------
RPOC1_CHAVU      LAYFD-------------------------------------------------------
RPOC1_OEDCA      LKKIPNKLHEI-------------------------------------------------
RPOC1_OLTVI      YNQEIRVLEQL-------------------------------------------------
RPOC1_TUPAK      LNRDIKRLEDF-------------------------------------------------
RPOC1_TETOB      KQKQQIQEKFQKMEKNHFLQNSILTIAYNYLWNNDADWKYFIYYNSLFFYEFEDHPIFLY
RPOC1_BIGNA      NFQ---------------------------------------------------------
                                                                             

RPOC1_MESVI      ------------------------------------------------------------
RPOC1_CHLAT      ------------------------------------------------------------
RPOC1_CYAP4      ------------------------------------------------------------
RPOC1_ACAM1      ------------------------------------------------------------
RPOC1_THEEB      ------------------------------------------------------------
RPOC1_TRIV2      ------------------------------------------------------------
RPOC1_NOSS1      ------------------------------------------------------------
RPOC1_NOSP7      ------------------------------------------------------------
RPOC1_NOSCO      ------------------------------------------------------------
RPOC1_SYNE7      ------------------------------------------------------------
RPOC1_SYNP6      ------------------------------------------------------------
RPOC1_RIPO1      ------------------------------------------------------------
RPOC1_CROS5      ------------------------------------------------------------
RPOC1_MICAN      ------------------------------------------------------------
RPOC1_SYNY3      ------------------------------------------------------------
RPOC1_GLOC7      ------------------------------------------------------------
RPOC1_SYNP2      ------------------------------------------------------------
RPOC1_TRIEI      ------------------------------------------------------------
RPOC1_SYNJA      ------------------------------------------------------------
RPOC1_SYNJB      ------------------------------------------------------------
RPOC1_GLOVI      ------------------------------------------------------------
RPOC1_PROMT      ------------------------------------------------------------
RPOC1_PROM1      ------------------------------------------------------------
RPOC1_SYNS3      ------------------------------------------------------------
RPOC1_SYNPW      ------------------------------------------------------------
RPOC1_SYNPX      ------------------------------------------------------------
RPOC1_SYNS9      ------------------------------------------------------------
RPOC1_SYNSC      ------------------------------------------------------------
RPOC1_PROMM      ------------------------------------------------------------
RPOC1_PROM3      ------------------------------------------------------------
RPOC1_PROMA      ------------------------------------------------------------
RPOC1_PROM4      ------------------------------------------------------------
RPOC1_SYNR3      ------------------------------------------------------------
RPOC1_PROM0      ------------------------------------------------------------
RPOC1_PROM2      ------------------------------------------------------------
RPOC1_PROMS      ------------------------------------------------------------
RPOC1_PROM9      ------------------------------------------------------------
RPOC1_PROM5      ------------------------------------------------------------
RPOC1_PROMP      ------------------------------------------------------------
RPOC1_PAUCH      ------------------------------------------------------------
RPOC1_PYRYE      ------------------------------------------------------------
RPOC1_PORPU      ------------------------------------------------------------
RPOC1_GRATL      ------------------------------------------------------------
RPOC1_GUITH      ------------------------------------------------------------
RPOC1_RHDSA      ------------------------------------------------------------
RPOC1_CYAPA      ------------------------------------------------------------
RPOC1_EMIHU      ------------------------------------------------------------
RPOC1_CYACA      ------------------------------------------------------------
RPOC1_THAPS      ------------------------------------------------------------
RPOC1_PHATC      ------------------------------------------------------------
RPOC1_TRICV      ------------------------------------------------------------
RPOC1_NEPOL      ------------------------------------------------------------
RPOC1_OSTTA      ------------------------------------------------------------
RPOC1_PHYPA      ------------------------------------------------------------
RPOC1_MARPO      ------------------------------------------------------------
RPOC1_ANTAG      ------------------------------------------------------------
RPOC1_ANEMR      ------------------------------------------------------------
RPOC1_PSINU      ------------------------------------------------------------
RPOC1_ANGEV      ------------------------------------------------------------
RPOC1_ADICA      ------------------------------------------------------------
RPOC1_CUCSA      ------------------------------------------------------------
RPOC1_MORIN      ------------------------------------------------------------
RPOC1_SOLBU      ------------------------------------------------------------
RPOC1_SOLTU      ------------------------------------------------------------
RPOC1_SOLLC      ------------------------------------------------------------
RPOC1_NICSY      ------------------------------------------------------------
RPOC1_TOBAC      ------------------------------------------------------------
RPOC1_ATRBE      ------------------------------------------------------------
RPOC1_NICTO      ------------------------------------------------------------
RPOC1_CUSEX      ------------------------------------------------------------
RPOC1_CUSRE      ------------------------------------------------------------
RPOC1_IPOPU      ------------------------------------------------------------
RPOC1_COFAR      ------------------------------------------------------------
RPOC1_JASNU      ------------------------------------------------------------
RPOC1_SPIOL      ------------------------------------------------------------
RPOC1_SILLA      ------------------------------------------------------------
RPOC1_FAGEA      ------------------------------------------------------------
RPOC1_LEPVR      ------------------------------------------------------------
RPOC1_CAPBU      ------------------------------------------------------------
RPOC1_BARVE      ------------------------------------------------------------
RPOC1_NASOF      ------------------------------------------------------------
RPOC1_ARATH      ------------------------------------------------------------
RPOC1_OLIPU      ------------------------------------------------------------
RPOC1_DRANE      ------------------------------------------------------------
RPOC1_LOBMA      ------------------------------------------------------------
RPOC1_ARAHI      ------------------------------------------------------------
RPOC1_SINAL      ------------------------------------------------------------
RPOC1_CRUWA      ------------------------------------------------------------
RPOC1_AETCO      ------------------------------------------------------------
RPOC1_AETGR      ------------------------------------------------------------
RPOC1_CARPA      ------------------------------------------------------------
RPOC1_GOSHI      ------------------------------------------------------------
RPOC1_GOSBA      ------------------------------------------------------------
RPOC1_POPTR      ------------------------------------------------------------
RPOC1_POPAL      ------------------------------------------------------------
RPOC1_MANES      ------------------------------------------------------------
RPOC1_CITSI      ------------------------------------------------------------
RPOC1_VITVI      ------------------------------------------------------------
RPOC1_PHAAO      ------------------------------------------------------------
RPOC1_DIOEL      ------------------------------------------------------------
RPOC1_LEMMI      ------------------------------------------------------------
RPOC1_ACOAM      ------------------------------------------------------------
RPOC1_ACOCL      ------------------------------------------------------------
RPOC1_ACOGR      ------------------------------------------------------------
RPOC1_NYMAL      ------------------------------------------------------------
RPOC1_NUPAD      ------------------------------------------------------------
RPOC1_AMBTC      ------------------------------------------------------------
RPOC1_ILLOL      ------------------------------------------------------------
RPOC1_CHLSC      ------------------------------------------------------------
RPOC1_CALFG      ------------------------------------------------------------
RPOC1_LIRTU      ------------------------------------------------------------
RPOC1_DRIGR      ------------------------------------------------------------
RPOC1_CERDE      ------------------------------------------------------------
RPOC1_PIPCE      ------------------------------------------------------------
RPOC1_NANDO      ------------------------------------------------------------
RPOC1_RANMC      ------------------------------------------------------------
RPOC1_PLAOC      ------------------------------------------------------------
RPOC1_BUXMI      ------------------------------------------------------------
RPOC1_OENAR      ------------------------------------------------------------
RPOC1_OENBI      ------------------------------------------------------------
RPOC1_OENPA      ------------------------------------------------------------
RPOC1_OENEH      ------------------------------------------------------------
RPOC1_OENGL      ------------------------------------------------------------
RPOC1_EUCGG      ------------------------------------------------------------
RPOC1_PANGI      ------------------------------------------------------------
RPOC1_DAUCA      ------------------------------------------------------------
RPOC1_SOYBN      ------------------------------------------------------------
RPOC1_PHAVU      ------------------------------------------------------------
RPOC1_LOTJA      ------------------------------------------------------------
RPOC1_HELAN      ------------------------------------------------------------
RPOC1_GUIAB      ------------------------------------------------------------
RPOC1_LACSA      ------------------------------------------------------------
RPOC1_AGRST      ------------------------------------------------------------
RPOC1_BRADI      ------------------------------------------------------------
RPOC1_WHEAT      ------------------------------------------------------------
RPOC1_HORVU      ------------------------------------------------------------
RPOC1_LOLPR      ------------------------------------------------------------
RPOC1_ORYNI      ------------------------------------------------------------
RPOC1_ORYSA      ------------------------------------------------------------
RPOC1_ORYSI      ------------------------------------------------------------
RPOC1_ORYSJ      ------------------------------------------------------------
RPOC1_SACHY      ------------------------------------------------------------
RPOC1_SACOF      ------------------------------------------------------------
RPOC1_SORBI      ------------------------------------------------------------
RPOC1_MAIZE      ------------------------------------------------------------
RPOC1_PELHO      ------------------------------------------------------------
RPOC1_PINKO      ------------------------------------------------------------
RPOC1_PINTH      ------------------------------------------------------------
RPOC1_CYCTA      ------------------------------------------------------------
RPOC1_WELMI      ------------------------------------------------------------
RPOC1_GNEPA      ------------------------------------------------------------
RPOC1_CRYJA      ------------------------------------------------------------
RPOC1_HUPLU      ------------------------------------------------------------
RPOC1_CHAGL      ------------------------------------------------------------
RPOC1_STAPU      ------------------------------------------------------------
RPOC1_ZYGCR      ------------------------------------------------------------
RPOC1_CHAVU      ------------------------------------------------------------
RPOC1_OEDCA      ------------------------------------------------------------
RPOC1_OLTVI      ------------------------------------------------------------
RPOC1_TUPAK      ------------------------------------------------------------
RPOC1_TETOB      RSLSPIKDTKNNQAFMFSDTNSSAIKFGQSFSSFLSWSIDDLPKNFFVGAGILEKLLTEY
RPOC1_BIGNA      --------------------------------------------------------LLNL
                                                                             

RPOC1_MESVI      ----SFFNGEDSDWVLDENQWNKKNQDWQIEEE-------RRNKKRNKLIKRLRIINHFI
RPOC1_CHLAT      ------------DWSEE-------------EED-------RLRKKRNKLIKRLKIINHFL
RPOC1_CYAP4      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_ACAM1      ------------------------------------------GQKRAKLIKRLRVIDNFV
RPOC1_THEEB      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_TRIV2      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_NOSS1      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_NOSP7      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_NOSCO      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_SYNE7      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_SYNP6      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_RIPO1      ------------------------------------------GQKRAKLIKRLRVIDNFV
RPOC1_CROS5      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_MICAN      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_SYNY3      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_GLOC7      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_SYNP2      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_TRIEI      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_SYNJA      ------------------------------------------GQKRARLIKRLRVIDNFI
RPOC1_SYNJB      ------------------------------------------GQKRARLIKRLRVIDNFI
RPOC1_GLOVI      ------------------------------------------GQKRTKLIKRLRVLDNFI
RPOC1_PROMT      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_PROM1      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_SYNS3      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_SYNPW      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_SYNPX      ------------------------------------------GQKRAKLIKRLRVIDNFV
RPOC1_SYNS9      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_SYNSC      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_PROMM      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_PROM3      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_PROMA      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_PROM4      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_SYNR3      ------------------------------------------GQKRAKLIKRLRVIDNFI
RPOC1_PROM0      ------------------------------------------GQKRAKLIKRIRVIDNFI
RPOC1_PROM2      ------------------------------------------GQKRAKLIKRIRVIDNFI
RPOC1_PROMS      ------------------------------------------GQKRAKLIKRIRVIDNFI
RPOC1_PROM9      ------------------------------------------GQKRAKLIKRIRVIDNFI
RPOC1_PROM5      ------------------------------------------GQKRAKLIKRIRVIDNFI
RPOC1_PROMP      ------------------------------------------GQKRAKLIKRIRVIDNFL
RPOC1_PAUCH      ------------------------------------------GQRRAKLIKRLRVIDNFI
RPOC1_PYRYE      ------------------------------SFK-------TPSLKFNKKMKRLRLIENFI
RPOC1_PORPU      ------------------------------SFK-------TPSLKFNKKMKRLRLIENFI
RPOC1_GRATL      ------------------------------LFK-------NPSTKFNKKMKRLRLLENFL
RPOC1_GUITH      ------------------------------------------GIKKDKSIKRLRVIDNFI
RPOC1_RHDSA      ------------------------------------------GSKRDKAIKRLRVIDNFI
RPOC1_CYAPA      ------------------------------KKK-------N-TQKRAKLIKKLRIINNFI
RPOC1_EMIHU      ------------------------------------------RFFSEKLIRRLRVINQFI
RPOC1_CYACA      ------------------------------------------AVKKDKIMKRLRIIDNFM
RPOC1_THAPS      ---------------KEQPFYNFSHWSRKWEYQ-------RIYKLRDQSIKRIRILENLL
RPOC1_PHATC      ---------------KEKPIYDESRWFRKWEQQ-------RIYKIREQAIKRIRILENLV
RPOC1_TRICV      ---------------KEKPIYHFLRWFRKWELQ-------RAYKLRDQAIKRIRILENLL
RPOC1_NEPOL      ----GALE------------------------E-------EEMKRRSKLIRRLQLIHYFM
RPOC1_OSTTA      ------LAAKSLRKRHKRRKTAKLLGRTDQKNY-------GITIKVREYSRRLEFIRSLA
RPOC1_PHYPA      ------------------------STGNEWEDR-------KIQRRKDLLVRRIKLAKQFL
RPOC1_MARPO      ------------------------STGNEWEDR-------KIQRRKDLLVRRIKLAKHFI
RPOC1_ANTAG      ------------------------STGNEWEDR-------KIQRRKDLLVRRMELAKNFL
RPOC1_ANEMR      ------------------------STGTDWGDR-------KIQRNKDLLVRRMKLSKYFV
RPOC1_PSINU      ------------------------PTGNEWEDR-------GIQRIKDFMVRRIRLVKHFL
RPOC1_ANGEV      ------------------------STEDEWEDQ-------TIQRRKDFLIRRMKLSKHFL
RPOC1_ADICA      ------------------------PVGIEWEDR-------TIRRRKDLLIRRIKLAKDFL
RPOC1_CUCSA      ------------------------PAGNEWEDR-------KVGRRKDFLVRRMELAKHFI
RPOC1_MORIN      ------------------------PTVNEWEDR-------KVGRRKDFLVRRMELAKHFI
RPOC1_SOLBU      ------------------------HTGNEWEDR-------KVGRRKDFLVRRVELAKHFI
RPOC1_SOLTU      ------------------------HTGNEWEDR-------KVGRRKDFLVRRVELAKHFI
RPOC1_SOLLC      ------------------------HTGNEWEDR-------KVGRRKDFLVRRVELAKHFI
RPOC1_NICSY      ------------------------HTGNEWEDR-------KVGRRKDFLVRRVELAKHFI
RPOC1_TOBAC      ------------------------HTGNEWEDR-------KVGRRKDFLVRRVELAKHFI
RPOC1_ATRBE      ------------------------HTGNEWEDR-------KVGRRKDFLVRRVELAKHFI
RPOC1_NICTO      ------------------------HTGNEWEDR-------KVGRRKDFLVRRVELAKHFI
RPOC1_CUSEX      ------------------------NTGNEWEDR-------KAGRRKGFLVRRMELVKHFI
RPOC1_CUSRE      ------------------------RIGNEWEDR-------KAGRRKGFLVRRMELVKHFI
RPOC1_IPOPU      ------------------------HTGNEWEDR-------KVGRRKDFLVRRMELAKHFL
RPOC1_COFAR      ------------------------PTGNEWEDR-------KVGRRKDFLVRRMELTKHFI
RPOC1_JASNU      ------------------------PTGNEWEDQ-------KVRRRRGFLVRRMELAKHFI
RPOC1_SPIOL      ------------------------STGNEWEDR-------KVGRRKDFLVRRMELVKHFI
RPOC1_SILLA      ------------------------PTGNEWEDR-------KVGRRKDFLVRRMELAKHFI
RPOC1_FAGEA      ------------------------PTGNEWEDR-------KVRRRKDFLVRRMELAKHFI
RPOC1_LEPVR      ------------------------PTGNEWEDR-------KIVRRKDFLVRRMELAKHFI
RPOC1_CAPBU      ------------------------PTGNEWEDR-------KIVRRKDFLVRRMELAKHFI
RPOC1_BARVE      ------------------------PTGNEWEDR-------KIVRRKDFLVRRMELAKHFI
RPOC1_NASOF      ------------------------PTGNEWEDR-------KIVRRKDFLVRRMELAKHFI
RPOC1_ARATH      ------------------------PTGNEWEDR-------KIVRRKDFLVRRMELAKHFI
RPOC1_OLIPU      ------------------------PTGNEWEDR-------KIVRRKDFLVRRMELAKHFI
RPOC1_DRANE      ------------------------PTGNEWEDR-------KIVRRKDFLVRRMELAKHFI
RPOC1_LOBMA      ------------------------PTGNEWEDR-------KIVRRKDFLVRRMELAKHFI
RPOC1_ARAHI      ------------------------PTGNEWEDR-------KIVRRKDFLVRRMELAKHFI
RPOC1_SINAL      ------------------------PTGNEWEDR-------KIVRRKDFLVRRMELAKHFI
RPOC1_CRUWA      ------------------------PTGNEWEDR-------KIVRRKDFLVRRMELAKHFI
RPOC1_AETCO      ------------------------PTGNEWEDR-------KIVRRKDFLVRRMELAKHFI
RPOC1_AETGR      ------------------------PTGNEWEDR-------KIVRRKDFLVRRMELAKHFI
RPOC1_CARPA      ------------------------PTGNEWEDR-------KIGRRKDFLVRRMELAKHFI
RPOC1_GOSHI      ------------------------LTGNEWEDR-------KIGRRKDFLVRRMELAKHFI
RPOC1_GOSBA      ------------------------LTGNEWEDR-------KIGRRKDFLVRRMELAKHFI
RPOC1_POPTR      ------------------------PTGNEWEDR-------KVGRRKDFLVRRVELAKHFI
RPOC1_POPAL      ------------------------PTGNEWEDR-------KVGRRKDFLVRRVELAKHFI
RPOC1_MANES      ------------------------PTGNEWEDR-------KVGRRKDFLVRRVELAKHFI
RPOC1_CITSI      ------------------------PAGNDWEDR-------KIGRRRDFLVRRMELAKHFL
RPOC1_VITVI      ------------------------PTGNEWEDR-------KIGRRKDFLVRRMELAKHFI
RPOC1_PHAAO      ------------------------SAGNEWEEK-------KIRRRKDFLVRRIELAKHFL
RPOC1_DIOEL      -----------------------IGTGNEWEDR-------KIRRRKDFLVKRMELAKHFI
RPOC1_LEMMI      ------------------------STGNEWEDR-------KIRRRKDFLVRRMELAKHFI
RPOC1_ACOAM      ------------------------STGNEWEDR-------KIGRRKDFLVRRMELAKHFI
RPOC1_ACOCL      ------------------------STGNEWEDR-------KIGRRKDFLVRRMELAKHFI
RPOC1_ACOGR      ------------------------STGNEWEDR-------KIGRRKDFLVRRMELAKHFI
RPOC1_NYMAL      -----------------------ST-GNDWEDR-------KIGRRKDFLVRRMELAKHFL
RPOC1_NUPAD      -----------------------ST-GNDWEDR-------KIGRRKDFLVRRMELAKHFL
RPOC1_AMBTC      -----------------------SA-ENEWEDK-------KIVRRKDFLVRRMELAKHLL
RPOC1_ILLOL      -----------------------ST-GNAWEDR-------KIGRRKDFLVKRMELAKHFL
RPOC1_CHLSC      -----------------------ST-GNEWEDR-------KIGRRKDFLVRRLELAKNLI
RPOC1_CALFG      -----------------------ST-GNEWEDR-------KIGRRKDFLVRRIELAKHFI
RPOC1_LIRTU      -----------------------SADGNEWEDR-------KIGRRKDFLVRRMELAKHFI
RPOC1_DRIGR      -----------------------SA-GNEWEDR-------KIGRRKDFLVRRMELAKHFI
RPOC1_CERDE      -----------------------ST-GNEWEDR-------KIRRRKDFLVRRMELAKHFI
RPOC1_PIPCE      -----------------------ST-GNEWEDR-------KIGRRKDFLVRRIELAKHFI
RPOC1_NANDO      ------------------------ATGNEWEDR-------KIGRRKDFLVRRMELAKHFI
RPOC1_RANMC      ------------------------PAGNEWEDR-------KMGRRKSFLVRRMELAKHFI
RPOC1_PLAOC      ------------------------PTGNEWEDR-------KIGRRKDFLVRRMELAKHFI
RPOC1_BUXMI      ------------------------PTGNEWEDR-------KIGRRKDFLVRRMELAKHFI
RPOC1_OENAR      ------------------------STGNEWEDR-------KIGRRKQFLVRRVELAKHFI
RPOC1_OENBI      ------------------------STGNEWEDR-------KIGRRKQFLVRRVELAKHFI
RPOC1_OENPA      ------------------------STGNEWEDR-------KIGRRKQFLVRRVELAKHFI
RPOC1_OENEH      ------------------------STGNEWEDR-------KIGRRKQFLVRRVELAKHFI
RPOC1_OENGL      ------------------------STGNEWEDR-------KIGRRKQFLVRRVELAKHFI
RPOC1_EUCGG      ------------------------PTGNEWEDR-------KIGRRKDFLVRRMELAKHFL
RPOC1_PANGI      ------------------------PTGNEWEDR-------KVGRRKDFLVRRMELAKHFI
RPOC1_DAUCA      ------------------------PTGNEWEDR-------KVGRRKDFLVRRMELAKHFI
RPOC1_SOYBN      -----------------------PDNENEWEDR-------KVGRRKNFLVRRIELAKHFL
RPOC1_PHAVU      -----------------------PDNENEWEDR-------KVGRRKNFLVRRIELAKHFI
RPOC1_LOTJA      -----------------------THNENEWEDR-------KVGRRKNFLVRRMELAKHFI
RPOC1_HELAN      ------------------------STGNEWEDR-------KVGRRKDFLLRRMELAKHFI
RPOC1_GUIAB      ------------------------PTGNEWEDR-------KVGRRKDFLLRRMELAKHFI
RPOC1_LACSA      ------------------------PTGNEWEDR-------KVGRRKDFLLRRMELAKHFI
RPOC1_AGRST      ------------------------YSGDEWEDR-------KRRIRKVFLIRRMQLAKHFI
RPOC1_BRADI      ------------------------YSGDEWEDR-------KRRIRKVFLIRRMQLAKHFI
RPOC1_WHEAT      ------------------------YSGDEWEDR-------KRRIRKVFLIRRMQLAKHFI
RPOC1_HORVU      ------------------------YSGDEWEDR-------KRRIRKVFLIRRMQLAKHFI
RPOC1_LOLPR      ------------------------YSGDEWEDR-------KRRIRKVFLIRRMQLAKHFI
RPOC1_ORYNI      ------------------------YSGDEWEDR-------KRRIRKVFLIRRMQLAKHFI
RPOC1_ORYSA      ------------------------YSGDEWEDR-------KRRIRKVFLIRRMQLAKHFI
RPOC1_ORYSI      ------------------------YSGDEWEDR-------KRRIRKVFLIRRMQLAKHFI
RPOC1_ORYSJ      ------------------------YSGDEWEDR-------KRRIRKVFLIRRMQLAKHFI
RPOC1_SACHY      ------------------------YSGDEWEDR-------KRRIRKVFLIRRMQLAKHFI
RPOC1_SACOF      ------------------------YSGDEWEDR-------KRRIRKVFLIRRMQLAKHFI
RPOC1_SORBI      ------------------------YSGDEWEDR-------KRRIRKVFLIRRMQLAKHFI
RPOC1_MAIZE      ------------------------YSGDEWEDR-------KRRIRKVFLIRRMQLAKHFI
RPOC1_PELHO      ----P-----------------TRTERTEEEDRKIE----KIKRRMRVLVRRMELAKHFL
RPOC1_PINKO      ----N-----------------QESTVDRWEDE-------KIRRRKDFLVGRIKLAKHFL
RPOC1_PINTH      ----N-----------------QESTVDRWEDE-------KIRRRKDFLVGRMKLAKHFL
RPOC1_CYCTA      ----------------------QKSAGNGWGDR-------KIQRRKDFSVRRMKLAKHFL
RPOC1_WELMI      -----------------------LLRNYKIQRTQRE--KNKIQKRKNFLVRRIKFVKYLI
RPOC1_GNEPA      -----------------------LLKNHRIQKR-----KNKIEKRKNFLVKRIKFAKNLI
RPOC1_CRYJA      ----PE----------------NLFSNRKIYAQFKEQKLQKLRRRKDLLVRRMRFAKYFL
RPOC1_HUPLU      ------------------------FVNKKPTGDILE--DLLIKRRKDFLVRRFKLIKFFI
RPOC1_CHAGL      ------------------------STGNSYEDK-------KIQRMKDIIIRRIKLAKQFF
RPOC1_STAPU      ------------------------PVSGKYKNSDHS---ADIQREKRLIIRSSKIIRDLI
RPOC1_ZYGCR      ----VIEA--------------QGPVPQAEEEKQRD---QSIQQQKDAVLRRITLIRDLL
RPOC1_CHAVU      -------------------------PLDEKEAQ-------KAQREKERLVRRIKIASYFQ
RPOC1_OEDCA      ----EVLL--------------KHNQTNLKLLKYYSLKRRTVIEIEKSILRKLKYIRRLN
RPOC1_OLTVI      ----YVNG--------------LFMTRTQRKV------LFALWRQRTKVLRRLKLVRYFR
RPOC1_TUPAK      ----FKFE--------------IFFIDDQEIIEKVFMKLVILRSLRSKALRRLKVLRPFK
RPOC1_TETOB      TSSELRKMTKQHQILLPKINQMLRFLKQNAKTKKDSLKIQKYFQKREQIIRRLKFLRKFS
RPOC1_BIGNA      ERQIRFTVFEIKEEIKELSGILFSYFFQKQQFISFQKKIKKLNWKKNKVFRRLKLIMYFR
                                                                           : 

RPOC1_MESVI      ATGAKPEWMVLSILPVLPPELRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LAKLN
RPOC1_CHLAT      ATGAKPEWMILSILPVLPPDLRPMVQL-DGGQFATSDLNDLYRRVINRNNR----LSKLN
RPOC1_CYAP4      ATGSRPDWMVLTVIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_ACAM1      GTGSQTDWMVLSVIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_THEEB      ATGAKPEWMVLTVIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_TRIV2      ATGSKPEWMVMTVIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_NOSS1      ATGSKPEWMVMTVIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_NOSP7      ATGSKPEWMVMAVIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_NOSCO      ATGSKPEWMVMAVIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_SYNE7      GTESRPEWMVLNVIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_SYNP6      GTESRPEWMVLNVIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_RIPO1      ATNSRPDWMVLSVIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LSRLQ
RPOC1_CROS5      ATGSLPAWMVLDVIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_MICAN      ATGSQAEWMVLSVIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LSRLQ
RPOC1_SYNY3      ATHSQAEWMTLDVIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_GLOC7      ATGSQPDWMVLTVIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LSRLQ
RPOC1_SYNP2      ATGARPEWMVLNSIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_TRIEI      ATGSRPEWMVLDAIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_SYNJA      ATGARPEWMVLRVLPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_SYNJB      ATGSRPEWMVLRVLPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_GLOVI      ATGSRPEWMVLTAIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_PROMT      ATSASPEWMVLDAIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_PROM1      ATSASPEWMVLDAIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_SYNS3      ATNARPEWMVLDAIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_SYNPW      ATNARPEWMVLDVIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_SYNPX      ATSARPEWMVLDVIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_SYNS9      ATGARPDWMVLDVIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_SYNSC      ATNARPEWMVLDVIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_PROMM      ATNARPEWMVLDAIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_PROM3      ATNARPEWMVLDAIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_PROMA      ATNARPEWMVLNAIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_PROM4      ATNARPEWMVLDAIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_SYNR3      ATDARPEWMVLDAIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_PROM0      ATNAKPEWMVLDAIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_PROM2      ATNAKPEWMVLDAIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_PROMS      ATNAKPEWMVLDAIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_PROM9      ATNAKPEWMVLDAIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_PROM5      ATNAKPEWMVLDAIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_PROMP      ATNAKPEWMVLDAIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_PAUCH      ATGAKPEWMVLDVVPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LGRLK
RPOC1_PYRYE      ATGADPSWMVFTVIPVIPPDLRPMVQL-DGGRFATADLNEFYRRIINRNNR----LSRLK
RPOC1_PORPU      ATGADPSWMVFTVIPVIPPDLRPMVQL-DGGRFATADLNEFYRRIINRNNR----LSRLK
RPOC1_GRATL      ATGANPSWMVLSVIPVIPPDLRPMVQL-DGGRFATADLNEFYRRIINRNNR----LARLK
RPOC1_GUITH      ATRSDPTWMILTVLPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVLNRNNR----LIRLQ
RPOC1_RHDSA      ATRSDPAWMILTVLPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVLNRNNR----LIRLQ
RPOC1_CYAPA      ATKAKPEWMILSLIPVIPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LLRLQ
RPOC1_EMIHU      ASKFDPTWMILDILPVLPPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LARLQ
RPOC1_CYACA      VTGASPSWMVLNVIPVISPDLRPMVQL-DGGRFATSDLNDLYRRVINRNNR----LKRLE
RPOC1_THAPS      TTGANPAWMIITILPVIPPALRPMIQL-EGGRFATSDLNELYRRIITRNNR----LLRLL
RPOC1_PHATC      GTGSSPAWMILTILPVIPPALRPMIQL-EGGRFATSDLNELYRRIITRNNR----LLRLL
RPOC1_TRICV      ATGSNPAWMILTILPVIPPALRPMIQL-EGGRFATSDLNELYRRIITRNNR----LLRLL
RPOC1_NEPOL      QTKAQPEWMVIKALPVLPPDLRPIVQL-EGGRFATTDLNDLYRRVLNRNNR----FMKLH
RPOC1_OSTTA      RKGLRPEWMILSIFPVLPPDLRPMIQM-SSGRFATSDLNDLYRRLIYRKIRFEKFLTLFD
RPOC1_PHYPA      QTNIKPEWMVLSLLPVLPPELRPMIEL-GEGELITSDLNELYRRVIYRNNTLIDFLARSG
RPOC1_MARPO      QTNIKPEWMVLSLLPVLPPELRPMIEL-GEGELITSDLNELYRRVIYRNNTLLDFLARSG
RPOC1_ANTAG      QTNMKPEWMVLSLLPVLPPELRPMIEL-GEGELITSDLNELYRRVIYRNNTLLDFLARGR
RPOC1_ANEMR      QTNIEPEWMVLSLLPVLPPELRPMIEL-GEGELITSDLNELYRRVIYRNNTLLDFLARSD
RPOC1_PSINU      YTDVKPEWMVLSLLPVLPPELRPMIEV-SGGLLLTSDLNELYRKVIYRNNTLIDFLLRSE
RPOC1_ANGEV      HTNIKPEWMVLDVLPVLPPELRPMIEL-SEGDVITSDFNELYRKIIYRNNILLDLLLKSA
RPOC1_ADICA      RTNMKPEWMVLYFIPVLPPELRPIVEL-HEGELITSDLNELYRKIIYRNNTLREFLSGSE
RPOC1_CUCSA      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLIDLLTTSR
RPOC1_MORIN      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLIDLLTTSR
RPOC1_SOLBU      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_SOLTU      QSNIDPQWMVWCLLPVLPPELRPIIRI-DGGKLMSSDISELYRKVIYRNNTLTDLLRTSK
RPOC1_SOLLC      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_NICSY      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_TOBAC      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_ATRBE      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_NICTO      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_CUSEX      RTNIEPKWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_CUSRE      RTNIEPEWMVLSLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_IPOPU      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_COFAR      RTNIEPEWMVLFLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_JASNU      RTNIEPEWMVLCLLPVLPPDLRPVIQI-AEGKVMSSDITKLYQRVIYRNKILTDLLTRSV
RPOC1_SPIOL      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLSTSR
RPOC1_SILLA      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_FAGEA      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_LEPVR      RTNIEPEWMVLCLLPVLPPELRPIIQI-EGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_CAPBU      RTNIEPEWMVLCLLPVLPPELRPIIQI-EGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_BARVE      RTNIEPEWMVLCLLPVLPPELRPIIQI-EGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_NASOF      RTNIEPEWMVLCLLPVLPPELRPIIQI-EGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_ARATH      RTNIEPEWMVLCLLPVLPPELRPIIQI-EGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_OLIPU      RTNIEPEWMVLCLLPVLPPELRPIIQI-EGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_DRANE      RTNIEPEWMVLCLLPVLPPELRPIIQI-EGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_LOBMA      RTNIEPEWMVLCLLPVLPPELRPIIQV-EGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_ARAHI      RTNIEPEWMILCLLPVLPPELRPIIQI-EGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_SINAL      RTNIEPEWMVLCLLPVLPPELRPIIQI-EGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_CRUWA      RTNIEPEWMVLCLLPVLPPELRPIIQI-EGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_AETCO      RTNIEPEWMVLCLLPVLPPELRPIIQI-EGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_AETGR      RTNIEPEWMVLCLLPVLPPELRPIIQI-EGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_CARPA      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_GOSHI      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_GOSBA      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_POPTR      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_POPAL      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_MANES      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLIDLLTTSR
RPOC1_CITSI      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLIDLLTTSR
RPOC1_VITVI      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_PHAAO      RTNVDPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLATSR
RPOC1_DIOEL      RTNVEPKRMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLATSR
RPOC1_LEMMI      RTNVEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_ACOAM      RTNVEPERMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLKTSR
RPOC1_ACOCL      RTNVEPERMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLKTSR
RPOC1_ACOGR      RTNVEPERMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLKTSR
RPOC1_NYMAL      RTNVEPEWMVLSLLPVLPPELRPIIQI-DGGKSMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_NUPAD      RTNVEPEWMVLCLLPVLPPELRPIIQI-DGGKPMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_AMBTC      RTNVEPERMVLCLLPVLPPELRPIIQI-DGGKPMSSDINELYRRVIYRNNTLIDPLTTSR
RPOC1_ILLOL      RTNVEPERMVLCLLPVLPPELRPIIQI-DGGKPMSSDINELYRRVIYRNNTLTDPLTTSR
RPOC1_CHLSC      RTNVEPEWMVLRLLPVLPPELRPIIQI-DGGKPMSSDINELYRRVIYRNNTLTDPLTTSR
RPOC1_CALFG      RTNVEPERMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDPLTTST
RPOC1_LIRTU      RTNVEPERMVLCLLPVLPPELRPIIQI-DGGKPMSSDINELYRRVIYRNNTLTDPLTTSR
RPOC1_DRIGR      RTNVEPERMVLCLLPVLPPELRPIIQI-DGGKPMSSDINELYRRVIYRNNTLTDPLTTSR
RPOC1_CERDE      RTNIEPERMVLCLLPVLPPELRPIIQI-DGGKPMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_PIPCE      RTNVEPERMVLSLLPVLPPELRPIIQI-DGGKPMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_NANDO      RTNVEPERMVLCLLPVLPPELRPIIQI-DGGKPMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_RANMC      RTNVEPERMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_PLAOC      RTNVEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_BUXMI      RTKVEPERMVLCLLPVLPPELRPIIQI-DGGKSMSSDINELYRRVIYRNNTLIDLLTTSR
RPOC1_OENAR      RTNIEPEWMVLCLLPVLPPELRPIIQM-DGGKLMSSDINELYRRVIYRNNILADLLTTSR
RPOC1_OENBI      RTNIEPEWMVLCLLPVLPPELRPIIQM-DGGKLMSSDINELYRRVIYRNNILADLLTTSR
RPOC1_OENPA      RTNIEPEWMVLCLLPVLPPELRPIIQM-DGGKLMSSDINELYRRVIYRNNILADLLTTSR
RPOC1_OENEH      RTNIEPEWMVLCLLPVLPPELRPIIQM-DGGKLMSSDINELYRRVIYRNNILADLLTTSR
RPOC1_OENGL      RTNIEPEWMVLCLLPVLPPELRPIIQM-DGGKLMSSDINELYRRVIYRNNILADLLTTSR
RPOC1_EUCGG      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_PANGI      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_DAUCA      RTNIDPKWMVLCLLPVLPPELRPIVQI-DGGKLMSSDINELYRRVIYRNNTLTDLLTTSR
RPOC1_SOYBN      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLIDLLTTSR
RPOC1_PHAVU      RTNIEPEWMVLCLLPVLPPELRPIIQV-DGGKLMSSDINELYRRVIYRNNTLIDLLTTSR
RPOC1_LOTJA      RTNIEPEWMVLCLLPVLPPELRPIIQI-DGGKLMSSDINELYRRVIYRNNTLIDLLTTSR
RPOC1_HELAN      RTNIEPKWMVLRLLPVLPPELRPIYHI-DEDKLVTSDINEIYRRIIYRNNTLTDLLTTSI
RPOC1_GUIAB      RTNIEPKWMVLCLLPVLPPELRPIYHI-DEDKLVTSDINEIYRRIIYRNNTLTDLLTTSI
RPOC1_LACSA      RTNIEPKWMVLRLLPVLPPELRPIYHI-DEDKLVTSDINEIYRRIIYRNNTLTDLLTTSI
RPOC1_AGRST      QTNVEPEWMVLCLLPVLPPELRPIVYR-SGDKVVTSDINELYKRVIRRNNNLAYLLKRSE
RPOC1_BRADI      QTNVEPEWMVLCLLPVLPPELRPIVYR-SGDKVVTSDINELYKRVIRRNNNLAYLLKRSE
RPOC1_WHEAT      QTNVEPEWMVLCLLPVLPPELRPIVYR-SGDKVVTSDINELYKRVIRRNNNLAYLLKRSE
RPOC1_HORVU      QTNVEPEWMVLCLLPVLPPELRPIVYR-SGDKVVTSDINELYKRVIRRNNNLAYLLKRSE
RPOC1_LOLPR      QTNVEPEWMVLCLLPVLPPELRPIVYR-SGDKVVTSDINELYKRVIRRNNNLAYLLKRSE
RPOC1_ORYNI      QTNVEPEWMVLCLLPVLPPELRPIVYR-SGDKVVTSDINELYKRVIRRNNNLAYLLKRSE
RPOC1_ORYSA      QTNVEPEWMVLCLLPVLPPELRPIVYR-SGDKVVTSDINELYKRVIRRNNNLAYLLKRSE
RPOC1_ORYSI      QTNVEPEWMVLCLLPVLPPELRPIVYR-SGDKVVTSDINELYKRVIRRNNNLAYLLKRSE
RPOC1_ORYSJ      QTNVEPEWMVLCLLPVLPPELRPIVYR-SGDKVVTSDINELYKRVIRRNNNLAYLLKRSE
RPOC1_SACHY      QTNVEPEWMVLCLLPVLPPELRPIVYR-SGDKVVTSDINELYKRVIRRNNNLAYLLKRSE
RPOC1_SACOF      QTNVEPEWMVLCLLPVLPPELRPIVYR-SGDKVVTSDINELYKRVIRRNNNLAYLLKRSE
RPOC1_SORBI      QTNVEPEWMVLCLLPVLPPELRPIVYR-SGDKVVTSDINELYKRVIRRNNNLAYLLKRSE
RPOC1_MAIZE      QTNVEPEWMVLCLLPVLPPELRPIVYR-SGDKVVTSDINELYKRVIRRNNNLAYLLKRSE
RPOC1_PELHO      ETNVKPEWMILRLLPVLPPELRPIFKI-SEVQFISSDLNTLYKEVISNNKILSDSLLGCK
RPOC1_PINKO      RTNIEPKWMVLCLLPVLPPEPRPIVQLGEGGLITSSDLNELYRRVINRNNTLTNLLARSG
RPOC1_PINTH      RTNIEPKWMVLCLLPVLPPEPRPIVQLGEGGLITSSDLNELYRRVINRNNTLTNLLARSG
RPOC1_CYCTA      QTDIEPEWMVLCPLPVLPPELRPIVQLGGGELITS-DPNELYRRVIYRNNTLTDLLARSR
RPOC1_WELMI      QAKIKPEWMVLCLLPVLPPELRPIFVL-GEQIIAESDLNKLYQKVLIRNKNLQSSFEMQG
RPOC1_GNEPA      QAKINPEWMVLCLLPVLPPELRPIFVL-GEQVVVESDFNKLYQKVNLRNKNLQNSFEIQG
RPOC1_CRYJA      RTNVEPQWMVLCLLPVLPPDLRPMFQL-NEGGVITSDLNELYQTVIRRNNNVLQFIETTS
RPOC1_HUPLU      QTKTNPEWMVLSILPVLPPELRPMIRL-NDGEIISSDINELYRRIIFRNNGLIDFLEKRT
RPOC1_CHAGL      ENNIKPEWMVLSVLPVLPPELRPMIEI-NQGELITSDLNELYRRVIYRNNTLIGFLNKSN
RPOC1_STAPU      QSKTQPEWMVLSVLPVLPPDLRPIVEL-REGQLITSDLNELYRKVLFRNEDLSIWLSYQG
RPOC1_ZYGCR      QSQTQPEWMVLRTLPVLPPDLRPILEL-KDGQLIRSDLNELYRRVLYRNQ-----LICQF
RPOC1_CHAVU      ETKIKPQWMVLSTIPVLPPDLRPMIHL-NDGPLATSDLNDLYRKVLYRNKTLWELRQGIW
RPOC1_OEDCA      WVSAKPEYMIIRNLPVLPADLRPIFKI--QQQLTASDLNRLYQKVIYRNDRLKRFLKNST
RPOC1_OLTVI      QTNMRPQWMVLSVLPVLPPDLRPIIQM-NGNQVAVSDLNKLYQKVIFRNQRMLRFARGQY
RPOC1_TUPAK      GSHVLPEWMVLSVLPILPPALRPIIPL-DSQQVAVSDLNKLYQTVLFRNKRVQRFYNDYY
RPOC1_TETOB      RRNSNPTFMILKNLPVLPPDLRPILKL--QNQIAASDLNRFYQRIIYRNDRLKKFAKDSA
RPOC1_BIGNA      QAKLQPKWMILSSLPVLPPDLRPIVELG-SNKIAVSDLNKSYQTIILRNLRLKKFYNNSA
                      .  *    .*::..  **:            * .  *: :  .:           

RPOC1_MESVI      NM------LAPEI---VVRSEKRMLQESVDALIDNGKRGK-ALVGNNKIPLKSLSDIIKG
RPOC1_CHLAT      TM------LAPEI---VVRSEKRMLQEAVDALIDNGKRGRQALVGSNKIPLKSLSDIIKG
RPOC1_CYAP4      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_ACAM1      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_THEEB      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_TRIV2      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_NOSS1      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_NOSP7      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_NOSCO      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_SYNE7      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_SYNP6      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_RIPO1      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRALKSLSDIIEG
RPOC1_CROS5      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_MICAN      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRALKSLSDIIEG
RPOC1_SYNY3      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRALKSLSDIIEG
RPOC1_GLOC7      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_SYNP2      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_TRIEI      EI------LAPEI---IIRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_SYNJA      EI------MAPEI---IVRNEKRMLQEAVDALIDNGRRGR-MVVGANNRPLKSLSDIIEG
RPOC1_SYNJB      EI------MAPEI---IVRNEKRMLQEAVDALIDNGRRGR-VVAGANNRPLKSLSDIIEG
RPOC1_GLOVI      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_PROMT      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_PROM1      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_SYNS3      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_SYNPW      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_SYNPX      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_SYNS9      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_SYNSC      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_PROMM      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_PROM3      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_PROMA      EI------LAPEI---IVRNEKRMLQEAVDALVDNGRRGR-TVVGANNRALKSLSDIIEG
RPOC1_PROM4      EI------LAPEI---IVRNEKRMLQEAVDALVDNGRRGR-TVVGANNRALKSLSDIIEG
RPOC1_SYNR3      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_PROM0      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRALKSLSDIIEG
RPOC1_PROM2      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRALKSLSDIIEG
RPOC1_PROMS      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRALKSLSDIIEG
RPOC1_PROM9      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRALKSLSDIIEG
RPOC1_PROM5      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRALKSLSDIIEG
RPOC1_PROMP      EI------LAPEI---IVRNEKRMLQEAVDALIDNGRRGR-TVVGANNRALKSLSDIIEG
RPOC1_PAUCH      EI------LAPEI---IIRNEKRMLQEAVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_PYRYE      SI------LAPEI---IIRNEKRMLQEAVDSLMDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_PORPU      SI------LAPEI---IIRNEKRMLQEAVDSLMDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_GRATL      AI------LAPEI---IIRNEKRMLQEAVDSLMDNGRRGR-TVIGANNRPLKSLSDIIEG
RPOC1_GUITH      EI------LAPEI---IIRNEKRMLQESVDALIDNGRRGR-TVMGANNRPLKSLSDIIEG
RPOC1_RHDSA      EI------LAPEI---IIRNEKRMLQESVDALIDNGRRGR-TVVGANNRPLKSLSDIIEG
RPOC1_CYAPA      EV------FAPEI---VVRNEKRILQEAVDALIDNGRRGR-IVVGAKNRPLKSLSDIIEG
RPOC1_EMIHU      EI------VAPEL---IIRNEKRMLQEAVDALIDNGKRGR-AVVGLNNRPLKSLSDIIEG
RPOC1_CYACA      EI------LAPEI---IIRNEKRMLQEAVDALIDNGRRGR-VVVGANNRALKSLSNIIEG
RPOC1_THAPS      EI------DAPQL---IIRNEKRMLQEAVDTLIDNGKRGK-IALSASNRPLKSLSDIIKG
RPOC1_PHATC      EI------DAPQL---IIRNEKRLLQEAVDTLIDNGKRGK-IALSANNRPLKSLSDIIKG
RPOC1_TRICV      EI------DAPQL---IIRNEKRMLQEAVDTLIDNGKRGK-IALSANNRPLKSLSDIIKG
RPOC1_NEPOL      KM------VAPET---LIRSEKRLLQEAVDGLFDNGKRGK-PVLNSSNRPLKSLADALKG
RPOC1_OSTTA      EE------FLPDL---LIRHDLCLLQEAADSIIDNGRLDK-PAQRPNRKPFKSLTSIIEG
RPOC1_PHYPA      --------STPGG---LVVCQIRLVQEAVDGLIDNGIRGQPMKDSH-NRPYKSFSDVIEG
RPOC1_MARPO      --------STPGG---LVVCQKRLVQEAVDALIDNGIRGQPMKDSH-NRPYKSFSDLIEG
RPOC1_ANTAG      --------STPGG---LVVCQKRLVQEAVDALIDNGIRGQPMRDSH-NRAYKSFSDLIEG
RPOC1_ANEMR      --------STPRG---LIICQKRLVQEAVDALIDNGIRGQPMRDNH-NRPYKSFSDLLGG
RPOC1_PSINU      --------FTPEG---LIVCQKRLVQEAVDALIDNGIRGQPIRDSH-NRPYKSFSDIIEG
RPOC1_ANGEV      --------FTPEG---LIICQKKLIQEAVDALIDNGIRGQPLRDSN-NRPYKSFSEVIEG
RPOC1_ADICA      --------FTPEG---LIVCQKRLVQEAVDALIGSGIRGQPMRDIH-NRPYKSFSEVIEG
RPOC1_CUCSA      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_MORIN      --------STPGE---LVMCQEKLVQEAVDTLFDNGIRGQPMRDGH-NKVYKSFSDIIEG
RPOC1_SOLBU      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_SOLTU      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_SOLLC      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_NICSY      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_TOBAC      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_ATRBE      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_NICTO      --------STPVE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_CUSEX      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDIIEG
RPOC1_CUSRE      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDIIEG
RPOC1_IPOPU      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKIYKSFSDLIEG
RPOC1_COFAR      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMKDGH-NKVYKSFSDVIEG
RPOC1_JASNU      --------STPGD---LVTSQEKLVQEAVDALLDNGTRGQPMRDGQ-NKVYKSLSDIIEG
RPOC1_SPIOL      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_SILLA      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_FAGEA      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_LEPVR      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_CAPBU      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_BARVE      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_NASOF      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_ARATH      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_OLIPU      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_DRANE      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_LOBMA      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_ARAHI      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_SINAL      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_CRUWA      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_AETCO      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_AETGR      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMKDGH-NKVYKSFSDVIEG
RPOC1_CARPA      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_GOSHI      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_GOSBA      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_POPTR      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_POPAL      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_MANES      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_CITSI      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKIYKSFSDVIEG
RPOC1_VITVI      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_PHAAO      --------STPGE---LVMCQEKLVQEAVDTLFDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_DIOEL      --------SMPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMKDGH-NKVYKSFSDVIEG
RPOC1_LEMMI      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_ACOAM      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_ACOCL      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_ACOGR      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_NYMAL      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_NUPAD      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_AMBTC      --------STPGE---SVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_ILLOL      --------STPGE---LVLCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_CHLSC      --------STPGE---SVMCQEKLVQEAVDTLLDNGIRGQPMKDGH-NKVYKSFSDVIEG
RPOC1_CALFG      --------STPGE---SVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_LIRTU      --------STPGE---SVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_DRIGR      --------STPGE---SVMCQEKLVQEAVDTLLDNGIRGQPMRNGH-NKVYKSFSDVIEG
RPOC1_CERDE      --------STPGE---SVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_PIPCE      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGY-NKVYKSFSDVIEG
RPOC1_NANDO      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDSH-NKVYKSFSDVIEG
RPOC1_RANMC      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPTRDGH-NKIYKSFSDVIEG
RPOC1_PLAOC      --------STPGE---SVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_BUXMI      --------STPRE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_OENAR      --------STPGD---LVMGQEKLVQEAVDTLLDNGIRSRPVRDGQ-NKVYKSFSDVIEG
RPOC1_OENBI      --------STPGD---LVMGQEKLVQEAVDTLLDNGIRSRPVRDGQ-NKVYKSFSDVIEG
RPOC1_OENPA      --------STPGD---LVMGQEKLVQEAVDTLLDNGIRSRPVRDGQ-NKVYKSFSDVIEG
RPOC1_OENEH      --------STPGD---LVMGQEKLVQEAVDTLLDNGIRSRPVRDGQ-NKVYKSFSDVIEG
RPOC1_OENGL      --------STPGD---LVMGQEKLVQEAVDTLLDNGIRSRPVRDGQ-NKVYKSFSDVIEG
RPOC1_EUCGG      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_PANGI      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_DAUCA      --------STPGE---LIMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDVIEG
RPOC1_SOYBN      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDIIEG
RPOC1_PHAVU      --------STPGE---LVICQEKLVQEAVDTLLDNGIRGQPMRDGH-NKVYKSFSDIIEG
RPOC1_LOTJA      --------STPGE---LVMCQEKLVQEAVDTLLDNGIRGQPMKDGH-NKVYKSFSDIIEG
RPOC1_HELAN      --------ATPEE---LIISQEKLLQEAVDALLDNGICGQPMRDDH-NRIYKSLSDVIEG
RPOC1_GUIAB      --------ATPEE---LIISQEKLLQEAVDALLDNGICGQPMRDDH-NRIYKSLSDVIEG
RPOC1_LACSA      --------ATPEE---LIISQEKLLQEAVDALLDNGICGQPMRDDH-NRVYKSLSDVIEG
RPOC1_AGRST      --------LAPAD---LVMCQEKLVQEAVDTLLDSGSRGQPIRDGH-NKVYKSLSDVIEG
RPOC1_BRADI      --------LAPAD---LVMCQEKLVQEAVDTLLDSGSRGQPTRDGH-NKVYKSLSDVIEG
RPOC1_WHEAT      --------LAPAD---LVMCQEKLVQEAVDTLLDSGSRGQPTRDGH-NKVYKSLSDVIEG
RPOC1_HORVU      --------LAPAD---LVMCQEKLVQEAVDTLLDSGSRGQPTRDGH-NKVYKSLSDVIEG
RPOC1_LOLPR      --------LAPAD---LVMCQEKLVQEAVDTLLDSGSRGQPMRDGH-NKVYKSLSDVIEG
RPOC1_ORYNI      --------LAPAD---LVMCQEKLVQEAVDTLLDSGSRGQPTRDGH-NKVYKSLSDVIEG
RPOC1_ORYSA      --------LAPAD---LVMCQEKLVQEAVDTLLDSGSRGQPTRDGH-NKVYKSLSDVIEG
RPOC1_ORYSI      --------LAPAD---LVMCQEKLVQEAVDTLLDSGSRGQPTRDGH-NKVYKSLSDVIEG
RPOC1_ORYSJ      --------LAPAD---LVMCQEKLVQEAVDTLLDSGSRGQPTRDGH-NKVYKSLSDVIEG
RPOC1_SACHY      --------LAPAD---LVMCQEKLVQEAVDTLLDSGSRGQPMRDGH-NKVYKSLSDVIEG
RPOC1_SACOF      --------LAPAD---LVMCQEKLVQEAVDTLLDSGSRGQPMRDGH-NKVYKSLSDVIEG
RPOC1_SORBI      --------LAPAD---LVMCQEKLVQEAVDTLLDSGSRGQPMRDGH-NKVYKSLSDVIEG
RPOC1_MAIZE      --------LAPAD---LVMCQEKLVQEAVDTLLDSGSRGQPTRDGH-NKVYKSLSDVIEG
RPOC1_PELHO      --------FVPEQ---LLTGQEKIVQVAVDQLLDNRISGQPRRDRN-KQLYKSFSDILAG
RPOC1_PINKO      --------SES-----FVICQKKLIQEAVDALLDNGICGQPMRDSH-DRPYKSFSDVIEG
RPOC1_PINTH      --------SES-----FVIYQTKLIQEAVDALLDNGICRQPMRDSH-NRPYKSFSDVIEG
RPOC1_CYCTA      --------STPGG---LVICQKKLVQEAVDALLDNGIRGQPMRDSH-DRPYKSFSDVIEG
RPOC1_WELMI      D------PLYSTGKRDFMTFQKRLLQEAVDALLDNDRSGEPGEDLF-NRPYKSFSDVIAG
RPOC1_GNEPA      G------PFYSTG--DFLTLQKRLLQEAVDALLDSGKSGQPRKDHFRNRPYKSFSDVIAG
RPOC1_CRYJA      A------FLIPDL----LPDQKKLVQQAVDALLDNSIGTQPVRDSH-DRPYKSFSDFIQG
RPOC1_HUPLU      --------FTPEG---VIVCQKKLVQEAVDSLFDNSMCKEPMTDLN-GRLLKSFSDIIQG
RPOC1_CHAGL      --------STPAG---LIIYQKRLVQEAVDALIDNRIGNQIMKDRN-NRPYKSFSEIIEG
RPOC1_STAPU      TLVLSGL---------LARLQRASLQRAVDALLANGMGSSTFRDYN-KRAYKSFSALIKG
RPOC1_ZYGCR      SVEDPFC---------ISMMQKKLLQQAIDSLLANGAGGNIIRDRN-MRPYKSLSDIIKG
RPOC1_CHAVU      --------PAPHS---LMISQKRLVQEAVDALIDNGLGGPPMRDSN-NRPYKSLSDVISG
RPOC1_OEDCA      -----------TSNSFEMLFAQRMLQEAVDNLIENGKDINSIETDSRGRPLKSLGELLKG
RPOC1_OLTVI      TIN-----NSPE-----MRYAGRLLQEAVDALIANGKGGGATISDANNRPLKSLSDMLKG
RPOC1_TUPAK      SLN-----FSEE-----MRYAQRLLQEAVDALIENGKGDSAAITASNNRPLKSLSDMIKG
RPOC1_TETOB      TNQ-----------SFEIKYAQRLLQEAVDNLIQNGKGSVKAETNSRGQPLKSLSEILKG
RPOC1_BIGNA      FNEF----------TEEIRYTKRLLQESVDELIQQDKSKKNNNISS-----KSLSDILKG
                                         :* : * :. .                **:   : *

RPOC1_MESVI      KQGRFRQNLLGKRVDYSGRSVIVVGPNLKLHQCGLPKEMAIELFQPFVIHTLINEGLANN
RPOC1_CHLAT      KQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKEMAIELFQPFVIHNLINQGLANN
RPOC1_CYAP4      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPREMAIELFQPFVIHRLIRQGLVNN
RPOC1_ACAM1      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIGQGLVNN
RPOC1_THEEB      KQGRFRQNLLGKRVDYSGRSVIVVGPKLQMHQCGLPREMAIELFQPFVIHRLIRQQIVNN
RPOC1_TRIV2      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKIHQCGLPREMAIELFQPFVINRLIRSGMVNN
RPOC1_NOSS1      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKIHQCGLPREMAIELFQPFVINRLIRSGMVNN
RPOC1_NOSP7      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKIHQCGLPREMAIELFQPFVINRLIRSGMVNN
RPOC1_NOSCO      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKIHQCGLPREMAIELFQPFVINRLIRSGMV--
RPOC1_SYNE7      KQGRFRQNLLGKRVDYSGRSVIVVGPNLKIHQCGLPREMAIELFQPFVIHRLIKNHSINN
RPOC1_SYNP6      KQGRFRQNLLGKRVDYSGRSVIVVGPNLKIHQCGLPREMAIELFQPFVIHRLIKNHSINN
RPOC1_RIPO1      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKIYQCGLPREMAIELFQPFVIHRLIRLGLVNN
RPOC1_CROS5      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKIYQCGLPREMAIELFQPFVIHRLIRLGLVNN
RPOC1_MICAN      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKIYQCGLPREMAIELFQPFVIHRLIKLGIVNN
RPOC1_SYNY3      KQGRFRQNLLGKRVDYSGRSVIVVGPNLKIYQCGLPREMAIELFQPFVIHRLIKLGIVNN
RPOC1_GLOC7      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKIFQCGLPREMAIELFQPFVIHRLIKLGLVNN
RPOC1_SYNP2      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKIYQCGLPREMAIELFQPFVIQRLIKSTIVSN
RPOC1_TRIEI      KQGRFRQNLLGKRVDYSGRSVIVVGPKLAINQCGLPREMAIELFQPFVIHRLIRQGLVNN
RPOC1_SYNJA      KQGRFRQNLLGKRVDYSGRSVIVVGPNLRMHQCGLPKEMAIELFQPFVIHKLIKRGIVNN
RPOC1_SYNJB      KQGRFRQNLLGKRVDYSGRSVIVVGPNLRMHQCGLPKEMAIELFQPFVIHKLIKRGIVNN
RPOC1_GLOVI      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKLHQCGLPKEMAIELFQPFVIHKLIQRGLVNN
RPOC1_PROMT      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQNIVNN
RPOC1_PROM1      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQNIVNN
RPOC1_SYNS3      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQNIVNN
RPOC1_SYNPW      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQNIVNN
RPOC1_SYNPX      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQNIVNN
RPOC1_SYNS9      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQNIVNN
RPOC1_SYNSC      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQNIVNN
RPOC1_PROMM      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQNIVNN
RPOC1_PROM3      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQNIVNN
RPOC1_PROMA      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQNIVNN
RPOC1_PROM4      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQNIVNN
RPOC1_SYNR3      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQNIVNN
RPOC1_PROM0      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQNIVNN
RPOC1_PROM2      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQNIVNN
RPOC1_PROMS      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQNIVNN
RPOC1_PROM9      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQNIVNN
RPOC1_PROM5      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQNIVNN
RPOC1_PROMP      KQGRFRQNLLGKRVDYSGRSVIVVGPKLKMHQCGLPKEMAIELFQPFVIHRLIRQNIVNN
RPOC1_PAUCH      KQGRFRQNLLGKRVDYSGRSVIVVGPRLKIHQCGLPKEMAIELFQPFVIHRLIRQNIVNN
RPOC1_PYRYE      KQGRFRQNLLGKRVDYSGRSVIVVGPHLKLHQCGLPREMALELFQPFVIHRLILQGLVNN
RPOC1_PORPU      KQGRFRQNLLGKRVDYSGRSVIVVGPHLKLHQCGLPREMALELFQPFVIHRLILQGLVNN
RPOC1_GRATL      KQGRFRQNLLGKRVDYSGRSVIVVGPNLKLHQCGLPKEMALELFQPFVIHRLILQGLVNN
RPOC1_GUITH      KQGRFRQNLLGKRVDYSGRSVIVVGPQLELNQCGLPREMALELFQPFVIHKLIQQGLVNN
RPOC1_RHDSA      KQGRFRQNLLGKRVDYSGRSVIVVGPTLQLNQCGLPREMALELFQPFVIHKLIHQGLVNN
RPOC1_CYAPA      KQGRFRQNLLGKRVDYSGRSVIVVGLQLKLYQCGLPWEMAIELFQPFVIHRLIHQGLVNN
RPOC1_EMIHU      KQGRFRQNLLGKRVDYSGRSVIIVGPELKLNQCGLPSEMAIELFQPFVIHRLIYEGLVNN
RPOC1_CYACA      KQGRFRQNLLGKRVDYSGRSVIVVGPDLKLNECGIPKEMAIELFQPFLIHQIIKEGLANN
RPOC1_THAPS      KHGRFRQNLLGKRVDYSGRSVIVVGPSLKLNQCGLPYEMAIELFQPFIIRELINQGLASN
RPOC1_PHATC      KHGRFRQNLLGKRVDYSGRSVIVVGPSLRLNQCGLPYEMAIELFQPFIIRELINQGLASN
RPOC1_TRICV      KHGRFRQNLLGKRVDYSGRSVIVVGPSLRLNECGLPYEMALELFQPFLIREMINQGLASN
RPOC1_NEPOL      KQGRFRQNLLGKRVDYSGRSVIVVGPKLRLHQCGLPKEMALELFQPLVIRLLLKRKVAPN
RPOC1_OSTTA      KHGRFRQNLLGKRVDYSGRSVIVVGPKLRLHQCGLPREMALELFQPFVIRALLEESGVKN
RPOC1_PHYPA      KEGRFRENLLGKRVDYSGRSVIVVGPFLSLHQCGLPREMAIELFQAFVIRGLIGRHLAPN
RPOC1_MARPO      KEGRFRENLLGKRVDYSGRSVIVVGPFLPLHQCGLPREMAIELFQAFVIRGLIGRNFAPN
RPOC1_ANTAG      KEGRFRENLLGKRVDYSGRSVIVAGPYLPLHECGLPKEMAVELFQAFVIRGLIGRYLAPN
RPOC1_ANEMR      KEGRFRENLLGKRVDYSGRSVIVVGPSLPLHRCGLPREMAIELFQAFVIRGLIGRNLAPN
RPOC1_PSINU      KEGRFRENLLGKRVDYSGRSVIVVGPSLPLHRCGLPREMAIELFQAFVIRGLIGRYLAQN
RPOC1_ANGEV      KEGRFRENLLGKRVDYSGRSVIVVGPSLQLHQCGLPREMAIELFQSFVIRGLIGRHLARN
RPOC1_ADICA      KEGRFRENLLGKRVDYSGRSVIVVGPSLSLHQCGLPREMAIELFQAFVIRNLIGRHLACN
RPOC1_CUCSA      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFLIRGLIRQHFASN
RPOC1_MORIN      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHFASN
RPOC1_SOLBU      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_SOLTU      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_SOLLC      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_NICSY      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_TOBAC      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_ATRBE      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_NICTO      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_CUSEX      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHQCGLPREIAIELFQPFVIRDLIKQHLASN
RPOC1_CUSRE      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPRKIAIELFQPFVIRDLIRQHLASN
RPOC1_IPOPU      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_COFAR      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_JASNU      KEGRFRQTLLGKRVDYSGRSVIVVGPSLSLYRCGLPREIAIELFQTFVIRGLIRQDPASN
RPOC1_SPIOL      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_SILLA      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFIIRGLIRQHLASN
RPOC1_FAGEA      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQDLASN
RPOC1_LEPVR      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_CAPBU      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_BARVE      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_NASOF      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_ARATH      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_OLIPU      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_DRANE      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_LOBMA      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_ARAHI      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_SINAL      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_CRUWA      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_AETCO      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_AETGR      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_CARPA      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_GOSHI      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLAPN
RPOC1_GOSBA      KEGRFRETLLGRRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLAPN
RPOC1_POPTR      KEGRFRETMLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_POPAL      KEGRFRETMLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_MANES      KEGRFRETMLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQIFVIRGLIRQHLASN
RPOC1_CITSI      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHQCGLPREIAIELFQTFVICGLIRQHLASN
RPOC1_VITVI      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHQCGLPREIAIELFQTFLIRGLIRQHLASN
RPOC1_PHAAO      KEGRFRETLLGKRVDYSGRSVIVVGPLLSLHQCGLPREIAIELFQAFVIRGLIRQDVASN
RPOC1_DIOEL      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHQCGLPREIAIELFQTFLIHGLIKQHVASN
RPOC1_LEMMI      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHQCGLPREIAIELFQTFVIRGLIRQHVASN
RPOC1_ACOAM      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_ACOCL      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_ACOGR      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_NYMAL      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHQCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_NUPAD      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQNLASN
RPOC1_AMBTC      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHVASN
RPOC1_ILLOL      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQRVASN
RPOC1_CHLSC      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHVASN
RPOC1_CALFG      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHVASN
RPOC1_LIRTU      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHVASN
RPOC1_DRIGR      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHIASN
RPOC1_CERDE      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQQIASN
RPOC1_PIPCE      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFLIRGLIRQRVASN
RPOC1_NANDO      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHAASN
RPOC1_RANMC      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFHTFVIRGLIRQHIASN
RPOC1_PLAOC      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_BUXMI      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHVASN
RPOC1_OENAR      KEGRFRETLLGKRVDYSGRSVIVVGPTLPLHRCGLPREIAIELFQTFLIRGLIRQHLASD
RPOC1_OENBI      KEGRFRETLLGKRVDYSGRSVIVVGPTLPLHRCGLPREIAIELFQTFLIRGLIRQHLASD
RPOC1_OENPA      KEGRFRETLLGKRVDYSGRSVIVVGPTLPLHRCGLPREIAIELFQTFLIRGLIRQHLASD
RPOC1_OENEH      KEGRFRETLLGKRVDYSGRSVIVVGPTLPLHRCGLPREIAIELFQTFLIRGLIRQHLASD
RPOC1_OENGL      KEGRFRETLLGKRVDYSGRSVIVVGPTLPLHRCGLPREIAIELFQTFLIRGLIRQHLASD
RPOC1_EUCGG      KEGRFRETLLGKRVDYSGRSVIVVGPSLPLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_PANGI      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASN
RPOC1_DAUCA      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLYQCGLPREIAIELFQTFVIRSLIRQQLASN
RPOC1_SOYBN      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFLIRGLIRKHFASN
RPOC1_PHAVU      KEGRFRETLLGKRVDYSGRSVIIVGPSLSLHRCGLPGEIAIELFQTFLIRGLIRKHFASN
RPOC1_LOTJA      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFLIRSLIRKHFASN
RPOC1_HELAN      KEGRVRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQAFVIRDLIRKHLASN
RPOC1_GUIAB      KEGRVRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQAFVIRDLIRKHLASN
RPOC1_LACSA      KEGRVRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQAFVIRDLIRKHLASN
RPOC1_AGRST      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHQCGLPLEIAIKLFQLFVIRDLITKRATSN
RPOC1_BRADI      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHQCGLPLEIAIKLFQLFVIRDLITKRATSN
RPOC1_WHEAT      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHQCGLPLEIAIKLFQLFVIRDLITKRATSN
RPOC1_HORVU      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHQCGLPLEIAIKLFQLFVIRDLITKRATSN
RPOC1_LOLPR      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHQCGLPLEIAIKLFQLFVIRDLITKRATSN
RPOC1_ORYNI      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHQCGLPLEIAIKLFQLFVIRDLITKRATSN
RPOC1_ORYSA      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHQCGLPLEIAIKLFQLFVIRDLITKRATSN
RPOC1_ORYSI      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHQCGLPLEIAIKLFQLFVIRDLITKRATSN
RPOC1_ORYSJ      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHQCGLPLEIAIKLFQLFVIRDLITKRATSN
RPOC1_SACHY      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHQCGLPLEIAIKLFQLFVIRDLITKRATSN
RPOC1_SACOF      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHQCGLPLEIAIKLFQLFVIRDLITKRATSN
RPOC1_SORBI      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHQCGLPLEIAIKLFQLFVIRDLITKRATSN
RPOC1_MAIZE      KEGRFRETLLGKRVDYSGRSVIVVGPSLSLHQCGLPLEIAIKLFQLFVIRDLITKRATSN
RPOC1_PELHO      KEGRFRQTLLGRRVDYSGRSVIVVGPSLALHQCGLPREIALELFQTFIIRSLIRQRLASS
RPOC1_PINKO      KEGRFRENLLGKRVDYSGRSVIVVGPFLSLYQCGLPSEIAIELFQAFVIRSLIGRHIAPN
RPOC1_PINTH      KEGRFRENLLGKRVDYSGRSVIVVGPFLSLYQCGLPSEIAIELFQAFLIRSLIGRHIAPN
RPOC1_CYCTA      KEGRSRENLLGKRVDYSGRSVIVVGPSLPLHQCGLPREIAIELFQAFVIRGLIRRHFAPN
RPOC1_WELMI      KEGRFRANLLGKRVDYSGRSVIVVGPSLALHQCGLPREMAIKLFQPFLIRNLIRRGVAPN
RPOC1_GNEPA      KEGRFRANLLGKRVDYSARSVIVVGPSLALHQCGLPRELAIKLFQPFLIRNLIGQGVVAN
RPOC1_CRYJA      KEGRFRENLLGKRVDYSGRSVIVVGPLLSLYQCGLPREIAIELFQAFLIRDLVERQIAPN
RPOC1_HUPLU      KEGRFRENLLGKRVDYSARSVIVVGPSLPLHQCGLPQEIAMELFQPFMIRNSIERNLVPS
RPOC1_CHAGL      KEGRFRQDLLGKRVDYSGRSVIVVGPSLSLHQCGIPKDMAIELFQPFIIRDLINCQLAPN
RPOC1_STAPU      KKGRFRENLLGKRVDYSGRSVIVVGPLLALHECGLPREMALELFQPFIIRELITRQLAPN
RPOC1_ZYGCR      KKGRFRENLLGKRVDYSGRSVIVVGPYLSLYQCGLPREMAIELFQPFVIRGLIINHFARN
RPOC1_CHAVU      KQGRFRQNLLGKRVDYSGRSVIVVGPHLKIYQCGLPKNMAIELFQPFLIHYMINKKLASN
RPOC1_OEDCA      KKGRFRQNLLGKRVDYSGRSVIVVGPKLKLHECGLPIEMAIELFLPFLIKEILKNKYALT
RPOC1_OLTVI      KKGRFRQNLLGKRVDYSGRSVIVVGPKLKLHECGLPKEMAIELFQPFLIRQLRTNKIAAT
RPOC1_TUPAK      KKGRFRQNLLGKRVDYSGRSVIVVGPKLRLHECGLPKEMAIELFQPFLIRRLIFKEVATN
RPOC1_TETOB      KQGRFRQYLLGKRVDYSGRSVIVVGPELKLYECGLPKEMALELFLPFLIQYILQNKLAQT
RPOC1_BIGNA      KRGRFRQNLLGKRVDYSGRSVIIVDPELKLHECGIPLKMAIELFYPFIIQYLISFNLTKT
                 *.** *  :**:*****.****:..  * : .**:* .:*::**  ::*           

RPOC1_MESVI      IKGAKKIIQNS-----------DPILWEILNQVIQGHPVLLNRAPTLHRLGIQAFEPILV
RPOC1_CHLAT      IKAAKRKLQNN-----------DPSIWEVLKQVIQGHPVLLNRAPTLHRLGIQAFEPILV
RPOC1_CYAP4      IKAAKRLIQRN-----------DPIIWEVLEEVIDGHPVLLNRAPTLHRLGIQAFEPILV
RPOC1_ACAM1      IKAAKRLIQRN-----------DPVIWDVLEEVIEGHPVMLNRAPTLHRLGIQAFEPILV
RPOC1_THEEB      IKAAKRMIQRN-----------DPQIWDVLEEVIEGHPVLLNRAPTLHRLGIQAFEPILV
RPOC1_TRIV2      IKAAKKLISRN-----------DPSVWDVLEEVIEGHPVMLNRAPTLHRLGIQAFEPILV
RPOC1_NOSS1      IKAAKKLISRN-----------DPSVWDVLEEVIEGHPVMLNRAPTLHRLGIQAFEPILV
RPOC1_NOSP7      IKAAKKLISRN-----------DPSVWDVLEEVIEGHPVMLNRAPTLHRLGIQSFEPILV
RPOC1_NOSCO      IHQAAPMISRN-----------DPSVWDVLEEVIEGHPVMLNRAPTLHRLGIQSFEPILV
RPOC1_SYNE7      IKQAKKLIQKN-----------DPLIWDVLEEVIEGHPVMLNRAPTLHRLGIQAFEPILV
RPOC1_SYNP6      IKQAKKLIQKN-----------DPLIWDVLEEVIEGHPVMLNRAPTLHRLGIQAFEPILV
RPOC1_RIPO1      IKAAKKLIMRE-----------DPSVWTVLEEVITGHPVLLNRAPTLHRLGIQAFEPILV
RPOC1_CROS5      IKAAKKLIIKG-----------DPSVWNVLEEVITGHPVLLNRAPTLHRLGIQAFEPILV
RPOC1_MICAN      IKAAKKMIQRG-----------DANVWHVLDEVITGHPVMLNRAPTLHRLGIQAFEPILV
RPOC1_SYNY3      IKAAKKLILKG-----------DPQIWSVLEEVITGHPVMLNRAPTLHRLGIQAFEPILV
RPOC1_GLOC7      IKAAKKMIQRG-----------DPQVWNVLEEVITGHPVLLNRAPTLHRLGIQAFEPILV
RPOC1_SYNP2      IKAAKKLIQRG-----------DESVWDVLAEVITGHPVLLNRAPTLHRLGIQAFEPILV
RPOC1_TRIEI      IKAAKKLIQKG-----------DPNVWDVLEEVIDGHPVMLNRAPTLHRLGIQAFEPILV
RPOC1_SYNJA      IKAAKKLIQSN-----------DPQVWDVLEDVIDGHPVLLNRAPTLHRLGIQAFEPILV
RPOC1_SYNJB      IKAAKKMIQSN-----------DPQIWDVLEEVIDGHPVLLNRAPTLHRLGIQAFEPILV
RPOC1_GLOVI      IKAAKKMIQRN-----------DARIWSVLDEVITGHPVLLNRAPTLHRLGIQAFEPILV
RPOC1_PROMT      IKAAKKLIQKA-----------DDEVMQVLQEVIEGHPILLNRAPTLHRLGIQAFEPKLV
RPOC1_PROM1      IKAAKKLIQKA-----------DDEVMQVLQEVIEGHPILLNRAPTLHRLGIQAFEPKLV
RPOC1_SYNS3      IKAAKKLIQRA-----------DDEVMQVLQEVIDGHPIMLNRAPTLHRLGIQAFEPKLV
RPOC1_SYNPW      IKAAKKLIQRA-----------DDEVMQVLQEVIDGHPIMLNRAPTLHRLGIQAFEPKLV
RPOC1_SYNPX      IKAAKKLIQRA-----------DDEVMQVLQEVIDGHPIMLNRAPTLHRLGIQAFEPKLV
RPOC1_SYNS9      IKAAKKLIQRA-----------DDEVMQVLQEVIDGHPIMLNRAPTLHRLGIQAFEPKLV
RPOC1_SYNSC      IKAAKKLIQRA-----------DDEVMQVLQEVIEGHPILLNRAPTLHRLGIQAFEPKLV
RPOC1_PROMM      IKAAKKLIQRA-----------DDEVMQVLQEVIEGHPILLNRAPTLHRLGIQAFEPKLV
RPOC1_PROM3      IKAAKKLIQRA-----------DDEVMQVLQEVIEGHPILLNRAPTLHRLGIQAFEPKLV
RPOC1_PROMA      IKAAKKLIQRA-----------DDEVMQVLQEVIEGHPILLNRAPTLHRLGIQAFEPKLV
RPOC1_PROM4      IKAAKKLIQRA-----------DDEVMQVLQEVIDGHPILLNRAPTLHRLGIQAFEPKLV
RPOC1_SYNR3      IKAAKKLIQRA-----------DDEVMQVLQEVIDGHPILLNRAPTLHRLGIQAFEPKLV
RPOC1_PROM0      IKAAKKLIQKA-----------DDEVMQVLQEVIEGHPILLNRAPTLHRLGIQAFEPKLV
RPOC1_PROM2      IKAAKKLIQKA-----------DDEVMQVLQEVIDGHPILLNRAPTLHRLGIQAFEPKLV
RPOC1_PROMS      IKAAKKLIQKA-----------DDEVMQVLQEVIEGHPILLNRAPTLHRLGIQAFEPKLV
RPOC1_PROM9      IKAAKKLIQKA-----------DDEVMQVLQEVIEGHPILLNRAPTLHRLGIQAFEPKLV
RPOC1_PROM5      IKAAKKLIQKA-----------DDEVMQVLQEVIEGHPILLNRAPTLHRLGIQAFEPKLV
RPOC1_PROMP      IKAAKKLIQKG-----------DDEVMQVLQEVIEGHPILLNRAPTLHRLGIQAFEPKLV
RPOC1_PAUCH      IKAAKKLIQRA-----------DDEVMQVLQEVIEGHPILLNRAPTLHRLGIQAFEPKLV
RPOC1_PYRYE      IKAAKKMIQKN-----------ESSIWNVLNEVIQGHPVLLNRAPTLHRLGIQAFEPILV
RPOC1_PORPU      IKAAKKMIQKN-----------ESSIWNVLNEVIQGHPVLLNRAPTLHRLGIQAFEPILV
RPOC1_GRATL      IKAAKKIIQRN-----------EVVVWTVLQEVIYGHPVLLNRAPTLHRLGIQAFEPILV
RPOC1_GUITH      IKAAKRLIQKN-----------ELIVWNVLEEVIQGHPILLNRAPTLHRLGIQAFEPILV
RPOC1_RHDSA      IKAAKKMIQKN-----------DSVIWSVLEEVIQGHPVLLNRAPTLHRLGIQAFEPILV
RPOC1_CYAPA      IKAAKKLIQSN-----------DPIIRDILEEVIQNHPVLLNRAPTLHRLSIQAFEPILV
RPOC1_EMIHU      IKAAKSIIQKN-----------GPLAWEILANVMEGHPILLNRAPTLHRLGIQSFEPILV
RPOC1_CYACA      MKSAKKLMQKH-----------TSVTIELLQKIIKWHPVLLNRAPTLHRLGIQAFDPVLV
RPOC1_THAPS      MKVAKNLLQQN-----------EPIINPVLEKVLANHPIFLNRAPTLHRLGIQAFQPIIV
RPOC1_PHATC      MKIAKNLIQQN-----------ESIIDPVLEKVLKSHPIFLNRAPTLHRLGIQAFEPILV
RPOC1_TRICV      MKIARNLIEQN-----------EAIIDPVLEKVLSNHPIFLNRAPTLHRLGIQAFEPILV
RPOC1_NEPOL      IRYAKKLMHHAVARGPENPTIIDAVVWDTLAAVVEGYPILLNRAPTLHRLGIQAFEPVLI
RPOC1_OSTTA      IRAAKNLLQRR-----------SQMVWDILDTVVLGHPVLLNRAPTLHRLGIQAFEPILL
RPOC1_PHYPA      LRAAKSMIQNK-----------EPIIWKILQEIMQGHPVLLNRAPTLHRLGIQAFQPILI
RPOC1_MARPO      LRAAKTMIQNK-----------EPIIWKVLQEVMQGHPILLNRAPTLHRLGIQAFQPILV
RPOC1_ANTAG      LRAAKSMIQDK-----------EPIIWKILKEVIQGHPVLLNRAPTLHRLGIQAFEPILV
RPOC1_ANEMR      LRAAKTMIRGN-----------KPMIWKILQEVIEEHPILLNRAPTLHRLGIQAFQPVLV
RPOC1_PSINU      LRDAKNMIQNK-----------EPIIWKILRDVMQGHPVLLNRAPTLHRLGIQAFQPILI
RPOC1_ANGEV      LRDAKNIIRNK-----------EIFIWKILQEVMQGHPVLLNRAPTLHRLGIQAFQPVLI
RPOC1_ADICA      LRAAKCMIRKG-----------NPIIWEVLREVMRGHPVLLNRAPTLHRLGIQAFQPLLI
RPOC1_CUCSA      IGVAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_MORIN      IGVAKSKIREK-----------EPVVWEILQDVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_SOLBU      IGVAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPVLV
RPOC1_SOLTU      IGVAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPVLV
RPOC1_SOLLC      IGVAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPVLV
RPOC1_NICSY      IGVAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPVLV
RPOC1_TOBAC      IGVAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPVLV
RPOC1_ATRBE      IGVAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPVLV
RPOC1_NICTO      IGVAKSQIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPVLV
RPOC1_CUSEX      IGVAKSKIREK-----------EPIIWEILQDVMQGHPVLLNRAPTLHRLGIQAFQPVLV
RPOC1_CUSRE      IGVAKSKIREK-----------EPIIWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPVLV
RPOC1_IPOPU      IGVAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPVLV
RPOC1_COFAR      IGVAKNKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPVLV
RPOC1_JASNU      IKVAKSQIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPVLV
RPOC1_SPIOL      IGVAKRKIREK-----------EPIVWKILQEVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_SILLA      IGVAKSKIREK-----------EPIIWKILQEVMQGHPILLNRAPTLHRLGIQAFQPILV
RPOC1_FAGEA      IGVAKSKIREN-----------EPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPTLV
RPOC1_LEPVR      IGVAKSQIREK-----------KPIVWEILQEVMQGHPVLLNRAPTLHRLGIQSFQPILV
RPOC1_CAPBU      IGVAKSQIREK-----------KPIVWEILQEVMQGHPVLLNRAPTLHRLGIQSFQPILV
RPOC1_BARVE      IGVAKSQIREK-----------KPIVWEILQEVMQGHPVLLNRAPTLHRLGIQSFQPILV
RPOC1_NASOF      IGVAKSQIREK-----------KPIVWEILQEVMQGHPVLLNRAPTLHRLGIQSFQPILV
RPOC1_ARATH      IGVAKSQIREK-----------KPIVWEILQEVMQGHPVLLNRAPTLHRLGIQSFQPILV
RPOC1_OLIPU      IGVAKSQIREK-----------KPIVWEILQEVMQGHPVLLNRAPTLHRLGIQSFQPILV
RPOC1_DRANE      IGVAKSQIREK-----------KPIVWEILQEVMQGHPVLLNRAPTLHRLGIQSFQPILV
RPOC1_LOBMA      IGVAKSQIREK-----------KPIVWEILQEVMQGHPVLLNRAPTLHRLGIQSFQPILV
RPOC1_ARAHI      IGVAKSQIREK-----------KPVVWEILQEVMQGHPVLLNRAPTLHRLGIQSFQPILV
RPOC1_SINAL      IGVAKSQIREK-----------KPIVWEILQEVMQGHPVLLNRAPTLHRLGIQSFQPILV
RPOC1_CRUWA      IGVAKSQIREK-----------KPIVWEILQEVMQGHPVLLNRAPTLHRLGIQSFQPILV
RPOC1_AETCO      IGVAKSQIREN-----------KPIVWEILQEVMQGHPVLLNRAPTLHRLGIQSFQPILV
RPOC1_AETGR      IGVAKSQIREN-----------KPIVWEILQEVMQGHPVLLNRAPTLHRLGIQSFQPILV
RPOC1_CARPA      MGVAKSKIREK-----------EPIIWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_GOSHI      IGVAKSKIREK-----------GPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_GOSBA      IGVAESKIREK-----------GPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_POPTR      IGVAKSKIREK-----------EPIVWGILQEVMRGHPILLNRAPTLHRLGIQAFQPILV
RPOC1_POPAL      IGVAKSKIREK-----------EPIVWGILQEVMRGHPILLNRAPTLHRLGIQAFQPILV
RPOC1_MANES      IGVAKSKIREK-----------EPIVWEILHEVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_CITSI      IGVAKSKIREK-----------GPIIWEILQEVMQGHPVLLNRAPTLHRLGVQAFQPILV
RPOC1_VITVI      IGVAKSQIREK-----------EPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_PHAAO      TGIAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_DIOEL      IGIAKSKIREK-----------EPIVWEILQEVMRGHPILLNRAPTLHRLGIQAFQPILV
RPOC1_LEMMI      IGIAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_ACOAM      IGIAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPVLV
RPOC1_ACOCL      IGIAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPVLV
RPOC1_ACOGR      IGIAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPVLV
RPOC1_NYMAL      IGLAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_NUPAD      IGLAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_AMBTC      IGIAKSKIREK-----------EPIVWEILQKVMEGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_ILLOL      IGIAKSKIREK-----------EPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPIIG
RPOC1_CHLSC      IGIAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_CALFG      IGIAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_LIRTU      IGIAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_DRIGR      IGIAKNKIREK-----------EPIVWEILQEVMQGHPILLNRAPTLHRLGIQAFQPILA
RPOC1_CERDE      IGIAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_PIPCE      IGIAKSKIREK-----------EPIVWEILQEIMRGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_NANDO      IGVAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_RANMC      IGVAKSKIREK-----------APIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_PLAOC      IGVAKSKIRER-----------EPIVWEILQKVIQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_BUXMI      IGVAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_OENAR      IVGAKSQIREK-----------EPIVWEILQQVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_OENBI      IVGAKSQIREK-----------EPIVWEILQQVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_OENPA      IVGAKSQIREK-----------EPIVWEILQQVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_OENEH      IVGAKSQIREK-----------EPIVWEILQQVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_OENGL      IVGAKSQIREK-----------EPIVWEILQQVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_EUCGG      IGVAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_PANGI      IGVAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPVLV
RPOC1_DAUCA      IGVAKSKIREK-----------KPIVWEILREVMRGHPVLLNRAPTLHRLGIQAFQPVLV
RPOC1_SOYBN      IGIAKSKIREK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_PHAVU      IGIAKSKIRQK-----------EPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_LOTJA      IGVAKSKIREK-----------EPIVWEILQEVMRGHPILLNRAPTLHRLGIQAFQPILV
RPOC1_HELAN      IGVAKSQIRKK-----------KPIVWEILQEILDDHPVLLNRAPTLHRLGIQAFLPVLV
RPOC1_GUIAB      IGVAKSQIRKK-----------KPIVWEILQEILDDHPVLLNRAPTLHRLGIQAFLPILV
RPOC1_LACSA      IGVAKSQIRKK-----------KPIVWEILQEILDDHPVLLNRAPTLHRLGIQAFLPVLV
RPOC1_AGRST      VRIAKRKIWEK-----------EPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPTLV
RPOC1_BRADI      VRIAKRKIWEK-----------EPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPTLV
RPOC1_WHEAT      VRIAKRKIWEK-----------EPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPTLV
RPOC1_HORVU      VRIAKRKIWEK-----------EPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPTLV
RPOC1_LOLPR      VRIAKRKIWEK-----------EPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPTLV
RPOC1_ORYNI      VRIAKRKIWEK-----------EPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPTLV
RPOC1_ORYSA      VRIAKRKIWEK-----------EPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPTLV
RPOC1_ORYSI      VRIAKRKIWEK-----------EPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPTLV
RPOC1_ORYSJ      VRIAKRKIWEK-----------EPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPTLV
RPOC1_SACHY      VRIAKRKIWEK-----------EPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPTLV
RPOC1_SACOF      VRIAKRKIWEK-----------EPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPTLV
RPOC1_SORBI      VRIAKRKIWEK-----------EPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPTLV
RPOC1_MAIZE      VRIAKRKIWEK-----------EPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPTLV
RPOC1_PELHO      VKTAKKQIREQ-----------ERIVWDILEEVVQEHPVLLNRAPTLHRLGIQAFQPILT
RPOC1_PINKO      LRAAKSMIRDK-----------GPIVWEVLQEVMQGHPVLLNRAPTLHKLGIQAFQPILV
RPOC1_PINTH      LRTAKSMIRDK-----------GPIVWEVLQEVMQGHPILLNRAPTLHKLGIQAFQPILV
RPOC1_CYCTA      LRAAKSIIRDK-----------EPIVWEVLQGVMQGHPVSLNRAPTLHRLGIQAFQPILV
RPOC1_WELMI      IRAAKSLIQGR-----------KPFIWKILQRVMLGHPVLLNRAPTLHKFGILAFQPILV
RPOC1_GNEPA      IRAAKLLIQRR-----------IPVVWKILQQILLGHPVLLNRAPTLHKFGILAFQPILV
RPOC1_CRYJA      LRAAKFLIRDR-----------GPIIWNVLKQIMQKHPILLNRAPTLHRLGIQAFIPVLI
RPOC1_HUPLU      VRAAKLMIQNK-----------LPFLWKILQEVMYGHPILLNRAPTLHRLGIQAFEPILA
RPOC1_CHAGL      LRAARSMIQNQ-----------EPIIFKILEKIIKNHPILLNRAPTLHRLGIQAFQPILV
RPOC1_STAPU      LRAAKSMIQNK-----------EPIIWKVLQVIVQNRLVLLNRAPTLHRLGIQAFQPVLV
RPOC1_ZYGCR      PRAAKSMIQRR-----------HPIVWKILKMIVDDHLVILNRAPTLHRLGVQAFQPVLV
RPOC1_CHAVU      LRVAKSIIQSK-----------HPIVWFILKEVIKKHPVLLNRAPTLHRLGIQAFQPILV
RPOC1_OEDCA      VRSAKIYIKKH-----------RIKITQLLRQVVKRQPILLNRAPTLHRLGIQAFLPKLV
RPOC1_OLTVI      IVGAKKLIRSG-----------DQIIWEVLKQVLQNHPILLNRAPTLHRLGIQAFQPKLV
RPOC1_TUPAK      FISAKKLIKSN-----------PESILDILREVMENRPVLLNRAPTLHRLGIQAFQPKLI
RPOC1_TETOB      VVGAKNLLKSD-----------SNLTLHLLHKVIKNIPILLNRAPTLHRLGFQAFLPKLI
RPOC1_BIGNA      IPGAKHIIHTK-----------ASFLNEIIHFVLNNYLVLLNRAPTLHKLGIQAFKPKLV
                    *   :                     :  ::    : ********::.. :* * : 

RPOC1_MESVI      EGRAIQLHPLVCPAFNADFDGDQMAVHIPLSLEAQTEARLLMLASSNLLSPATGLPIISP
RPOC1_CHLAT      EGRAIQLHPLVCPAFNADFDGDQMAVHIPLSLEAQTEARLLMLASSNLLSPATGQPIIAP
RPOC1_CYAP4      DGRAIQLHPLVCPAFNADFDGDQMAVHVPLSIESQAEARLLMLASNNILSPATGKPIVTP
RPOC1_ACAM1      DGRAIQLHPLVCPAFNADFDGDQMAVHVPLSIEAQSEARLLMLASNNILSPATGRPIVTP
RPOC1_THEEB      EGRAIQLHPLVCPAFNADFDGDQMAVHVPLSIEAQAEARMLMLASNNILSPATGKPIITP
RPOC1_TRIV2      EGRAIQLHPLVCPAFNADFDGDQMAVHVPLSLESQAEARLLMLASNNILSPATGRPIITP
RPOC1_NOSS1      EGRAIQLHPLVCPAFNADFDGDQMAVHVPLSLESQAEARLLMLASNNILSPATGRPIITP
RPOC1_NOSP7      EGRAIQLHPLVCPAFNADFDGDQMAVHVPLSLESQAEARLLMLASNNILSPATGKPIITP
RPOC1_NOSCO      EGRAIQLHPLVCPAFNADFDGDQMAVHVPLSLESQAEARLLMLASNNILSPATGKPIITP
RPOC1_SYNE7      EGRAIQLHPLVCPAFNADFDGDQMAVHVPLSIEAQAEARMLMLASGNILSPATGQPIVTP
RPOC1_SYNP6      EGRAIQLHPLVCPAFNADFDGDQMAVHVPLSIEAQAEARMLMLASGNILSPATGQPIVTP
RPOC1_RIPO1      EGRAIQLHPLVCPAFNADFDGDQMAVHVPLSLEAQSEARLLMLACHNILSPATGKPIVAP
RPOC1_CROS5      EGRAIQLHPLVCPAFNADFDGDQMAVHVPLSLESQAEARLLMLACHNILSPATGKPIVAP
RPOC1_MICAN      EGRAIQLHPLVCPAFNADFDGDQMAVHIPLSLEAQSEARLLMLACHNILSPATGRPIVAP
RPOC1_SYNY3      EGRAIQLHPLVCPAFNADFDGDQMAVHVPLSLEAQCEARLLMLACHNVLSPATGKPIVAP
RPOC1_GLOC7      EGRAIQLHPLVCPAFNADFDGDQMAVHVPLSLESQSEARLLMLACHNILSPATGRPIVAP
RPOC1_SYNP2      EGRAIQLHPLVCPAFNADFDGDQMAVHVPLSLEAQAEARLLMLACHNILSPATGKPIVAP
RPOC1_TRIEI      EGRAIQLHPLVCPAFNADFDGDQMAVHVPLSLESQAEARLLMLASNNVLSPATGRPIITP
RPOC1_SYNJA      EGRAIQLHPLVCPAFNADFDGDQMAVHVPLSLEAQAEARLLMLATNNILSPATGAPIITP
RPOC1_SYNJB      EGRAIQLHPLVCPAFNADFDGDQMAVHVPLSLEAQAEARLLMLATNNILSPATGAPIITP
RPOC1_GLOVI      SGRAIQLHPLVCTAFNADFDGDQMAVHVPLSLESQAEARLLMLASNNVLSPATGRPIITP
RPOC1_PROMT      AGRAIQLHPLVCPAFNADFDGDQMAVHVPLAIEAQTEARMLMLASNNILSPATGDPIVTP
RPOC1_PROM1      AGRAIQLHPLVCPAFNADFDGDQMAVHVPLAIEAQTEARMLMLASNNILSPATGDPIVTP
RPOC1_SYNS3      DGRAIQLHPLVCPAFNADFDGDQMAVHVPLAIEAQTEARMLMLASNNILSPATGDPIITP
RPOC1_SYNPW      DGRAIQLHPLVCPAFNADFDGDQMAVHVPLAIEAQTEARMLMLASNNILSPATGEPIITP
RPOC1_SYNPX      DGRAIQLHPLVCPAFNADFDGDQMAVHVPLAIEAQTEARMLMLASNNILSPATGEPIVTP
RPOC1_SYNS9      DGRAIQLHPLVCPAFNADFDGDQMAVHVPLAIEAQTEARMLMLASNNILSPATGEPIITP
RPOC1_SYNSC      DGRAIQLHPLVCPAFNADFDGDQMAVHVPLAIEAQTEARMLMLASNNILSPATGEPIITP
RPOC1_PROMM      DGRAIQLHPLVCPAFNADFDGDQMAVHVPLAIESQTEARMLMLASNNILSPATGDPIITP
RPOC1_PROM3      AGRAIQLHPLVCPAFNADFDGDQMAVHVPLAIEAQTEARMLMLASNNILSPATGDPIITP
RPOC1_PROMA      AGRAIQLHPLVCPAFNADFDGDQMAVHVPLAIEAQTEARMLMLASNNILSPATGEPIVTP
RPOC1_PROM4      DGRAIQLHPLVCPAFNADFDGDQMAVHVPLAIESQTEARMLMLASNNILSPATGEPIVTP
RPOC1_SYNR3      DGRAIQLHPLVCPAFNADFDGDQMAVHVPLALEAQTEARMLMLASNNILSPATGQPIITP
RPOC1_PROM0      GGRAIQLHPLVCPAFNADFDGDQMAVHVPLALEAQTEARMLMLASNNILSPATGEPIVTP
RPOC1_PROM2      GGRAIQLHPLVCPAFNADFDGDQMAVHVPLALEAQTEARMLMLASNNILSPATGEPIVTP
RPOC1_PROMS      GGRAIQLHPLVCPAFNADFDGDQMAVHVPLALEAQTEARMLMLASNNILSPATGEPIVTP
RPOC1_PROM9      GGRAIQLHPLVCPAFNADFDGDQMAVHVPLALESQTEARMLMLASNNILSPATGEPIVTP
RPOC1_PROM5      GGRAIQLHPLVCPAFNADFDGDQMAVHVPLALEAQTEARMLMLASNNILSPATGEPIVTP
RPOC1_PROMP      GGRAIQLHPLVCPAFNADFDGDQMAVHVPLALEAQTEARMLMLASNNILSPATGEPIVTP
RPOC1_PAUCH      DGRAIQLHPLVCPAFNADFDGDQMAVHVPLSIEAQTEARILMLASANILSPATGEPVITP
RPOC1_PYRYE      EGRAIKLHPLVCPAFNADFDGDQMAVHVPLSLEAQAEARLLMLAPHNFLSPATGQPIIMP
RPOC1_PORPU      EGRAIKLHPLVCPAFNADFDGDQMAVHVPLSLEAQAEARLLMLAPHNFLSPATGQPIIMP
RPOC1_GRATL      EGRAIKLHPLVCPAFNADFDGDQMAVHVPLSLEAQAEARLLMLAPHNFLSPATGQPILMP
RPOC1_GUITH      EGRAIKLHPLVCPAFNADFDGDQMAVHIPLSLEAQAEARMLMLAPYNFLSPATGDPIIMP
RPOC1_RHDSA      EGRAIKLHPLVCPAFNADFDGDQMAVHIPLSLEAQAEARLLMLAPYNFLSPATGEPIIMP
RPOC1_CYAPA      EGRAIQLHPLVCPAFNADFDGDQMAVHVPLSLEAQTEARLLMLASNNLLSPATGQPIVTP
RPOC1_EMIHU      SGRAIRLHPLVCPAFNADFDGDQMAVHIPLSLEAQSEARLLMLAPNNFLSPATGDAILTP
RPOC1_CYACA      DGRAIRLHPLVCPAFNADFDGDQMAVHIPLSIEAQTEARLLMLAPNNFLSPATGQPIITP
RPOC1_THAPS      QGRAIKLHPLVCSAFNADFDGDQMAVHVPLSLEAQAECYMLMLAPYNFLSPANGEPIIMP
RPOC1_PHATC      QGRAIKLHPLVCSAFNADFDGDQMAVHIPLSLEAQAECYMLMLAPYNFLSPANGEPIIMP
RPOC1_TRICV      QGRAIKLHPLVCSAFNADFDGDQMAVHIPLSLESQSECYMLMLAPYNFLSPANGEPIILP
RPOC1_NEPOL      NGRAIQLHPLVCTGFNADFDGDQMGVHIPLSAEARAEAKLLMLASHNLLSPATGQPIVVP
RPOC1_OSTTA      SGRAIQLHPLVCPAFNADFDGDQMAVHVPLGLEAQAEARLLMLATHNWLSPATGEPSILP
RPOC1_PHYPA      KGRAIRLHPLVCGGFNADFDGDQMAVHIPLSLEAQAEARLLMFSHTNLLSPATGDPVSVP
RPOC1_MARPO      NGRAIHLHPLVCGGFNADFDGDQMAVHIPLSLEAQAEARLLMLSHKNLLSPATGEPISVP
RPOC1_ANTAG      EGRAIRLHPLVCAGFNADFDGDQMAVHIPLSLEAQVEARLLMFSHTNLLSPVTGNPVSVP
RPOC1_ANEMR      HGRAIHLHPLVCSGFNADFDGDQMAVHVPLSLEAQVEARLLMLSRRNVLSPATGEPLCIP
RPOC1_PSINU      EGRAIRLHPLVCGGFNADFDGDQMAVHVPLSLEAQAEARFLMLSHTNLLSPATGDPIAVP
RPOC1_ANGEV      EGRAIRLHPLVCGGFNADFDGDQMAVHVPLSIEAQTEARVLMFSHTNLLSPATGDPIAVP
RPOC1_ADICA      EGRAIRLHPLVRGGFNADFDGDQMAVHVPLSVEAQIEARLLMFSHLNLLSPATGDPVSVP
RPOC1_CUCSA      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSSAIGDPISVP
RPOC1_MORIN      EGHAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHTNLLSPAIGDPISVP
RPOC1_SOLBU      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQVEARLLMFSHMNLLSPAIGDPISVP
RPOC1_SOLTU      EGRAICLHPLVCKGFHADFDGDQMDFKVPLSLEAQVEARLLMFSHMNLLSPAIGDPISVP
RPOC1_SOLLC      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQVEARLLMFSHMNLLSPAIGDPISVP
RPOC1_NICSY      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQVEARLLMFSHMNLLSPAIGDPISVP
RPOC1_TOBAC      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQVEARLLMFSHMNLLSPAIGDPISVP
RPOC1_ATRBE      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQVEARLLMFSHMNLLSPAIGDPISVP
RPOC1_NICTO      AGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQVEARLLMFSHMNLLSPAIGDPISVP
RPOC1_CUSEX      EGRVICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_CUSRE      EGHVLCLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_IPOPU      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQVEARLLMFSHMNLLSPAIGDPISVP
RPOC1_COFAR      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_JASNU      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISIP
RPOC1_SPIOL      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_SILLA      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQTEARLLMFSHMNLLSPAIGDPISVP
RPOC1_FAGEA      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_LEPVR      EGRTICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_CAPBU      EGRTICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_BARVE      EGRTICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_NASOF      EGRTICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_ARATH      EGRTICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_OLIPU      EGRTICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_DRANE      EGRTICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_LOBMA      EGRTICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_ARAHI      EGRTICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_SINAL      EGRTICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_CRUWA      EGRTICLHPLVCKGFNADFDGDQMADHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_AETCO      EGRTICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_AETGR      EGRTICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_CARPA      EGRAICLHPLVRKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_GOSHI      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_GOSBA      EGRAICLHPLVCKGFNADFDGDQMAV--PFSLEMQAEARLLMFSHMNLFSPAIGDPISIL
RPOC1_POPTR      EGRAICLHPLVRKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_POPAL      EGRAICLHPLVRKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_MANES      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_CITSI      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPTIGDPISIP
RPOC1_VITVI      EGRAICLHPLVRKGFNADFDGDQMAVHVPLSLEAQSEARLLMFSHMNLLSPAIGDPISVP
RPOC1_PHAAO      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPVSVP
RPOC1_DIOEL      EERAICLHPLVCRGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_LEMMI      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_ACOAM      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_ACOCL      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_ACOGR      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_NYMAL      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHTNLLSPAIGDPISVP
RPOC1_NUPAD      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHTNLLSPAIGDPISVP
RPOC1_AMBTC      EGRAICLHPLVRKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_ILLOL      EGRAICLHPLVRKGFNADFDGDQMAVHVPLSLEAQTEARLLMFSHMNLLSPAIGDPISVP
RPOC1_CHLSC      EGRAICLHPLVRKGFNADFDGDQMAVHVPLSLEAQAEACLLMFSHMNLLSPTIGDPISVP
RPOC1_CALFG      EGRAICLHPLVRKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPTIGDPISVP
RPOC1_LIRTU      EGRAICLHPLVRKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_DRIGR      EGRAICLHPLVRKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISIP
RPOC1_CERDE      EGRAICLHPLVRKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAMGDPISVP
RPOC1_PIPCE      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGSPISVP
RPOC1_NANDO      EGRAIFLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_RANMC      EGRAICLHPLVCKGFNADFDGDQMAVHIPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_PLAOC      EGCAICLHPLVRKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_BUXMI      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_OENAR      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQTEARLLMFSHMNLLSPAMGDPISVP
RPOC1_OENBI      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQTEARLLMFSHMNLLSPAMGDPISVP
RPOC1_OENPA      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQTEARLLMFSHMNLLSPAMGDPISVP
RPOC1_OENEH      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQTEARLLMFSHMNLLSPAMGDPISVP
RPOC1_OENGL      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQTEARLLMFSHMNLLSPAMGDPISVP
RPOC1_EUCGG      EGRAICLHPLVRKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_PANGI      EGRAICLHPLVRKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVP
RPOC1_DAUCA      EGRAICLHPLVRKGFNADFDGDQMAVHVPLSFEAQAEARLLMFSHINLLSPAIGDPISVP
RPOC1_SOYBN      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHTNLLSPAIGDPISVP
RPOC1_PHAVU      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHTNLLSPAIADPISVP
RPOC1_LOTJA      EGRAICLHPLVCKGFNADFDGDQMAIHVPLSLEAQAEARLLMFSHTNLLSPAIGDPIAVP
RPOC1_HELAN      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPTIGDPISAP
RPOC1_GUIAB      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPTIGDPISAP
RPOC1_LACSA      EGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPTIGDPISAP
RPOC1_AGRST      EGRTISLHPLVCKGFNADFDGDQMAVHLPLSLEAQAEARLLMFSHMNLLSPAIGDPICVP
RPOC1_BRADI      EGRTISLHPLVCKGFNADFDGDQMAVHLPLSLEAQAEARLLMFSHMNLLSPAIGDPICVP
RPOC1_WHEAT      EGRTISLHPLVCKGFNADFDGDQMAVHLPLSLEAQAEARLLMFSHMNLLSPAIGDPICVP
RPOC1_HORVU      EGRTISLHPLVCKGFNADFDGDQMAVHLPLSLEAQAEARLLMFSHMNLLSPAIGDPICVP
RPOC1_LOLPR      EGRTISLHPLVCKGFNADFDGDQMAVHLPLSLEAQAEARLLMFSHMNLLSPAIGDPICVP
RPOC1_ORYNI      EGRTICLHPLVCKGFNADFDGDQMAVHLPLSLEAQAEARLLMFSHMNLLSPAIGDPICVP
RPOC1_ORYSA      EGRTICLHPLVCKGFNADFDGDQMAVHLPLSLEAQAEARLLMFSHMNLLSPAIGDPICVP
RPOC1_ORYSI      EGRTICLHPLVCKGFNADFDGDQMAVHLPLSLEAQAEARLLMFSHMNLLSPAIGDPICVP
RPOC1_ORYSJ      EGRTICLHPLVCKGFNADFDGDQMAVHLPLSLEAQAEARLLMFSHMNLLSPAIGDPICVP
RPOC1_SACHY      EGRTICLHPLVCKGFNADFDGDQMAVHLPLSLEAQAEARLLMFSHMNLLSPAIGDPICVP
RPOC1_SACOF      EGRTICLHPLVCKGFNADFDGDQMAVHLPLSLEAQAEARLLMFSHMNLLSPAIGDPICVP
RPOC1_SORBI      EGRTICLHPLVCKGFNADFDGDQMAVHLPLSLEAQAEARLLMFSHMNLLSPAIGDPICVP
RPOC1_MAIZE      EGRTICLHPLVCKGFNADFDGDQMAVHLPLSLEAQAEARLLMFSHMNLLSPAIGDPICVP
RPOC1_PELHO      KERAIYLHPLVCKGFNADFDGDQMAVHLPLSLEAQAEAYLLMFSTQNLLSPGNGDPICVP
RPOC1_PINKO      EGRAIRLHPSVCGGFNADFDGDQMAVHVPLSLEARAEARLLMFSETNLLSPAIGDPISIP
RPOC1_PINTH      EGRAIRLHPSVCGGFNADFDGDQMAVHVPLSLEARAEARLLMFSETNLLSPAIGDPISIP
RPOC1_CYCTA      EGRAIRLHPLVCGGFNADSDGDQMAVHVPLSLEAQAEARLLMFSHTNLLSPAIGDPISVP
RPOC1_WELMI      KEHAIRLHPSVCTGFNADFDGDQMAVHVPLSIEAILESRLLMFSHTNLLSPSSGSPITIP
RPOC1_GNEPA      KERAIRLHPAVCTGFNADFDGDQMAVHLPLSIEAILESRLLMFSHTNLLSPSNGSPITKP
RPOC1_CRYJA      NERAIRLHPLVCAGFNADFDGDQMAVHVPLSMEAQVEARLLMFSHLNLISPTIGDPICVP
RPOC1_HUPLU      DGRAIRLHPLVCAGFNADFDGDQMAVHLPLSLEAQAEASLLMLSQTNLLSPATGDPICVP
RPOC1_CHAGL      EGLAIRLHPLVCGGFNADFDGDQMAVHIPLSLEAQAEARFLMLANSNLLSPANGEPITVP
RPOC1_STAPU      GERAILLHPLVCAGFNADFDGDQMAVHVPLSWEAQVEARILMWSPSNLLSPATGRAVAVP
RPOC1_ZYGCR      RERAIHLHPLVCTGFNADFDGDQMAVHVPLSLEAQAEAHLLMSPYFNLLSPGTGDAIVVP
RPOC1_CHAVU      EGKAILLHPLVCAGFNADFDGDQMAVHVPLSPESQKEARLIMISNRNLLSPATGDPITLP
RPOC1_OEDCA      EGKAILLHPLVCSAFNADFDGDQMAVHVPITNEARIEAWKLVLSRNNLLSPATGEPILLP
RPOC1_OLTVI      DGRAILLHPLVCPAFNADFDGDQMAVHVPLSYEARSEAWKLIWARNNILSPATGEPILTP
RPOC1_TUPAK      SGRAILLHPLVCAAFNADFDGDQMAVHIPLSFQACAEAWKLMGSRNNLLSPATGEPIILP
RPOC1_TETOB      EGRAILLHPMVCPSFNADFDGDQMAVHIPLTVEARTEAWKFMLATNNLMNSATGEAIILP
RPOC1_BIGNA      TGKAIKLHPLVCPAFNADFDGDQMGMHIPLSFESRAESWKLLWSRNNLLLSSMGSPILTP
                    .: *** *  .*:** *****    *:  :   *.  :: .  * : .  . .    

RPOC1_MESVI      SQDMVLGCYYLTTEDIRLRG----------------------------------------
RPOC1_CHLAT      SQDMILGCYYLTTENPKFQI----------------------------------------
RPOC1_CYAP4      SQDMVLGCYYLTAENPKSQQ----------------------------------------
RPOC1_ACAM1      SQDMVLGAYYLTADNPGRQN----------------------------------------
RPOC1_THEEB      SQDMVLGCYYLTAENPKLPD----------------------------------------
RPOC1_TRIV2      SQDMVLGAYYLTAENPGATK----------------------------------------
RPOC1_NOSS1      SQDMVLGAYYLTAENPGATK----------------------------------------
RPOC1_NOSP7      SQDMVLGAYYLTAENPGATK----------------------------------------
RPOC1_NOSCO      SQDMVLGAYYLTAENPGATK----------------------------------------
RPOC1_SYNE7      SQDMVLGCYYLTAENPGAQK----------------------------------------
RPOC1_SYNP6      SQDMVLGCYYLTAENPGAQK----------------------------------------
RPOC1_RIPO1      SQDMVLGCYYLTAENPKAQK----------------------------------------
RPOC1_CROS5      SQDMVLGCYYLTAENPQSQK----------------------------------------
RPOC1_MICAN      SQDMVLGCYYLTAENPKAQK----------------------------------------
RPOC1_SYNY3      SQDMVLGCYYLTAENPNAQK----------------------------------------
RPOC1_GLOC7      SQDMVLGCYYLTSENPKAQK----------------------------------------
RPOC1_SYNP2      SQDMVLGCYYLTAENPGAQR----------------------------------------
RPOC1_TRIEI      SQDMVLGCYYLTAENHKLQG----------------------------------------
RPOC1_SYNJA      SQDMVLGCYYLTADNPHAPD----------------------------------------
RPOC1_SYNJB      SQDMVLGCYYLTADNPHAPD----------------------------------------
RPOC1_GLOVI      TQDMVLGCYYLTVDNPDATK----------------------------------------
RPOC1_PROMT      SQDMVLGSYYLTAIQPQSKQP---------------------------------------
RPOC1_PROM1      SQDMVLGSYYLTAIQPQAKQP---------------------------------------
RPOC1_SYNS3      SQDMVLGSYYLTALQPQMHPI---------------------------------------
RPOC1_SYNPW      SQDMVLGAYYLTALQPDVQPV---------------------------------------
RPOC1_SYNPX      SQDMVLGSYYLTALQPGAEQP---------------------------------------
RPOC1_SYNS9      SQDMVLGSYYLTALQPDATQP---------------------------------------
RPOC1_SYNSC      SQDMVLGSYYLTALQPGASKP---------------------------------------
RPOC1_PROMM      SQDMVLGSYYLTALKPGASVP---------------------------------------
RPOC1_PROM3      SQDMVLGSYYLTAIKPGASVP---------------------------------------
RPOC1_PROMA      SQDMVLGSYYLTALQPDAVKP---------------------------------------
RPOC1_PROM4      SQDMVLGSYYLTAIQPEASKP---------------------------------------
RPOC1_SYNR3      SQDMVLGAYYLTATRQERSKP---------------------------------------
RPOC1_PROM0      SQDMVLGSYYLTALQPNYQKP---------------------------------------
RPOC1_PROM2      SQDMVLGSYYLTALQPNYQKP---------------------------------------
RPOC1_PROMS      SQDMVLGSYYLTALQPNYQKP---------------------------------------
RPOC1_PROM9      SQDMVLGSYYLTALQPNYQKP---------------------------------------
RPOC1_PROM5      SQDMVLGSYYLTALQPNFKKP---------------------------------------
RPOC1_PROMP      SQDMVLGSYYLTALQPNFKKP---------------------------------------
RPOC1_PAUCH      SQDMVLGIYYLTSSKPAQTQP---------------------------------------
RPOC1_PYRYE      SQDMVLGCYYLTANNPSQQQ----------------------------------------
RPOC1_PORPU      SQDMVLGCYYLTANNPSQQR----------------------------------------
RPOC1_GRATL      SQDMVLGCYYLTTYNPAAIS----------------------------------------
RPOC1_GUITH      SQDMVLGCYYLTAENPSQQV----------------------------------------
RPOC1_RHDSA      SQDMVLGCYYLTTHNPSQQK----------------------------------------
RPOC1_CYAPA      SQDMVLGCYYLTVDNLKNQK----------------------------------------
RPOC1_EMIHU      SQDMVLGCFYLTANNPSQQL----------------------------------------
RPOC1_CYACA      SQDMVLGCYYLTNNNLANQK----------------------------------------
RPOC1_THAPS      SQDMVLGCYYLTVNNINGLL----------------------------------------
RPOC1_PHATC      SQDMVLGCYYLTVNNINGLL----------------------------------------
RPOC1_TRICV      SQDMVLGCYYLTVSNIKGLL----------------------------------------
RPOC1_NEPOL      SQDMVLGWYYLTTENPWIES----------------------------------------
RPOC1_OSTTA      SQDMILGFYYLTTLKPTVSLKRPVEQPMAVRGR---------------------------
RPOC1_PHYPA      SQDMLLGLYILTIKNHQGIYGNKNHPYK--------------------------------
RPOC1_MARPO      SQDMLLGLYILTIENNQGIYGNKYNPSK--------------------------------
RPOC1_ANTAG      SQDMLLGIYVSTIRSNRGIYQNQYHPY---------------------------------
RPOC1_ANEMR      SQDMLLGLYALTMENRRGIYGNKYSLDSNK------------------------------
RPOC1_PSINU      TQDMLLGLHILTIEDSQGIYGVRYFPYS--------------------------------
RPOC1_ANGEV      SQDMLLGLYVLTIENSQGIYGNRYYPNER-------------------------------
RPOC1_ADICA      SQDMLLGLYALTIESRQGIYRNRHLGFI--------------------------------
RPOC1_CUCSA      TQDMLIGLYVLTSGNRRGICANRYNPSNR---------------KNHKNEKIYN------
RPOC1_MORIN      TQDMLIGLYVLTSGNRRGICANRYNPCNY---------------RNYQNERIDD------
RPOC1_SOLBU      TQDMLIGLYVLTSGNHRGICVNRYNPCNR---------------RNYQNQKR-S------
RPOC1_SOLTU      TQDMLIGLYVLTSGNHRGICVNRYNPCNR---------------RNYQNQKR-S------
RPOC1_SOLLC      TQDMLIGLYVLTSGNHRGICVNRYNPCNR---------------RNYQNQKR-S------
RPOC1_NICSY      TQDMLIGLYVLTSGNHRGICVNRYNPCNR---------------RNYQNQKR-S------
RPOC1_TOBAC      TQDMLIGLYVLTSGNHRGICVNRYNPCNR---------------RNYQNQKR-S------
RPOC1_ATRBE      TQDMLIGLYVLTSGNRRGICVNRYNPCNR---------------RNYQNQKR-S------
RPOC1_NICTO      TQDMLIGLYVLTSGNPRGICVNRYNPCNR---------------INYQNKKR-S------
RPOC1_CUSEX      TQDMLIGLYVLTSEKHRGICTNRYTNCNI---------------RTLQTKSSDY------
RPOC1_CUSRE      TQDMLIGLYVLTSDNRRDICTNRYTKCNI---------------QTLQTKSSDS------
RPOC1_IPOPU      TQDMLIGLYVLTSENRRGICLNRYTKCNR---------------RNSQTKRSDN------
RPOC1_COFAR      TQDMLMGLYVLTSGNRRGICVNRYNPWNR---------------RNYQTKKS--------
RPOC1_JASNU      TQDMLVGLYVLTSGNRRGICVNRYNPWNH---------------RNYENQRS--------
RPOC1_SPIOL      TQDMLIGLYILTSGNRRGICANRYNPWNH---------------KTYQNERI--------
RPOC1_SILLA      TQDMLIGLYILTSGTRRGICANRYNPWNR---------------KNDQNERI--------
RPOC1_FAGEA      TQDMLIGLYVLTSGNRRGICANRYNPWSR---------------KNYKNEKW--------
RPOC1_LEPVR      TQDMLIGLYVLTSGTRRGISANRYNPCNR---------------KNYQNERI--------
RPOC1_CAPBU      TQDMLIGLYVLTSGTRRGICANRYNPCNR---------------KNYQNERI--------
RPOC1_BARVE      TQDMLIGLYVLTSGTRRGICANRYNPCNQ---------------KNYQNERI--------
RPOC1_NASOF      TQDMLIGLYVLTSGTRRGICANRYNPCNR---------------KNYQNERI--------
RPOC1_ARATH      TQDMLIGLYVLTSGTRRGICANRYNPCNR---------------KNYQNERI--------
RPOC1_OLIPU      TQDMLIGLYVLTSGTRRGICANRYNPCNR---------------KNYQNERI--------
RPOC1_DRANE      TQDMLIGLYVLTSGTRRGICANRYNPCNR---------------KNDKNEKL--------
RPOC1_LOBMA      TQDMLIGLYVLTSGTRRGICANRYNPCNR---------------KNYKNERI--------
RPOC1_ARAHI      TQDMLIGLYVLTSGTRRGICANRYNPCNR---------------KNSQNERI--------
RPOC1_SINAL      TQDMLIGLYVLTSGTRRGICANRYNPCNR---------------KNYQNERI--------
RPOC1_CRUWA      TQDMLIGLYVLTSGTRRGICANRYNPCNP---------------KNYKNERI--------
RPOC1_AETCO      TQDMLIGLYVLTSGTRRGICANRYNPCNR---------------KNYQNERI--------
RPOC1_AETGR      TQDMLIGLYVLTSATRRGICANRYNPCNR---------------KNYQNERI--------
RPOC1_CARPA      TQDMLMGLYVLTSGTRRGICANRYNPCNR---------------KNYQNERI--------
RPOC1_GOSHI      TQDMLIGLYVLTSGNRRGICANRYNPWNR---------------KSYQNERI--------
RPOC1_GOSBA      TQDMLIGLYVLTSGNRRGICANRYNPWNL---------------KSYQNQRF--------
RPOC1_POPTR      TQDMLMGLYVLTSGNRRGICANRYNPFNC---------------RNFQNEKI--------
RPOC1_POPAL      TQDMLMGLYVLTSGNRRGICANRYNPFNC---------------RNFQNEKI--------
RPOC1_MANES      TQDMLIGLYVLTSGNRRGICANRYNPCNR---------------RNYQNKRI--------
RPOC1_CITSI      TQDMLIGLYVLTSGNRRGICANRYNTWNR---------------RNYPDERI--------
RPOC1_VITVI      TQDMLIGLYVLTSGNRRGICANRYNPCNR---------------RNYQNERI--------
RPOC1_PHAAO      TQDMLIGLYVLTIGNPRGICANRYNQSNS---------------NCRNYKKEKV------
RPOC1_DIOEL      TQDMLIGLYVLTIGNRRGICANRYNTYNC---------------RNSQNKILNN------
RPOC1_LEMMI      TQDMLIGLYVLTIGNPRGICANRYNFFNC---------------KNDENAPLDN------
RPOC1_ACOAM      TQDMLIGLYVLTMGNRRGIFVNRYNPCNR---------------RNYQNKTVDN------
RPOC1_ACOCL      TQDMLIGLYVLTMGNRRGIFVNRYNPCNR---------------RNYQNKTVDN------
RPOC1_ACOGR      TQDMLIGLYVLTMGNHRGIFVNRYNPCNR---------------RNYQNKTVDN------
RPOC1_NYMAL      TQDMLMGLYVLTMGNRRGICANRYNPCNP---------------RNHQNERMDH------
RPOC1_NUPAD      TQDMLMGLYVLTMGNRRGICANRYNPCNS---------------RNYQNERTDH------
RPOC1_AMBTC      TQDMLIGLYVLTIGNRRGICTNRYNPCNY---------------RNYQNEIVDD------
RPOC1_ILLOL      TQDMLIGLYVLTIGNHRGICANRYNPCNY---------------RNYQNETVDD------
RPOC1_CHLSC      TQDMLIGLYVLTIGNRRGICANRYNPCNCRN-------------DNDQNETVDD------
RPOC1_CALFG      TQDMLIGLYVLTIGNRRGICANRYNPWNR---------------GNSQNERVND------
RPOC1_LIRTU      TQDMLIGLYILTIGNRRGICSNRYNPCNR---------------RNYQNETV--------
RPOC1_DRIGR      TQDMLIGLYVLTIGNRRGICANRYNPWNR---------------RNYQNKTVYEYN----
RPOC1_CERDE      TQDMLIGLYVLTIGNRRGICANRYNSCNR---------------GKYQNETKNNSK----
RPOC1_PIPCE      TQDMLIGLYVLTIGNRQGVCANRYNPWNR---------------RNYQNETVDHTKY---
RPOC1_NANDO      TQDMLMGLYVLTTGNHRGICANRYNPSNH---------------RNYQNEKIDD------
RPOC1_RANMC      TQDMLMGLYVLTIGNRRGICANRYNPWNH---------------RNSQNEKIDD------
RPOC1_PLAOC      TQDMLMGLYVLTIGNRRGICANRYNPRNR---------------RNYQNERIDD------
RPOC1_BUXMI      TQDMLIGLYVLTSGNRRGICANRYNPCNRGNR------------VNFQNERIDD------
RPOC1_OENAR      TQDMLIGLYILTSGNPRGICTNRYNPWNR---------------SNYQNERISD------
RPOC1_OENBI      TQDMLIGLYILTSGNPRGICTNRYNPWNR---------------SNYQNERISD------
RPOC1_OENPA      TQDMLIGLYILTSGNPRGICTNRYNPWNR---------------SNYQNERISD------
RPOC1_OENEH      TQDMLIGLYILTSGNPRGICTNRYNPWNR---------------SNYQNERISD------
RPOC1_OENGL      TQDMLIGLYILTSGNPRGICTNRYNPWNR---------------SNYQNERISD------
RPOC1_EUCGG      TQDMLIGLYVLTSGNRRGICTNRYNPWNR---------------RNYQNERTYD------
RPOC1_PANGI      TQDMLIGLYVLTSGNRRGICVNRYNPCNR---------------RNYQNERIYD------
RPOC1_DAUCA      TQDMLIGLYVLTSGNRRGICVNRYNPSNH---------------RN-QNKRIYE------
RPOC1_SOYBN      TQDMLIGLYILTSGNRRGIYSNRYNPRNCGNF------------RNLKNERI--------
RPOC1_PHAVU      TQDMLIGLYILTSGNRRGIYSNRYNPRNC---------------RNLKNERI--------
RPOC1_LOTJA      TQDMLIGLYILTSGNRRGICANRYNRSNW---------------KNSKNEKI--------
RPOC1_HELAN      TQDMLSGLYVLTSGNRRGICVNRYNPCNR---------------RNYQNEDN--------
RPOC1_GUIAB      TQDMLSGLYVLTSGNRRGICVNRYNPCNR---------------RNYQNEDN--------
RPOC1_LACSA      TQDMLSGLYVLTSGNRRGICVNRYNPCNR---------------RNYQNEDN--------
RPOC1_AGRST      TQDMLIGLYVLTIGNHRGIYANRYNSCEN-----------------YPNQKVNYN-----
RPOC1_BRADI      TQDMLIGLYVLTIGNPRGICANRYNSCGN-----------------YPNQKVNYN-----
RPOC1_WHEAT      TQDMLIGLYVLTIGKRRGICANRYNSCRN-----------------YPNLKVNYN-----
RPOC1_HORVU      TQDMLIGLYVLTIGKRRGICANRYNSFRN-----------------YPNLKVNYN-----
RPOC1_LOLPR      TQDMLIGLYVLTIGNRRGICANRYNSCVN-----------------YPTKKVNYN-----
RPOC1_ORYNI      TQDMLIGLYVLTIGNRRGICANRYNSCGN-----------------YPNQKVNYN-----
RPOC1_ORYSA      TQDMLIGLYVLTIGNRRGICANRYNSCGN-----------------YPNQKVNYN-----
RPOC1_ORYSI      TQDMLIGLYVLTIGNRRGICANRYNSCGN-----------------YPNQKVNYN-----
RPOC1_ORYSJ      TQDMLIGLYVLTIGNRRGICANRYNSCGN-----------------YPNQKVNYN-----
RPOC1_SACHY      TQDMLIGLYVLTIGNRRGICANRYNSCGN-----------------SPNKKINYN-----
RPOC1_SACOF      TQDMLIGLYVLTIGNRRGICANRYNSCGN-----------------SPNKKINYN-----
RPOC1_SORBI      TQDMLIGLYVLTIGNRRGICANRYNSCGN-----------------SPNKKINYN-----
RPOC1_MAIZE      TQDMLIGLYVLTIGNRLGICANRYNSCGN-----------------SPNKKVNYN-----
RPOC1_PELHO      TQDMLTGLYTLTLGNRRGICATRYNLWNR---------------RNSQNERIDD------
RPOC1_PINKO      TQDMLLGLYISTVENSQGIYGNRYHPYHS-------------------------------
RPOC1_PINTH      TQDMLLGLYISTVQNSQGIYGNRYHPYHS-------------------------------
RPOC1_CYCTA      TQDMLLGLYILTVGNNQGIYGNRYHPYYS-------------------------------
RPOC1_WELMI      TQDMLLGLYILTADKNQDISEFRYHPSKS-------------------------------
RPOC1_GNEPA      TQDMLLGLYILTTEKPRNISQFRCRPSNP-------------------------------
RPOC1_CRYJA      TQDMLLGLYRSTLQKNQGIYENRYHPNSS-------------------------------
RPOC1_HUPLU      SQDMLLGLYPLTIEVNRGIYGNRYNLSPS-------------------------------
RPOC1_CHAGL      SQDMLLGLYVLTMSCKQGIYIYNEQKLKK-------------------------------
RPOC1_STAPU      SQDMLLGLYVLTLEGSVGIYGSRQRSFVSSSL------------LFTKNHEIKESKEEDS
RPOC1_ZYGCR      TQDMLLGLYALTLGATLGIYSNINTYKYQSDV------------SFTQKTDSK-------
RPOC1_CHAVU      SQDMLLGLYMLTLEDLQRNFSFSQKQCLK-------------------------------
RPOC1_OEDCA      SQDMVLGCYYLTIENLQSLTQKKFRINRK-------------------------------
RPOC1_OLTVI      SQDMILGCYYLTTTDRIRFKSTWLAS----------------KSQQTGDSE--ASFAMLR
RPOC1_TUPAK      SQDMVLGCYYLTTLDRVKIKQKLSQSSFLFPFLISKQGVHENLSTISSNSKGIENWILKK
RPOC1_TETOB      SQDMVLGCYYLTLDFQSKFVGVQLSNLLK-------------------------------
RPOC1_BIGNA      GQDVVLGCYYLTSNLLDKVKTYIKPCHLN-------------------------------
                  **:: * .  *                                                

RPOC1_MESVI      -----------------------------------TKSH---------------------
RPOC1_CHLAT      -----------------------------------ERGH---------------------
RPOC1_CYAP4      -----------------------------------GEGT---------------------
RPOC1_ACAM1      -----------------------------------GAGK---------------------
RPOC1_THEEB      -----------------------------------YSDR---------------------
RPOC1_TRIV2      -----------------------------------GAGK---------------------
RPOC1_NOSS1      -----------------------------------GAGK---------------------
RPOC1_NOSP7      -----------------------------------GAGN---------------------
RPOC1_NOSCO      -----------------------------------GAGK---------------------
RPOC1_SYNE7      -----------------------------------GAGR---------------------
RPOC1_SYNP6      -----------------------------------GAGR---------------------
RPOC1_RIPO1      -----------------------------------GANR---------------------
RPOC1_CROS5      -----------------------------------GNGR---------------------
RPOC1_MICAN      -----------------------------------GGGR---------------------
RPOC1_SYNY3      -----------------------------------GAGR---------------------
RPOC1_GLOC7      -----------------------------------GAES---------------------
RPOC1_SYNP2      -----------------------------------GAGR---------------------
RPOC1_TRIEI      -----------------------------------SKAL---------------------
RPOC1_SYNJA      -----------------------------------LGDR---------------------
RPOC1_SYNJB      -----------------------------------IGDR---------------------
RPOC1_GLOVI      -----------------------------------GSGK---------------------
RPOC1_PROMT      --------------------------------KFGDYSN---------------------
RPOC1_PROM1      --------------------------------KFGDYSD---------------------
RPOC1_SYNS3      --------------------------------EFGDRSR---------------------
RPOC1_SYNPW      --------------------------------DFGDRSR---------------------
RPOC1_SYNPX      --------------------------------EFGDRSR---------------------
RPOC1_SYNS9      --------------------------------EFGDRSA---------------------
RPOC1_SYNSC      --------------------------------DFGDRSC---------------------
RPOC1_PROMM      --------------------------------EFGDQSR---------------------
RPOC1_PROM3      --------------------------------EFGDQSR---------------------
RPOC1_PROMA      --------------------------------DFGDQSK---------------------
RPOC1_PROM4      --------------------------------DFGDQSK---------------------
RPOC1_SYNR3      --------------------------------EFGDRSR---------------------
RPOC1_PROM0      --------------------------------EFGDNKT---------------------
RPOC1_PROM2      --------------------------------EFGDNKT---------------------
RPOC1_PROMS      --------------------------------EFGDNKT---------------------
RPOC1_PROM9      --------------------------------DFGDNKS---------------------
RPOC1_PROM5      --------------------------------NFGDNQR---------------------
RPOC1_PROMP      --------------------------------NFGDNQK---------------------
RPOC1_PAUCH      --------------------------------AFGERGL---------------------
RPOC1_PYRYE      -----------------------------------GSNQ---------------------
RPOC1_PORPU      -----------------------------------GASQ---------------------
RPOC1_GRATL      -----------------------------------DSSH---------------------
RPOC1_GUITH      -----------------------------------NRSL---------------------
RPOC1_RHDSA      -----------------------------------SQAY---------------------
RPOC1_CYAPA      -----------------------------------GKGS---------------------
RPOC1_EMIHU      -----------------------------------NKNH---------------------
RPOC1_CYACA      -----------------------------------GSGH---------------------
RPOC1_THAPS      -----------------------------------GSNH---------------------
RPOC1_PHATC      -----------------------------------GSSH---------------------
RPOC1_TRICV      -----------------------------------GSNQ---------------------
RPOC1_NEPOL      -----------------------------------TEGL---------------------
RPOC1_OSTTA      --------------------------------NLIQSNS---------------------
RPOC1_PHYPA      ---------------------------QNNNKIFLNKTP---------------------
RPOC1_MARPO      ---------------------------KYDSKKKFSQIP---------------------
RPOC1_ANTAG      ---------------------------DYRNKNFSYKMF---------------------
RPOC1_ANEMR      --------------------------ETYLKNFSFPKIP---------------------
RPOC1_PSINU      ----------------------------KRNCTSFFKIP---------------------
RPOC1_ANGEV      ---------------------------TKDPISSFSRIP---------------------
RPOC1_ADICA      ----------------------------DRVNVYSTKLL---------------------
RPOC1_CUCSA      --------------------------NNYKYTK----EP---------------------
RPOC1_MORIN      --------------------------NKYKYTKTQEKEP---------------------
RPOC1_SOLBU      --------------------------DNSYYK--YTKEP---------------------
RPOC1_SOLTU      --------------------------DNSYYK--YTKEP---------------------
RPOC1_SOLLC      --------------------------DNSYYK--YTKEP---------------------
RPOC1_NICSY      --------------------------DNSHYK--YTKEP---------------------
RPOC1_TOBAC      --------------------------DNSHYK--YTKEP---------------------
RPOC1_ATRBE      --------------------------DNSYYK--YTKEP---------------------
RPOC1_NICTO      --------------------------DNSHYK--YTKEP---------------------
RPOC1_CUSEX      --------------------------SNSKYKNPYNNGP---------------------
RPOC1_CUSRE      --------------------------SNSKSKNWYKNRP---------------------
RPOC1_IPOPU      --------------------------SNYKYK----KEP---------------------
RPOC1_COFAR      --------------------------DNNNYE--YTKEP---------------------
RPOC1_JASNU      --------------------------KNNNYR--YTKEP---------------------
RPOC1_SPIOL      --------------------------DDTNYK--SMKEP---------------------
RPOC1_SILLA      --------------------------DDKNYK--YMEEP---------------------
RPOC1_FAGEA      --------------------------NDHNYK--YMKEP---------------------
RPOC1_LEPVR      --------------------------YETHYK--YTKEP---------------------
RPOC1_CAPBU      --------------------------YETNYK--YTKEP---------------------
RPOC1_BARVE      --------------------------YETNYK--YTKEP---------------------
RPOC1_NASOF      --------------------------YETNYK--YTKEP---------------------
RPOC1_ARATH      --------------------------YETNYK--YTKEP---------------------
RPOC1_OLIPU      --------------------------SETNYK--YTKEP---------------------
RPOC1_DRANE      --------------------------YETNYK--YMKEP---------------------
RPOC1_LOBMA      --------------------------YETNYK--YMKEP---------------------
RPOC1_ARAHI      --------------------------YETNYK--YMKEP---------------------
RPOC1_SINAL      --------------------------YETNYK--YMKEP---------------------
RPOC1_CRUWA      --------------------------YETNYK--YTKEP---------------------
RPOC1_AETCO      --------------------------YETNYK--YMKEP---------------------
RPOC1_AETGR      --------------------------YETNYK--YMKEP---------------------
RPOC1_CARPA      --------------------------DDNNYK--YTKEP---------------------
RPOC1_GOSHI      --------------------------DDNNYK--STREP---------------------
RPOC1_GOSBA      --------------------------DNNNYK--STREP---------------------
RPOC1_POPTR      --------------------------DANANKDKYIKEP---------------------
RPOC1_POPAL      --------------------------DANANKDKYIKEP---------------------
RPOC1_MANES      --------------------------DGNN--DKYTKEP---------------------
RPOC1_CITSI      --------------------------DDNSYTYTKE--P---------------------
RPOC1_VITVI      --------------------------DDNNYRYTKEKEP---------------------
RPOC1_PHAAO      ----------------------------YKNDFKYTKEL---------------------
RPOC1_DIOEL      ----------------------------NKYNYIKMKAT---------------------
RPOC1_LEMMI      ----------------------------DNYQATKEKEP---------------------
RPOC1_ACOAM      ----------------------------NNYKHTKEKKP---------------------
RPOC1_ACOCL      ----------------------------NNYKHTKEKKP---------------------
RPOC1_ACOGR      ----------------------------NNYKHTKEKKP---------------------
RPOC1_NYMAL      ----------------------------SNYEYRKGKEP---------------------
RPOC1_NUPAD      ----------------------------NNYKYRKGKEP---------------------
RPOC1_AMBTC      ----------------------------NNYKYTKEKEP---------------------
RPOC1_ILLOL      ----------------------------NNYQYTKEKEP---------------------
RPOC1_CHLSC      ----------------------------NNYKYTKEKEP---------------------
RPOC1_CALFG      ----------------------------TNYMYTK-KEP---------------------
RPOC1_LIRTU      ----------------------------DYNKYTKEKEP---------------------
RPOC1_DRIGR      ----------------------------NNYRYTKEKEP---------------------
RPOC1_CERDE      --------------------------------YTKAKEP---------------------
RPOC1_PIPCE      --------------------------DRTNYRYTKEKEP---------------------
RPOC1_NANDO      ----------------------------NNYKYTKE--P---------------------
RPOC1_RANMC      ----------------------------NNHTYTKE--P---------------------
RPOC1_PLAOC      ----------------------------NNYRYTKEKEP---------------------
RPOC1_BUXMI      ----------------------------NNYKYTKEKDP---------------------
RPOC1_OENAR      ----------------------------NNWK---KKEP---------------------
RPOC1_OENBI      ----------------------------NNWK---KKEP---------------------
RPOC1_OENPA      ----------------------------NNWK---KKEP---------------------
RPOC1_OENEH      ----------------------------NNWK---KKEP---------------------
RPOC1_OENGL      ----------------------------NNWK---KKEP---------------------
RPOC1_EUCGG      ----------------------------NNYKYRKKKEP---------------------
RPOC1_PANGI      ----------------------------NNYKYTKKKEP---------------------
RPOC1_DAUCA      ----------------------------NNYKYTKEKEP---------------------
RPOC1_SOYBN      --------------------------RDNNYKYTKKKEP---------------------
RPOC1_PHAVU      --------------------------PNNNYKYTKKKEP---------------------
RPOC1_LOTJA      --------------------------RDK--KYMKKKEP---------------------
RPOC1_HELAN      -----------------------------NYKYTKKKEP---------------------
RPOC1_GUIAB      -----------------------------NYKYTKKKEP---------------------
RPOC1_LACSA      -----------------------------NYKYTKKKEP---------------------
RPOC1_AGRST      --------------------------NNN-SKYTKDKEP---------------------
RPOC1_BRADI      --------------------------NNN-STYTRDKEP---------------------
RPOC1_WHEAT      --------------------------NNNNSKYRKDKEP---------------------
RPOC1_HORVU      --------------------------NNN-SKYRKDKEP---------------------
RPOC1_LOLPR      --------------------------MKD-------KEP---------------------
RPOC1_ORYNI      --------------------------NNN-PKYTKDKES---------------------
RPOC1_ORYSA      --------------------------NNN-PKYTKDKES---------------------
RPOC1_ORYSI      --------------------------NNN-PKYTKDKES---------------------
RPOC1_ORYSJ      --------------------------NNN-PKYTKDKES---------------------
RPOC1_SACHY      --------------------------NNNYYKYTKDKEP---------------------
RPOC1_SACOF      --------------------------NNNYYKYTKDKEP---------------------
RPOC1_SORBI      --------------------------NNNYYKYTKDKEP---------------------
RPOC1_MAIZE      --------------------------NNNYYKYTKDKEP---------------------
RPOC1_PELHO      ----------------------------KHYGSTKGKEL---------------------
RPOC1_PINKO      -----------------------------EKKSFSCKKP---------------------
RPOC1_PINTH      -----------------------------ENKSFSCKKP---------------------
RPOC1_CYCTA      -----------------------------KYKIFSCKKP---------------------
RPOC1_WELMI      -----------------------------KKKISSKKNP---------------------
RPOC1_GNEPA      -----------------------------TKKFLPEANL---------------------
RPOC1_CRYJA      -----------------------------KKKIVS---P---------------------
RPOC1_HUPLU      -----------------------------LRQIPY-------------------------
RPOC1_CHAGL      ------------------------------------KIP---------------------
RPOC1_STAPU      QSKQDFIRSLDKKSKPIKNSKYSLYPKFIENKSSFHKFP---------------------
RPOC1_ZYGCR      -------------------------------------II---------------------
RPOC1_CHAVU      ------------------------------KHTNFNQMP---------------------
RPOC1_OEDCA      --------------------------------ILNQRNY---------------------
RPOC1_OLTVI      PKHGP------------SGRKPTQDLCTKGSAFFAPDNTAKQSEASFALS----------
RPOC1_TUPAK      PSQKSEIRTLSSFYEINESERATFESKTNDTSILKLQDKKRRETLTFKRNRLSPVDTKLH
RPOC1_TETOB      -----------------------------------KQNSFFPFSKPTYLGKEKTFQIQGK
RPOC1_BIGNA      -----------------------------------KKG----------------------
                                                                             

RPOC1_MESVI      -------------------------------YFSSLEQVIMAYDQ-KKINLHTIVWVRFS
RPOC1_CHLAT      -------------------------------YFSTLKDAVMAYEQ-KRIHLHSYIWVRFQ
RPOC1_CYAP4      -------------------------------YFASMNDVVMAYEQ-GQVELHAFIWVRYD
RPOC1_ACAM1      -------------------------------YFAGLDDAIMAYEQ-QQVDLHAYVWVRFD
RPOC1_THEEB      -------------------------------YYANFQDVVMAYEQ-GHLPLHAFVWVRYD
RPOC1_TRIV2      -------------------------------YFASLDDVIMAFQQ-EQIDLHAYIYVRFD
RPOC1_NOSS1      -------------------------------YFASLDDVIMAFQQ-EQIDLHAYVYVRFD
RPOC1_NOSP7      -------------------------------YFSSLEDVIMAFQQ-DQIDLHAYIYVRFD
RPOC1_NOSCO      -------------------------------YFSSLEDVIMAFQQ-EQIDLHAYIYVRFD
RPOC1_SYNE7      -------------------------------YFANLEDAIRAFEQ-GSVDLHAWVWVRFD
RPOC1_SYNP6      -------------------------------YFANLEDAIRAFEQ-GSVDLHAWVWVRFD
RPOC1_RIPO1      -------------------------------YFGSIPDAIKAYEQ-GTVDLHAYVWLRY-
RPOC1_CROS5      -------------------------------YFGNIDDAVKAFEH-GLVDLHAYVWLRSE
RPOC1_MICAN      -------------------------------YFASMDDAIRAFDQ-GLVDLHASVWLRLP
RPOC1_SYNY3      -------------------------------YFAGIEDALRAYDH-GQVDLHSQIWIRHL
RPOC1_GLOC7      -------------------------------YYSDLEDALMAYEQ-GLVDLHAYVWVRC-
RPOC1_SYNP2      -------------------------------YFSSMDDALRAYEQ-GDVDLHAYVWLRYL
RPOC1_TRIEI      -------------------------------YFANPDDVILAYQQ-DKIDLHTYVYLRLA
RPOC1_SYNJA      -------------------------------YFASLEDALIAYDR-GVIGLHSKIWVRYS
RPOC1_SYNJB      -------------------------------FFASLEDALIAYDR-GAIGLHSKVWVRYH
RPOC1_GLOVI      -------------------------------YFGSSEDAVIAYNQ-GMIDLHAKIWLRFE
RPOC1_PROMT      -------------------------------TYASLEDVLQALED-KRIDLHDWVWVRFS
RPOC1_PROM1      -------------------------------TYASLEDVLQALED-KRIDLHDWVWVRFS
RPOC1_SYNS3      -------------------------------TYSSLEDVIHAFED-NRITLHDWVWVRFN
RPOC1_SYNPW      -------------------------------TFSDLEDVIHAFED-KRLGLHDWVWVRFN
RPOC1_SYNPX      -------------------------------TYSSLEDVIHAFED-TRIGLHDWVWVRFN
RPOC1_SYNS9      -------------------------------TFAGLDDVIHAFDD-TRIGLHDWVWVRFN
RPOC1_SYNSC      -------------------------------TFAGLEDVIHAFED-NRIGLHDWVWVRFN
RPOC1_PROMM      -------------------------------TYSGLEDVIHAFED-KRILLHDWVWVRFN
RPOC1_PROM3      -------------------------------TYAGLEDVIHAFED-KRLLLHDWVWVRFN
RPOC1_PROMA      -------------------------------TFAGLEDVIHAFED-KRINLHDWVWVRFN
RPOC1_PROM4      -------------------------------TFASLDDVINAFED-KRIKLHDWVWVRFN
RPOC1_SYNR3      -------------------------------TYANLEDVCHAFEE-KRITLHDWVWVRFN
RPOC1_PROM0      -------------------------------TFASLEDVIFAFED-KRLSLHEWIWVRFN
RPOC1_PROM2      -------------------------------TFASLEDVIFAFED-KRLSLHEWVWVRFN
RPOC1_PROMS      -------------------------------TFASLEDVIFAFED-KRLSLHEWIWVRFN
RPOC1_PROM9      -------------------------------TFASLEDVIFAFED-KRLSLHEWVWVRFN
RPOC1_PROM5      -------------------------------TYASLEDVIFAFED-KRVGLHEWVWLRFN
RPOC1_PROMP      -------------------------------TYASLEDVIFAFED-KRVGLHEWVWVRFN
RPOC1_PAUCH      -------------------------------TFANTYDVISAYDN-DRIGLHTWIWVRFS
RPOC1_PYRYE      -------------------------------YFASLEDVVMAYEQ-KKIDLHSYIWARFD
RPOC1_PORPU      -------------------------------YFASLEDVVIAYEK-KKVDLHAYIWARFD
RPOC1_GRATL      -------------------------------YFSNLDDALMAYQQ-NNITLHSLVWVRFS
RPOC1_GUITH      -------------------------------YFSNFDDVLLAYET-KLIKLHSYVWVRFN
RPOC1_RHDSA      -------------------------------YFSNLEDALLAYEC-KKIALHSYVWVRFE
RPOC1_CYAPA      -------------------------------YFINSEDVLIAYEQ-QRIDLHSYIWVRFD
RPOC1_EMIHU      -------------------------------YFSDFEDAILAYQN-SQIHLHTFIWVRCN
RPOC1_CYACA      -------------------------------YFSSFEDAIIAYKQ-KLISLHAFIWVKFY
RPOC1_THAPS      -------------------------------YFADLNDVILAYNQ-DQIEIHTSIWVRYK
RPOC1_PHATC      -------------------------------YFANLADVILAYSQ-SKLEIHSAIWIRLE
RPOC1_TRICV      -------------------------------YFASLEDVLLAYNQ-DKIELHTAIWIRYT
RPOC1_NEPOL      -------------------------------YFSGLSDVEHAYHQ-GQIHLHSIIWVRWG
RPOC1_OSTTA      -------------------------------IFNNFESVLHAYET-SKVDLHEIIWLRWS
RPOC1_PHYPA      -------------------------------YFSSYDDVIKAYNQ-KKVRLHSALWLWW-
RPOC1_MARPO      -------------------------------YFSSYDNVFRALQQ-KQIYLHSSLWLRW-
RPOC1_ANTAG      -------------------------------YFHSYDDILKAEKQ-KQINLHSPLWLRW-
RPOC1_ANEMR      -------------------------------YFHGYEDVYKAHQQ-REIHSHSVLWLRW-
RPOC1_PSINU      -------------------------------YFNSYDDVLRAKEQ-RQIHFYSPIWLRW-
RPOC1_ANGEV      -------------------------------YFSNYDDILRAKEQ-ERVDLHSPLWLRW-
RPOC1_ADICA      -------------------------------HFSSYCDLLRAKES-RQVDSHSLLWLRW-
RPOC1_CUCSA      -------------------------------FFCNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_MORIN      -------------------------------FFCNSYDAIGAYRQ-KRIHLDSPLWLRW-
RPOC1_SOLBU      -------------------------------FFSNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_SOLTU      -------------------------------FFSNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_SOLLC      -------------------------------FFSNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_NICSY      -------------------------------FFSNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_TOBAC      -------------------------------FFSNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_ATRBE      -------------------------------FFSNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_NICTO      -------------------------------FFSNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_CUSEX      -------------------------------FFCNSYDAIGAYRQ-KRINLESPLWLRW-
RPOC1_CUSRE      -------------------------------FFCNSYDAIGAYRQ-KQINLESPLWLRW-
RPOC1_IPOPU      -------------------------------VFCNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_COFAR      -------------------------------FFCNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_JASNU      -------------------------------LFSNSYDAIGAYRQ-KRIKLDSPLWLRW-
RPOC1_SPIOL      -------------------------------FFCNFYDAIGAYRQ-KRIHLDSPLWLRW-
RPOC1_SILLA      -------------------------------FFCNSYDAIGAYCQ-KRINLDSPLWLRW-
RPOC1_FAGEA      -------------------------------FFCNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_LEPVR      -------------------------------FFCNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_CAPBU      -------------------------------FFCNSYDAIGAYRQ-KRIDLDSPLWLRW-
RPOC1_BARVE      -------------------------------FFCNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_NASOF      -------------------------------FFCNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_ARATH      -------------------------------FFCNSYDAIGAYRQ-KKINLDSPLWLRW-
RPOC1_OLIPU      -------------------------------FFCNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_DRANE      -------------------------------FFCNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_LOBMA      -------------------------------FFCNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_ARAHI      -------------------------------FFCNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_SINAL      -------------------------------FFCNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_CRUWA      -------------------------------FFCNSYDANGAYRQ-KRINLDSPLWLRW-
RPOC1_AETCO      -------------------------------FFCNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_AETGR      -------------------------------FFCNSYDAIGAYWQ-KRINLDSPLWLRW-
RPOC1_CARPA      -------------------------------FFCNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_GOSHI      -------------------------------FFCNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_GOSBA      -------------------------------FFFFLIHVMRLELMGRKESIQIVLCDSG-
RPOC1_POPTR      -------------------------------FFCNSYDAIGAYRQ-KRINLESPLWLRW-
RPOC1_POPAL      -------------------------------FFCNSYDAIGAYRQ-KRINLESPLWLRW-
RPOC1_MANES      -------------------------------LFSNSYDALGAYRQ-KRIHLDSPLWLRW-
RPOC1_CITSI      -------------------------------LFCNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_VITVI      -------------------------------FFCNSYDAIGAYRH-KRINLYSPLWLRW-
RPOC1_PHAAO      -------------------------------YFSSSYDALGAYRQ-KRIHLDSPLWLRW-
RPOC1_DIOEL      -------------------------------YCCSSYDALGAYRQ-KRIDLDSPLWLRW-
RPOC1_LEMMI      -------------------------------HFSSSYDALGAYRR-KRIRLDSPLWLRW-
RPOC1_ACOAM      -------------------------------YFLSSYDALGAYQQ-KRINLHSPLWLRW-
RPOC1_ACOCL      -------------------------------YFLSSYDALGAYQQ-KRINLHSPLWLRW-
RPOC1_ACOGR      -------------------------------YFFSSYDALGAYQQ-KRINLHRPLWLRW-
RPOC1_NYMAL      -------------------------------YFCSSYDALGAYRQ-KGIDLYSTLWLRW-
RPOC1_NUPAD      -------------------------------YFCSSYDALGAYRQ-KGIDLYSTLWLRW-
RPOC1_AMBTC      -------------------------------YFCSSYDALGAYRQ-KRIDLYSPLWLRW-
RPOC1_ILLOL      -------------------------------HFCSSYDALGAYRQ-KRINLYSPLWLRW-
RPOC1_CHLSC      -------------------------------YFCSSYDALGAYRQ-KRIHLDSPLWLRW-
RPOC1_CALFG      -------------------------------YFCSSSDALGAYRQ-KRINLDSPLWLRW-
RPOC1_LIRTU      -------------------------------YFCSSYDALGAYRQ-KRINLDSPLWLRW-
RPOC1_DRIGR      -------------------------------YFCSSYDALGAYRQ-KRINLDSPLWLRW-
RPOC1_CERDE      -------------------------------YFSSAYDALGAYRQ-KRINLDNPLWLRW-
RPOC1_PIPCE      -------------------------------YFCSSYDALGAYRQ-KRIHLDTPLWLRW-
RPOC1_NANDO      -------------------------------YFCSSYDALGAYRQ-KRIYLDSPLWLRW-
RPOC1_RANMC      -------------------------------YFCSSYDALGAFRQ-KRINLDSPLWLRW-
RPOC1_PLAOC      -------------------------------YFCSSYDALGAYRQ-KRINLDSPLWLRW-
RPOC1_BUXMI      -------------------------------YFCSSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_OENAR      -------------------------------FFCNSYDAIGAYRQ-KRIHLDSPLWLRW-
RPOC1_OENBI      -------------------------------FFCNSYDAIGAYRQ-KRIHLDSPLWLRW-
RPOC1_OENPA      -------------------------------FFCNSYDAIGAYRQ-KRIHLDSPLWLRW-
RPOC1_OENEH      -------------------------------FFCNSYDAIGAYRQ-KRIHLDSPLWLRW-
RPOC1_OENGL      -------------------------------FFCNSYDAIGAYRQ-KRIHLDSPLWLRW-
RPOC1_EUCGG      -------------------------------FFCNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_PANGI      -------------------------------FFCNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_DAUCA      -------------------------------FFCNSYDAIGAYRQ-KRINLDSPLWLRW-
RPOC1_SOYBN      -------------------------------FFCNSYDAIGAYQQ-KRINFDSPLWLRW-
RPOC1_PHAVU      -------------------------------FFCNSYDAIGAYQQ-KRITFDSPLWLRW-
RPOC1_LOTJA      -------------------------------FFSNSYDAIGAFRQ-KKINFDSPFWLRW-
RPOC1_HELAN      -------------------------------FFCNAYDAIGAYRQ-KRINLGSPLWLRW-
RPOC1_GUIAB      -------------------------------FFCNAYDAIGAYRQ-KRIHLGSPLWLRW-
RPOC1_LACSA      -------------------------------FFCNPYDAIGAYRQ-KRINLGSPLWLRW-
RPOC1_AGRST      -------------------------------HFSSSYDAMGAYRQ-KLISLDSPLWLRW-
RPOC1_BRADI      -------------------------------IFYSSYDALGAYRQ-KLISLDSPLWLRW-
RPOC1_WHEAT      -------------------------------HFSSSYDALGAYRQ-KLISLDSPLWLRW-
RPOC1_HORVU      -------------------------------HFSSSYDALGAYRQ-KLISLDSPLWLRW-
RPOC1_LOLPR      -------------------------------HFSSSYDALGAYRQ-KLISLDSPLWLRW-
RPOC1_ORYNI      -------------------------------LFSSSYDALGAYRQ-KQICLDSPLWLRW-
RPOC1_ORYSA      -------------------------------LFSSSYDALGAYRQ-KQICLDSPLWLRW-
RPOC1_ORYSI      -------------------------------LFSSSYDALGAYRQ-KQICLDSPLWLRW-
RPOC1_ORYSJ      -------------------------------LFSSSYDALGAYRQ-KQICLDSPLWLRW-
RPOC1_SACHY      -------------------------------HFSSSYDALGAYRQ-KRIGLNSPLWLRW-
RPOC1_SACOF      -------------------------------HFSSSYDALGAYRQ-KRIGLNSPLWLRW-
RPOC1_SORBI      -------------------------------HFSSSYDALGAYRQ-KRIGLNSPLWLRW-
RPOC1_MAIZE      -------------------------------HFSSSYDALGAYRQ-KRIGLNSPLWLRW-
RPOC1_PELHO      -------------------------------LFCNPDDAIGAYRQ-KRINLDSPFWLKV-
RPOC1_PINKO      -------------------------------SFYSYDDVLRAYRQ-KRIDLYSPLWLRW-
RPOC1_PINTH      -------------------------------SFYSYDDVLRAYRQ-KRIDLYSPLWLRW-
RPOC1_CYCTA      -------------------------------SFYSYDDALGAHWQ-KRIELDSPLWFRW-
RPOC1_WELMI      -------------------------------CFSNYDDVFIAYQQ-KRVQLNSPLWLRW-
RPOC1_GNEPA      -------------------------------CFCNYDDVFIAYQK-NRVSLKNPLWFRW-
RPOC1_CRYJA      -------------------------------SFYSYDDALKAYEQ-KQIDLDSPLWLRWG
RPOC1_HUPLU      --------------------------------FYSYDDALRAKSQ-KLINLHSFLWLRWP
RPOC1_CHAGL      -------------------------------YFCNYIDVITAYEK-KQINLHDPIWLKWY
RPOC1_STAPU      -------------------------------IFYDYDDVIISIHQ-GHLNLFSFLWLRWE
RPOC1_ZYGCR      -------------------------------TFSNFSDALTAYHQ-GIITSDLPIWLYCR
RPOC1_CHAVU      -------------------------------SFISFEDVIKARVE-RKIHLYTSLWLKL-
RPOC1_OEDCA      -------------------------------IFSDFEKIFIAYQR-NQINLHTNIWVIF-
RPOC1_OLTVI      -------------------------------FFSSQEEVLLAYHH-HKLSLHSLIWLKW-
RPOC1_TUPAK      LMDLSKNKNQNLFLNRFEKRANCKVWSDSNKYYSNWDQVLQSLNQ-QLIDLHSPIWLRW-
RPOC1_TETOB      N------------------FEKFGIQNKAFLLFSNFLSVLNAYQR-KEISLHTPVWVKWN
RPOC1_BIGNA      --------------------------ENWSIYFNNLNDVLKAYNQ-NKVNIHTEIWIKWS
                                                                       .     

RPOC1_MESVI      ----GIIDSKYIKQNPIEIRVDSL------------------------------------
RPOC1_CHLAT      ----GRIDTKSTQEEPIEIRIEES------------------------------------
RPOC1_CYAP4      ----GEVED-DDKGEP-EIQTSGD------------------------------------
RPOC1_ACAM1      ----GPVDDGEDDVEP-EVETSAD------------------------------------
RPOC1_THEEB      ----GEVDD-GDTSEP-QITTYED------------------------------------
RPOC1_TRIV2      ----GEVESDQPDTDPLEVTNNDD------------------------------------
RPOC1_NOSS1      ----GDVESDQPDTEPVKVTTNED------------------------------------
RPOC1_NOSP7      ----GEIESDQPDTEPVKVTENED------------------------------------
RPOC1_NOSCO      ----GEIESDQPDTEPVKVTENED------------------------------------
RPOC1_SYNE7      ----GEVESEGESDEPESVVAADD------------------------------------
RPOC1_SYNP6      ----GEVESEGESDEPESVVAADD------------------------------------
RPOC1_RIPO1      ---NGDVVTHKPDTEVLKTETLDD------------------------------------
RPOC1_CROS5      D-PNEEVVTDLPDTEVLKTETLED------------------------------------
RPOC1_MICAN      --VGEKVKTNKPDEEVLETETLPD------------------------------------
RPOC1_SYNY3      ---DEDVVTEKPDTEVIKTEDLGD------------------------------------
RPOC1_GLOC7      ---DLEVVTEQPDDKPIKTETSED------------------------------------
RPOC1_SYNP2      ----GDVETNEADDRVLESETLED------------------------------------
RPOC1_TRIEI      --PDVEIETDKPEEIPPDIQQISDELVVHTYWMPLDSKVLPNTLGELKSEQKCENGDLVK
RPOC1_SYNJA      ----GPMELGKEEKESEPQIIEEPG-----------------------------------
RPOC1_SYNJB      ----GPMELGKGEKESEPQIIEEAG-----------------------------------
RPOC1_GLOVI      ----GEVETDNPED----------------------------------------------
RPOC1_PROMT      ----GEIEDDDELQNPLKSETLKD------------------------------------
RPOC1_PROM1      ----GEIEDDDELQKPLKSETLKD------------------------------------
RPOC1_SYNS3      ----GEVEDEDEREEPITTETLSD------------------------------------
RPOC1_SYNPW      ----GEVEDDDEREEPVSSETLSD------------------------------------
RPOC1_SYNPX      ----GEVEDNDELDEPIKSETLSD------------------------------------
RPOC1_SYNS9      ----GEVEDDDELQEPLKSETLSD------------------------------------
RPOC1_SYNSC      ----GEVQDDEELDAPSKSESLSD------------------------------------
RPOC1_PROMM      ----GEVEDEDEIEEPIKAELLSD------------------------------------
RPOC1_PROM3      ----GEVEDEDEIDKPLKAESLSD------------------------------------
RPOC1_PROMA      ----GEVEDDDELTSPLDTQILED------------------------------------
RPOC1_PROM4      ----GEVDDDD-HGEPSHSETLED------------------------------------
RPOC1_SYNR3      ----GAVDDDDEAKEPIKSETLSD------------------------------------
RPOC1_PROM0      ----GEVEDEDEMRSPQKTQLLED------------------------------------
RPOC1_PROM2      ----GEVEDEDEMRSPQKTQELED------------------------------------
RPOC1_PROMS      ----GEVEDEDEMLSPQKTKELED------------------------------------
RPOC1_PROM9      ----GEVEDEDEMSKPQKIEELED------------------------------------
RPOC1_PROM5      ----GEVDDDEESKTPQETKELED------------------------------------
RPOC1_PROMP      ----GEVDDDEEANKPKESKELED------------------------------------
RPOC1_PAUCH      ----GEVEDDDESEMPIKIETAED------------------------------------
RPOC1_PYRYE      -----GLVDGDQPHDPIKIEKHSD------------------------------------
RPOC1_PORPU      -----GVIDSDQVKFPIKIETHHD------------------------------------
RPOC1_GRATL      -----GLVNDSSNQMVISSKLNID------------------------------------
RPOC1_GUITH      -----GNVDDDD--EKIEEKKLDG------------------------------------
RPOC1_RHDSA      -----GEVEDEN--LKIRTSILKE------------------------------------
RPOC1_CYAPA      TFSFDDILEEKNIQQVLYKREIDEF-----------------------------------
RPOC1_EMIHU      -------NVDLTEDETCSQTQSGN------------------------------------
RPOC1_CYACA      -----GTINNLDIGRFIKSTLCKNK-----------------------------------
RPOC1_THAPS      -------HKISKPSNFIKKIILND------------------------------------
RPOC1_PHATC      -------EQEINESILLKTTILDD------------------------------------
RPOC1_TRICV      -------DNYIEPLNFKKQIQLND------------------------------------
RPOC1_NEPOL      G-ESEGSLGDEFEDNPLEIRIDAN------------------------------------
RPOC1_OSTTA      ------SYIQTTNSEPLQITVNKT------------------------------------
RPOC1_PHYPA      G-SKLRTITSINREKPIEVQYNSS------------------------------------
RPOC1_MARPO      Q-INLRIITLLNQEGPIEIQYKSF------------------------------------
RPOC1_ANTAG      Q-VDLHIVTSIDREVPIEIQYESL------------------------------------
RPOC1_ANEMR      Q-TNFRMITSTPREEPIEIQYETS------------------------------------
RPOC1_PSINU      K-GFLRVITSINREFPIEIQYESS------------------------------------
RPOC1_ANGEV      Q-KDLRIITSLTRELPIEIQYESS------------------------------------
RPOC1_ADICA      K-IDLQIISSKIRELSSESHYESS------------------------------------
RPOC1_CUCSA      R-LDQRVIAS--REAPIEVHYESL------------------------------------
RPOC1_MORIN      R-LDQRVITS--REAPIEVHYQSL------------------------------------
RPOC1_SOLBU      R-LDQRVIAS--RETPIEVHYESL------------------------------------
RPOC1_SOLTU      R-LDQRVIAS--RETPIEVHYESL------------------------------------
RPOC1_SOLLC      R-LDQRVIAS--RETPIEVHYESL------------------------------------
RPOC1_NICSY      R-LDQRVIAS--RETPIEVHYESL------------------------------------
RPOC1_TOBAC      R-LDQRVIAS--RETPIEVHYESL------------------------------------
RPOC1_ATRBE      R-LDQRVIAS--RETPIEVHYESL------------------------------------
RPOC1_NICTO      R-LDQRVIAS--RETPIEVHYESL------------------------------------
RPOC1_CUSEX      R-LDRRVITS--RETPIEVHYESR------------------------------------
RPOC1_CUSRE      R-LDRRVITS--SETPIEVHYESR------------------------------------
RPOC1_IPOPU      R-LDQRVITS--RETPIEVHYESL------------------------------------
RPOC1_COFAR      P-LDQRVIAS--REIPIEVHYESL------------------------------------
RPOC1_JASNU      P-LDQRVIAS--RESPIEVHYESL------------------------------------
RPOC1_SPIOL      Q-LDQRIIAS--KEAPIEVHYESL------------------------------------
RPOC1_SILLA      R-LDQRIIAS--REAPVEVHYESL------------------------------------
RPOC1_FAGEA      Q-LDHRVVAS--REAPIEVHYESL------------------------------------
RPOC1_LEPVR      Q-LDQRVIAS--REVPIEVHYESF------------------------------------
RPOC1_CAPBU      Q-LDQRVIAS--REVPIEVHYESF------------------------------------
RPOC1_BARVE      Q-LDQRVIAS--REVPIEVHYESF------------------------------------
RPOC1_NASOF      Q-LDQRVIAS--KEVPIEVHYESF------------------------------------
RPOC1_ARATH      Q-LDQRVIAS--REVPIEVHYESF------------------------------------
RPOC1_OLIPU      Q-LDQRVIAS--REVPIEVHYESF------------------------------------
RPOC1_DRANE      Q-LDQRVIAS--REVPIEVHYESF------------------------------------
RPOC1_LOBMA      Q-LDQRVIAS--REVPIEVHYESF------------------------------------
RPOC1_ARAHI      Q-LDQRVIAS--REVPIEVHYESF------------------------------------
RPOC1_SINAL      Q-LDQRVIAS--KEVPIEVHYESF------------------------------------
RPOC1_CRUWA      Q-LDQRVIAS--REVPIEVHYESF------------------------------------
RPOC1_AETCO      Q-LDQRVSAS--REVPIEVHYESF------------------------------------
RPOC1_AETGR      Q-LDQRVSAS--REVPIEVHYESF------------------------------------
RPOC1_CARPA      Q-LDQRVIAS--REAPIEVHYESL------------------------------------
RPOC1_GOSHI      Q-LEQCVIAS--REAPIEVHYESS------------------------------------
RPOC1_GOSBA      G-NQSNALLL--QEKLPSKFTMNL------------------------------------
RPOC1_POPTR      Q-LDQGLIAS--REAPIEGHFGSL------------------------------------
RPOC1_POPAL      Q-LDQGLIAS--REAPIEGHFGSL------------------------------------
RPOC1_MANES      Q-LDQRAITS--REAPIEVHYESL------------------------------------
RPOC1_CITSI      R-LDQRLIAS--REAPIEVHYESL------------------------------------
RPOC1_VITVI      Q-LDQRLIAS--KEAPIEVHYESL------------------------------------
RPOC1_PHAAO      R-LDQRVV-GS-REVPIEIQYESF------------------------------------
RPOC1_DIOEL      R-LDQRVI-GS-REVPIEIQYESL------------------------------------
RPOC1_LEMMI      R-LDQRVIIGS-REVPLEVQYESF------------------------------------
RPOC1_ACOAM      R-LDQRVI-GS-REVPIEVQYESL------------------------------------
RPOC1_ACOCL      R-LDQRVI-GS-REVPIEVQYESL------------------------------------
RPOC1_ACOGR      R-LDQRVI-GS-REVPIEVQYESL------------------------------------
RPOC1_NYMAL      R-LDQRVIASINREVPIEVQYESL------------------------------------
RPOC1_NUPAD      R-LDQRVIASINREIPIEVQYESL------------------------------------
RPOC1_AMBTC      R-LDQCVIASINREVPIEVQYESL------------------------------------
RPOC1_ILLOL      R-LDQRVIAS--REVPIEVQYESL------------------------------------
RPOC1_CHLSC      R-LDQRVIAS--REVPIEVQYESS------------------------------------
RPOC1_CALFG      R-LDQRVIAS--REVPIEVQYESL------------------------------------
RPOC1_LIRTU      R-LDQRVIAS--REVPIEVQYESL------------------------------------
RPOC1_DRIGR      R-LDQRVIAP--REVPIEVQYESL------------------------------------
RPOC1_CERDE      R-LDQRAIAS--REVPIEVQYESL------------------------------------
RPOC1_PIPCE      R-LDQRIISL--REVPIEVQYESL------------------------------------
RPOC1_NANDO      R-LDQRVIAS--REVPIEVQYESL------------------------------------
RPOC1_RANMC      R-LDQRVIAP--REVPIEVQCESF------------------------------------
RPOC1_PLAOC      R-LDQRVIAS--REVPIEVQYESL------------------------------------
RPOC1_BUXMI      R-LDQRIIAS--REVPIEVHYESL------------------------------------
RPOC1_OENAR      R-LDQRVIAS--REVPIEVQYESL------------------------------------
RPOC1_OENBI      R-LDQRVIAS--REVPIEVQYESL------------------------------------
RPOC1_OENPA      R-LDQRVIAS--REVPIEVQYESL------------------------------------
RPOC1_OENEH      R-LDQRVIAS--REVPIEVQYESL------------------------------------
RPOC1_OENGL      R-LDQRVIAS--REVPIEVQYESL------------------------------------
RPOC1_EUCGG      R-LDQRIIAS--REVPIEIHYESL------------------------------------
RPOC1_PANGI      R-LDQRVISA--KEAPLEVHYESL------------------------------------
RPOC1_DAUCA      R-LDQRVIAA--REAPLEVHYESL------------------------------------
RPOC1_SOYBN      R-LDQRIISS--REVPIEVHYESL------------------------------------
RPOC1_PHAVU      R-LDLRIISS--REVPIEVHYESL------------------------------------
RPOC1_LOTJA      R-LDKCIMSS--REAPIEVHYESL------------------------------------
RPOC1_HELAN      R-LDQRVIAA--REAPIEIHYESL------------------------------------
RPOC1_GUIAB      R-LDQRVIAA--REAPIEIHYESL------------------------------------
RPOC1_LACSA      R-LDQRVIAA--REVPIEIHYESV------------------------------------
RPOC1_AGRST      K-LDQRVIGS--REVPIEVQYESL------------------------------------
RPOC1_BRADI      K-LDQRAIGS--REVPIEVQYESL------------------------------------
RPOC1_WHEAT      N-LDQRVIGS--REVPIEVQYESL------------------------------------
RPOC1_HORVU      N-LDQRVIGS--REVPIEIQYESL------------------------------------
RPOC1_LOLPR      K-LDQRVIGS--REVPIEVQYESL------------------------------------
RPOC1_ORYNI      K-LDQRVIGL--REVPIEVQYESL------------------------------------
RPOC1_ORYSA      K-LDQRVIGL--REVPIEVQYESL------------------------------------
RPOC1_ORYSI      K-LDQRVIGL--REVPIEVQYESL------------------------------------
RPOC1_ORYSJ      K-LDQRVIGL--REVPIEVQYESL------------------------------------
RPOC1_SACHY      K-LDQRIVGS--REVPIEVQYESF------------------------------------
RPOC1_SACOF      K-LDQRIVGS--REVPIEVQYESF------------------------------------
RPOC1_SORBI      K-LDQRIVGS--REVPIEVQYESF------------------------------------
RPOC1_MAIZE      K-LDQRIVGS--REVPIEVQYESF------------------------------------
RPOC1_PELHO      T-WGQHRIVS--KELPVEVHYESL------------------------------------
RPOC1_PINKO      GELDLRIITSVNQEAPIEVQYESL------------------------------------
RPOC1_PINTH      GEVDLRIITSVNQEAPIEVQYESL------------------------------------
RPOC1_CYCTA      G-VGLRIITSVDREAPIEVQYESL------------------------------------
RPOC1_WELMI      RVADGGILTSVDREVPIEIQHEPF------------------------------------
RPOC1_GNEPA      KVVNGTILTSVDQEVPIEFQYQSL------------------------------------
RPOC1_CRYJA      REIDTSIINSVNRELPIEVQYECL------------------------------------
RPOC1_HUPLU      VSDNLRILNSKDQEEPIEIQYDPL------------------------------------
RPOC1_CHAGL      G--NLRGTSSTKKQKLFEIQCESR------------------------------------
RPOC1_STAPU      A--KYPVISSRKG--PIEYQFDSS------------------------------------
RPOC1_ZYGCR      P--EIAVMNNSQGDCPVEAQYQPK------------------------------------
RPOC1_CHAVU      --KNIEAITSYLYQSPIEIQYNSR------------------------------------
RPOC1_OEDCA      ---NNTIESDSILQEPTEIQVLFS------------------------------------
RPOC1_OLTVI      ---EQDFEANTTFESPLEIRVDKN------------------------------------
RPOC1_TUPAK      ---NFYFEFVLKKESFLEIRLDKY------------------------------------
RPOC1_TETOB      SNVDFGNEFSKPVEIRLQIN----------------------------------------
RPOC1_BIGNA      ENIMFENNSLDLRRLEVYSG----------------------------------------
                                                                             

RPOC1_MESVI      ------------GFVSYIYKNYQMR-----------------------------------
RPOC1_CHLAT      ------------GFCSTIYRRYQYRSFKNKKELKTAATPFYNSENAYLMMNKKKMSIPQK
RPOC1_CYAP4      ------------GLVTHLYPSKRLR-----------------------------------
RPOC1_ACAM1      ------------GVVTQTYPSRRIR-----------------------------------
RPOC1_THEEB      ------------GSRLLEYALRRVK-----------------------------------
RPOC1_TRIV2      ------------GSRTVLYKYRRVR-----------------------------------
RPOC1_NOSS1      ------------GSRTVLYKYRRVR-----------------------------------
RPOC1_NOSP7      ------------GTRTLLYKFRRVR-----------------------------------
RPOC1_NOSCO      ------------GTRTLLYKFRRVR-----------------------------------
RPOC1_SYNE7      ------------GTVTKTYRFRRIR-----------------------------------
RPOC1_SYNP6      ------------GTVTKTYRFRRIR-----------------------------------
RPOC1_RIPO1      ------------GSVIKHYRERRVR-----------------------------------
RPOC1_CROS5      ------------GSVIKHYRERRVR-----------------------------------
RPOC1_MICAN      ------------GSIWKYYRERKTR-----------------------------------
RPOC1_SYNY3      ------------GTVMKYYRERKIR-----------------------------------
RPOC1_GLOC7      ------------GTVTKYYRHRKVR-----------------------------------
RPOC1_SYNP2      ------------GSILKIYRERKVR-----------------------------------
RPOC1_TRIEI      AYNLYRIHYSQEGEIKKVYIKSRQV-----------------------------------
RPOC1_SYNJA      ------------GTRLKITNYRRIR-----------------------------------
RPOC1_SYNJB      ------------GIRLKITNYRRIR-----------------------------------
RPOC1_GLOVI      ---------------------LRVR-----------------------------------
RPOC1_PROMT      ------------GTRIEEWTYRRDR-----------------------------------
RPOC1_PROM1      ------------GTRIEEWTYRRDR-----------------------------------
RPOC1_SYNS3      ------------GTRFEQWTYRRDR-----------------------------------
RPOC1_SYNPW      ------------GTRFEQWTYRRDR-----------------------------------
RPOC1_SYNPX      ------------GTRIEQWTYRRDR-----------------------------------
RPOC1_SYNS9      ------------GTRIEQWTYRRDR-----------------------------------
RPOC1_SYNSC      ------------GTRIEEWSYRRDR-----------------------------------
RPOC1_PROMM      ------------GTRIEQWTYRRDR-----------------------------------
RPOC1_PROM3      ------------GTRIEQWTYRRDR-----------------------------------
RPOC1_PROMA      ------------GTQIQQWTYRRDR-----------------------------------
RPOC1_PROM4      ------------GTRIEQWNLRRDR-----------------------------------
RPOC1_SYNR3      ------------GTRVEQWQYRRDR-----------------------------------
RPOC1_PROM0      ------------SSRLEIWNLRRDR-----------------------------------
RPOC1_PROM2      ------------GSKLEIWNLRRDR-----------------------------------
RPOC1_PROMS      ------------GSRLEIWNLRRDR-----------------------------------
RPOC1_PROM9      ------------GSRLEMWKLRRDR-----------------------------------
RPOC1_PROM5      ------------GSKLEIWNFRRDR-----------------------------------
RPOC1_PROMP      ------------GSRLETWNFRRDR-----------------------------------
RPOC1_PAUCH      ------------GSYTELWRYRRER-----------------------------------
RPOC1_PYRYE      ------------NSTTKFFNNHIIK-----------------------------------
RPOC1_PORPU      ------------NSVTKFFDNHIIK-----------------------------------
RPOC1_GRATL      ------------GTITKIFSDRIVK-----------------------------------
RPOC1_GUITH      ------------NKKLHIYPSRIKK-----------------------------------
RPOC1_RHDSA      ------------KYTLDIFTERIIK-----------------------------------
RPOC1_CYAPA      ------------GTVIKVYNTRRIR-----------------------------------
RPOC1_EMIHU      -------------LILTHGADIKSK-----------------------------------
RPOC1_CYACA      ------------LTTTDYYENLQVK-----------------------------------
RPOC1_THAPS      ------------KSYIEYYENIQIR-----------------------------------
RPOC1_PHATC      ------------ETKIEFYENLQIR-----------------------------------
RPOC1_TRICV      ------------ASYIEIYENMQIR-----------------------------------
RPOC1_NEPOL      ------------GHSWHIYSQYQLR-----------------------------------
RPOC1_OSTTA      ------------GHVTTVYDSFVMQSGATN------------------------------
RPOC1_PHYPA      ------------GISFKIYEHYQLK-----------------------------------
RPOC1_MARPO      ------------GNSFQIYEHYQLR-----------------------------------
RPOC1_ANTAG      ------------GTSSQIYENYQFR-----------------------------------
RPOC1_ANEMR      ------------GISYRIYNHYQLE-----------------------------------
RPOC1_PSINU      ------------NISVHIYENYQIR-----------------------------------
RPOC1_ANGEV      ------------GISFQIYENYQIR-----------------------------------
RPOC1_ADICA      ------------GTSFHFYENCRIR-----------------------------------
RPOC1_CUCSA      ------------GTHHEIYGYYLIV-----------------------------------
RPOC1_MORIN      ------------GTYHEIYGHLLIV-----------------------------------
RPOC1_SOLBU      ------------GTFYEIYGHYLIV-----------------------------------
RPOC1_SOLTU      ------------GTFYEIYGHYLIV-----------------------------------
RPOC1_SOLLC      ------------GTFYEIYGHYLIV-----------------------------------
RPOC1_NICSY      ------------GTFYEIYGHYLIV-----------------------------------
RPOC1_TOBAC      ------------GTFYEIYGHYLIV-----------------------------------
RPOC1_ATRBE      ------------GTFYEIYGHYLIV-----------------------------------
RPOC1_NICTO      ------------GTFYEIYGHYLIV-----------------------------------
RPOC1_CUSEX      ------------GTYFEIYGHFLIV-----------------------------------
RPOC1_CUSRE      ------------GTFSEIYGHFLIV-----------------------------------
RPOC1_IPOPU      ------------GTYYEIYGHYLIV-----------------------------------
RPOC1_COFAR      ------------GIYYEIYGHYLIV-----------------------------------
RPOC1_JASNU      ------------GTYYEIYGHYLIV-----------------------------------
RPOC1_SPIOL      ------------GTYHEIYAHYLII-----------------------------------
RPOC1_SILLA      ------------GTYHEIYAHYLII-----------------------------------
RPOC1_FAGEA      ------------GTYHEIYGNYLIV-----------------------------------
RPOC1_LEPVR      ------------GNYHEIYAHYLIV-----------------------------------
RPOC1_CAPBU      ------------GNYHEIYAHYLIV-----------------------------------
RPOC1_BARVE      ------------GNYHEIYAHYLIV-----------------------------------
RPOC1_NASOF      ------------GNYHEIYAHYLIV-----------------------------------
RPOC1_ARATH      ------------GNYHEIYAHYLIV-----------------------------------
RPOC1_OLIPU      ------------GNYHEIYAHYLIV-----------------------------------
RPOC1_DRANE      ------------GNYHEIYAHYLIV-----------------------------------
RPOC1_LOBMA      ------------GNYHEIYAHYLIV-----------------------------------
RPOC1_ARAHI      ------------GNYHEIYAHYLIV-----------------------------------
RPOC1_SINAL      ------------GNYHEIYAHYLIV-----------------------------------
RPOC1_CRUWA      ------------GNYHEIYAHYLIV-----------------------------------
RPOC1_AETCO      ------------GTYHEIYAHYLIV-----------------------------------
RPOC1_AETGR      ------------GTYHEIYAHYLIV-----------------------------------
RPOC1_CARPA      ------------GTYHEIYGHYLIV-----------------------------------
RPOC1_GOSHI      ------------GTYHEIYGHYLIV-----------------------------------
RPOC1_GOSBA      ------------RVPIMRFMDIIQQ-----------------------------------
RPOC1_POPTR      ------------GTYHEIYGHYLIV-----------------------------------
RPOC1_POPAL      ------------GTYHEIYGHYLIV-----------------------------------
RPOC1_MANES      ------------GTYHEIYEHYLIV-----------------------------------
RPOC1_CITSI      ------------GTSHEIYGHYLIV-----------------------------------
RPOC1_VITVI      ------------GTYHEIYGHYLIV-----------------------------------
RPOC1_PHAAO      ------------GNYNEIYKHYQII-----------------------------------
RPOC1_DIOEL      ------------GTYHEIYRHYLIV-----------------------------------
RPOC1_LEMMI      ------------GTYHEIYRHYLIV-----------------------------------
RPOC1_ACOAM      ------------GTYQEIYGHYLIV-----------------------------------
RPOC1_ACOCL      ------------GTYQEIYGHYLIV-----------------------------------
RPOC1_ACOGR      ------------GTYQEIYGHYLIV-----------------------------------
RPOC1_NYMAL      ------------GTYHEIYDHYRVV-----------------------------------
RPOC1_NUPAD      ------------GTYHEIYDHYRVV-----------------------------------
RPOC1_AMBTC      ------------GIYHEIHEHYRIV-----------------------------------
RPOC1_ILLOL      ------------GTYHEIYGHYQIV-----------------------------------
RPOC1_CHLSC      ------------GTHHEIYGHYLIV-----------------------------------
RPOC1_CALFG      ------------GTYHEIYGHYLIV-----------------------------------
RPOC1_LIRTU      ------------GTYHEIYGHYLIV-----------------------------------
RPOC1_DRIGR      ------------GTYHEIYGHYLLV-----------------------------------
RPOC1_CERDE      ------------GTYHEIYGQYLIV-----------------------------------
RPOC1_PIPCE      ------------GTYHEIYRPYLIV-----------------------------------
RPOC1_NANDO      ------------GTYHEIYGHYLIV-----------------------------------
RPOC1_RANMC      ------------GTYHEIYGHYLIV-----------------------------------
RPOC1_PLAOC      ------------GTYHEIYGHYLIV-----------------------------------
RPOC1_BUXMI      ------------GTYHEIYVNYLIV-----------------------------------
RPOC1_OENAR      ------------GTYHEIYGHYIIV-----------------------------------
RPOC1_OENBI      ------------GTYHEIYGHYIIV-----------------------------------
RPOC1_OENPA      ------------GTYHEIYGHYIIV-----------------------------------
RPOC1_OENEH      ------------GTYHEIYGHYIIV-----------------------------------
RPOC1_OENGL      ------------GTYHEIYGHYIIV-----------------------------------
RPOC1_EUCGG      ------------GTYHEIYGHYLIV-----------------------------------
RPOC1_PANGI      ------------GTYYEIYGQYLIV-----------------------------------
RPOC1_DAUCA      ------------GTYYDIYGQYLIV-----------------------------------
RPOC1_SOYBN      ------------GTYHEIYEHYLVV-----------------------------------
RPOC1_PHAVU      ------------GTYHEIYGHYLVV-----------------------------------
RPOC1_LOTJA      ------------GTYHDIYEHYLVI-----------------------------------
RPOC1_HELAN      ------------GTYYEIYGHYLIV-----------------------------------
RPOC1_GUIAB      ------------GTYYEIYGHYLIV-----------------------------------
RPOC1_LACSA      ------------GTYYEIYGHYLIV-----------------------------------
RPOC1_AGRST      ------------GTYHEIYAHYLIV-----------------------------------
RPOC1_BRADI      ------------GTYHEIYAHYLIV-----------------------------------
RPOC1_WHEAT      ------------GTYHEIYAHYLIM-----------------------------------
RPOC1_HORVU      ------------GTYHEIYAHYLIM-----------------------------------
RPOC1_LOLPR      ------------GTYHEIYAHYLIV-----------------------------------
RPOC1_ORYNI      ------------GTYREIYAHYLVV-----------------------------------
RPOC1_ORYSA      ------------GTYREIYAHYLVV-----------------------------------
RPOC1_ORYSI      ------------GTYREIYAHYLVV-----------------------------------
RPOC1_ORYSJ      ------------GTYREIYAHYLVV-----------------------------------
RPOC1_SACHY      ------------GTYHEIYAHYLVV-----------------------------------
RPOC1_SACOF      ------------GTYHEIYAHYLVV-----------------------------------
RPOC1_SORBI      ------------GTYHEIYAHYLVV-----------------------------------
RPOC1_MAIZE      ------------GTYHEIYAHYLVV-----------------------------------
RPOC1_PELHO      ------------GTHHEIYGHCKIV-----------------------------------
RPOC1_PINKO      ------------GTFHEIHEHYRIR-----------------------------------
RPOC1_PINTH      ------------GTFHEIHEHYRIR-----------------------------------
RPOC1_CYCTA      ------------GIFHEIYEHYRIG-----------------------------------
RPOC1_WELMI      ------------GTSQEIYEHYAIQ-----------------------------------
RPOC1_GNEPA      ------------GTSQQIYEHYTIQ-----------------------------------
RPOC1_CRYJA      ------------GTFYEIYDHFRIR-----------------------------------
RPOC1_HUPLU      ------------GNSHRIYEHFQIR-----------------------------------
RPOC1_CHAGL      ------------GTRRKIFENWHFC-----------------------------------
RPOC1_STAPU      ------------GNSINIYDNSYIK-----------------------------------
RPOC1_ZYGCR      ------------GIYLNVYEHSQIR-----------------------------------
RPOC1_CHAVU      ------------GTRSITYEDWNIC-----------------------------------
RPOC1_OEDCA      ------------GQYIKVYSDYYQK-----------------------------------
RPOC1_OLTVI      ------------GNSTHLYRNNLYR-----------------------------------
RPOC1_TUPAK      ------------GNSVYINPNYQSY-----------------------------------
RPOC1_TETOB      ------------GSWEEIQPKYTTF-----------------------------------
RPOC1_BIGNA      ------------KFFRFQYENYQIN-----------------------------------
                                                                             

RPOC1_MESVI      --------------------------------------KDFKNNLISQ------------
RPOC1_CHLAT      PSLESNNLSLTATATATATATATATATATATATATATATNANDHYFVQ------------
RPOC1_CYAP4      --------------------------------------FDQDGKLISQ------------
RPOC1_ACAM1      --------------------------------------KDADGTLISQ------------
RPOC1_THEEB      --------------------------------------EDANGQRISQ------------
RPOC1_TRIV2      --------------------------------------EDAQGNLISQ------------
RPOC1_NOSS1      --------------------------------------EDAQGNVISQ------------
RPOC1_NOSP7      --------------------------------------QDAKGNVLSQ------------
RPOC1_NOSCO      --------------------------------------QDAKGNVLSQ------------
RPOC1_SYNE7      --------------------------------------ETEDGQRLSQ------------
RPOC1_SYNP6      --------------------------------------ETEDGQRLSQ------------
RPOC1_RIPO1      --------------------------------------E-KDGEVISQ------------
RPOC1_CROS5      --------------------------------------E-IDGEAVSQ------------
RPOC1_MICAN      --------------------------------------E-KDGEIISQ------------
RPOC1_SYNY3      --------------------------------------EGVDGEIITQ------------
RPOC1_GLOC7      --------------------------------------ETADGKLICQ------------
RPOC1_SYNP2      --------------------------------------ETAEGEMISQ------------
RPOC1_TRIEI      --------------------------------------RQSNGLVTTQ------------
RPOC1_SYNJA      --------------------------------------EDRDGNVISQ------------
RPOC1_SYNJB      --------------------------------------EDQNGNVISQ------------
RPOC1_GLOVI      --------------------------------------RDEQGNALSQ------------
RPOC1_PROMT      --------------------------------------LDEDGSLISR------------
RPOC1_PROM1      --------------------------------------LDEDGSLISR------------
RPOC1_SYNS3      --------------------------------------FDEDGALISR------------
RPOC1_SYNPW      --------------------------------------FDDDGALISR------------
RPOC1_SYNPX      --------------------------------------FDEDGALISR------------
RPOC1_SYNS9      --------------------------------------FDEEGALISR------------
RPOC1_SYNSC      --------------------------------------FDEDGALISR------------
RPOC1_PROMM      --------------------------------------FDEDGALISR------------
RPOC1_PROM3      --------------------------------------FDEDGALISR------------
RPOC1_PROMA      --------------------------------------LDEEGALISR------------
RPOC1_PROM4      --------------------------------------LDEQGALISR------------
RPOC1_SYNR3      --------------------------------------LDEDGALISR------------
RPOC1_PROM0      --------------------------------------FDSDNNLISR------------
RPOC1_PROM2      --------------------------------------FDSDNNLISR------------
RPOC1_PROMS      --------------------------------------FGSDNNLISR------------
RPOC1_PROM9      --------------------------------------FDSQNNLISR------------
RPOC1_PROM5      --------------------------------------FDSQNNLISR------------
RPOC1_PROMP      --------------------------------------FDSQNNLISR------------
RPOC1_PAUCH      --------------------------------------FDKDKALVSR------------
RPOC1_PYRYE      --------------------------------------EDAENQRIVQ------------
RPOC1_PORPU      --------------------------------------EDAEHQRIVQ------------
RPOC1_GRATL      --------------------------------------YDNDGQMVVQ------------
RPOC1_GUITH      --------------------------------------LDQDNNLMVQ------------
RPOC1_RHDSA      --------------------------------------TDEEKKVIAQ------------
RPOC1_CYAPA      --------------------------------------EDKDGFCLTQ------------
RPOC1_EMIHU      --------------------------------------QSSSQDTKTK------------
RPOC1_CYACA      --------------------------------------KDIEGTITCQ------------
RPOC1_THAPS      --------------------------------------KDENDQIIVQ------------
RPOC1_PHATC      --------------------------------------KTKDNQLIVQ------------
RPOC1_TRICV      --------------------------------------RDKDGNKIVQ------------
RPOC1_NEPOL      --------------------------------------YDDEGDLISQ------------
RPOC1_OSTTA      ---------------------------GPDNSMLSVQMKSRDTSSISKVYNCLTSLNAAA
RPOC1_PHYPA      --------------------------------------KNKNEKNFSV------------
RPOC1_MARPO      --------------------------------------KNKNQEIIST------------
RPOC1_ANTAG      --------------------------------------KNRKEKILSM------------
RPOC1_ANEMR      --------------------------------------INAQREIISI------------
RPOC1_PSINU      --------------------------------------KDKKGNRLSL------------
RPOC1_ANGEV      --------------------------------------KGQSEDILSL------------
RPOC1_ADICA      --------------------------------------KCRDGSISSM------------
RPOC1_CUCSA      --------------------------------------KSIKKEILCI------------
RPOC1_MORIN      --------------------------------------RSIKKEILCI------------
RPOC1_SOLBU      --------------------------------------RSLKKKILFI------------
RPOC1_SOLTU      --------------------------------------RSLKKKILFI------------
RPOC1_SOLLC      --------------------------------------RSLKKKILFI------------
RPOC1_NICSY      --------------------------------------RSLKKQILFI------------
RPOC1_TOBAC      --------------------------------------RSLKKQILFI------------
RPOC1_ATRBE      --------------------------------------RSLKKQILFI------------
RPOC1_NICTO      --------------------------------------RSLKKQILFI------------
RPOC1_CUSEX      --------------------------------------RSLKKKILFI------------
RPOC1_CUSRE      --------------------------------------RSLKKKILFI------------
RPOC1_IPOPU      --------------------------------------RSLKKEIIFI------------
RPOC1_COFAR      --------------------------------------KSIKKEILFL------------
RPOC1_JASNU      --------------------------------------RSIKKEILFL------------
RPOC1_SPIOL      --------------------------------------RSVKKEIIDI------------
RPOC1_SILLA      --------------------------------------RNIKKEIIFV------------
RPOC1_FAGEA      --------------------------------------RSVKKEIIFI------------
RPOC1_LEPVR      --------------------------------------RSVKKETFCI------------
RPOC1_CAPBU      --------------------------------------RSVKKETFCI------------
RPOC1_BARVE      --------------------------------------RSVKKETFCI------------
RPOC1_NASOF      --------------------------------------RSVKKETFCI------------
RPOC1_ARATH      --------------------------------------RSVKKENFCI------------
RPOC1_OLIPU      --------------------------------------RSVKKETFCI------------
RPOC1_DRANE      --------------------------------------RSVKKETFCI------------
RPOC1_LOBMA      --------------------------------------RSVKKETFCI------------
RPOC1_ARAHI      --------------------------------------RSVKKETFFI------------
RPOC1_SINAL      --------------------------------------RSVKKETLYI------------
RPOC1_CRUWA      --------------------------------------RSVKKETYCI------------
RPOC1_AETCO      --------------------------------------RSIKKETFCV------------
RPOC1_AETGR      --------------------------------------RSVKKETFCV------------
RPOC1_CARPA      --------------------------------------RSVKKEILCI------------
RPOC1_GOSHI      --------------------------------------RSLKKKILCI------------
RPOC1_GOSBA      --------------------------------------QEVQKKKFFV------------
RPOC1_POPTR      --------------------------------------RSIKKKILSI------------
RPOC1_POPAL      --------------------------------------RNIKKKILSI------------
RPOC1_MANES      --------------------------------------RNIKKEILCI------------
RPOC1_CITSI      --------------------------------------RSVKKEILSI------------
RPOC1_VITVI      --------------------------------------RSVKKEIPCI------------
RPOC1_PHAAO      --------------------------------------GSVKIEICCI------------
RPOC1_DIOEL      --------------------------------------RSVKKKIRWI------------
RPOC1_LEMMI      --------------------------------------RSVKKEICSI------------
RPOC1_ACOAM      --------------------------------------RSVKKEILCI------------
RPOC1_ACOCL      --------------------------------------RSVKKEILCI------------
RPOC1_ACOGR      --------------------------------------RSVKKEILCI------------
RPOC1_NYMAL      --------------------------------------RSVKKGMLCI------------
RPOC1_NUPAD      --------------------------------------RSVKKGMLCI------------
RPOC1_AMBTC      --------------------------------------KSVKKEIVCI------------
RPOC1_ILLOL      --------------------------------------RSIKKEILCI------------
RPOC1_CHLSC      --------------------------------------RSVKKEILCI------------
RPOC1_CALFG      --------------------------------------RSIKKEILCI------------
RPOC1_LIRTU      --------------------------------------RSVKKEILCI------------
RPOC1_DRIGR      --------------------------------------RSVKKESLCI------------
RPOC1_CERDE      --------------------------------------RSVKKEILCI------------
RPOC1_PIPCE      --------------------------------------KSVKKEILCI------------
RPOC1_NANDO      --------------------------------------RNVKKEILCI------------
RPOC1_RANMC      --------------------------------------RNVNKKIFCI------------
RPOC1_PLAOC      --------------------------------------RSVKKEILCI------------
RPOC1_BUXMI      --------------------------------------KSVKKEILCI------------
RPOC1_OENAR      --------------------------------------RSVKTEILWM------------
RPOC1_OENBI      --------------------------------------RSVKTEILWM------------
RPOC1_OENPA      --------------------------------------RSVKTEILWM------------
RPOC1_OENEH      --------------------------------------RSVKTEILWM------------
RPOC1_OENGL      --------------------------------------RSVKTEILWM------------
RPOC1_EUCGG      --------------------------------------RSVKKEIICI------------
RPOC1_PANGI      --------------------------------------RSIKKEILYI------------
RPOC1_DAUCA      --------------------------------------RSIKKEILSI------------
RPOC1_SOYBN      --------------------------------------RSTKKEIRSI------------
RPOC1_PHAVU      --------------------------------------RSIKKQMRSI------------
RPOC1_LOTJA      --------------------------------------RSIKKQICCI------------
RPOC1_HELAN      --------------------------------------RSIKKEILYI------------
RPOC1_GUIAB      --------------------------------------RSIKKEILYI------------
RPOC1_LACSA      --------------------------------------RSIKKEILYI------------
RPOC1_AGRST      --------------------------------------GNRKKEIRSI------------
RPOC1_BRADI      --------------------------------------GNRKKEICSI------------
RPOC1_WHEAT      --------------------------------------GNRKKEIRSI------------
RPOC1_HORVU      --------------------------------------GNRKKEIRSI------------
RPOC1_LOLPR      --------------------------------------GNRKKEIRSI------------
RPOC1_ORYNI      --------------------------------------GNRKKEIRSI------------
RPOC1_ORYSA      --------------------------------------GNRKKEIRSI------------
RPOC1_ORYSI      --------------------------------------GNRKKEIRSI------------
RPOC1_ORYSJ      --------------------------------------GNRKKEIRSI------------
RPOC1_SACHY      --------------------------------------GNRKKEIRSI------------
RPOC1_SACOF      --------------------------------------GNRKKEIRSI------------
RPOC1_SORBI      --------------------------------------GNRKKEIRSI------------
RPOC1_MAIZE      --------------------------------------GNRKKEIRSI------------
RPOC1_PELHO      --------------------------------------RSVKTERHFI------------
RPOC1_PINKO      --------------------------------------KGRMGEILNI------------
RPOC1_PINTH      --------------------------------------KGRMGEILNI------------
RPOC1_CYCTA      --------------------------------------KNEVGEILSI------------
RPOC1_WELMI      --------------------------------------KNRMGKISNI------------
RPOC1_GNEPA      --------------------------------------RARSGKVLTI------------
RPOC1_CRYJA      --------------------------------------KGRVGEILNK------------
RPOC1_HUPLU      --------------------------------------KDREEKKLSI------------
RPOC1_CHAGL      --------------------------------------ENIRNRKFTI------------
RPOC1_STAPU      --------------------------------------KNRKGNSFSK------------
RPOC1_ZYGCR      --------------------------------------TDKLGKTVQK------------
RPOC1_CHAVU      --------------------------------------ENIEGEKISI------------
RPOC1_OEDCA      --------------------------------------FNRNGKIYNQ------------
RPOC1_OLTVI      --------------------------------------FNSKGEKLQQ------------
RPOC1_TUPAK      --------------------------------------SNSKLEKIVF------------
RPOC1_TETOB      --------------------------------------YNYKNKQLQK------------
RPOC1_BIGNA      --------------------------------------YNLKGYQLSQ------------
                                                                             

RPOC1_MESVI      -YIRTTPGRILFNQVIQNSLDYSPSEY---------------------------------
RPOC1_CHLAT      -YVRTTPGRILFNQVIHECLELNEIHP---------------------------------
RPOC1_CYAP4      -YIRTTPGRIIYNKTIQESLAI--------------------------------------
RPOC1_ACAM1      -YIRTTPGRIIYNKTIQDSLAS--------------------------------------
RPOC1_THEEB      -YIRTTPGRIIYNQTIQEALAS--------------------------------------
RPOC1_TRIV2      -YVRTTPGRVIYNKAIQEALAS--------------------------------------
RPOC1_NOSS1      -YIYTTPGRVIYNKAIQEALAS--------------------------------------
RPOC1_NOSP7      -YIYTTPGRVIYNNAIQEALAS--------------------------------------
RPOC1_NOSCO      -YIYTTPGRVIYNNAIQEALAS--------------------------------------
RPOC1_SYNE7      -YVKTTPGRILFNNTVQTALIH--------------------------------------
RPOC1_SYNP6      -YVKTAPGRILFNNTVQTALIH--------------------------------------
RPOC1_RIPO1      -FIRTTPGRIIYNKTIEDALVAL-------------------------------------
RPOC1_CROS5      -FIRTTPGRIIYNKTIQDALTVA-------------------------------------
RPOC1_MICAN      -YVRTTVGRIIYNKTILEALVV--------------------------------------
RPOC1_SYNY3      -YIQTTPGRIIYNKTIAEALVF--------------------------------------
RPOC1_GLOC7      -FIHTTVGRIIYNKTVQDTLVA--------------------------------------
RPOC1_SYNP2      -FIRTTPGRIIYNKTIQDALDLTERTLPEGLPV---------------------------
RPOC1_TRIEI      -FVVTTPGRIIINQTIQSVL----------------------------------------
RPOC1_SYNJA      -YIRTTAGRIIFNKTVQDILSA--------------------------------------
RPOC1_SYNJB      -YIRTTPGRIIFNKTVQDILSA--------------------------------------
RPOC1_GLOVI      -FVRTTVGRIIFNQVIQETLVAS-------------------------------------
RPOC1_PROMT      -YILTTVGRVVMNHTIIDAVAATS------------------------------------
RPOC1_PROM1      -YILTTVGRVVMNHTIIDAVAATS------------------------------------
RPOC1_SYNS3      -YILTTVGRVVMNHTIIDAVAAT-------------------------------------
RPOC1_SYNPW      -YILTTVGRVVMNHTIIDAVAAT-------------------------------------
RPOC1_SYNPX      -YILTTTGRVVMNHTIIGAVAAA-------------------------------------
RPOC1_SYNS9      -YVLTTVGRVVMNHTIIDAVASA-------------------------------------
RPOC1_SYNSC      -YILTTVGRVVMNHTIIDAVAAA-------------------------------------
RPOC1_PROMM      -YILTTVGRVVMNYTIIDAVAVA-------------------------------------
RPOC1_PROM3      -YILTTVGRVVMNYTIIDAVAAA-------------------------------------
RPOC1_PROMA      -FLLTTVGRVVMNNTIIDAVASG-------------------------------------
RPOC1_PROM4      -FVLTTVGRVVMNHTIIDAVAIA-------------------------------------
RPOC1_SYNR3      -YVLTTTGRVVMNRTIIDAVVTR-------------------------------------
RPOC1_PROM0      -FILTTVGRVVMNYTIIDSVSKT-------------------------------------
RPOC1_PROM2      -FVLTTVGRVVMNYTIIDSVSKT-------------------------------------
RPOC1_PROMS      -FVLTTVGRVVMNYTIIDSVSKT-------------------------------------
RPOC1_PROM9      -FVLTTVGRVVMNYTIIDSVSKT-------------------------------------
RPOC1_PROM5      -FILTTVGRVVMNHTIIDSVSKT-------------------------------------
RPOC1_PROMP      -FILTTVGRVVMNHTIIDSVSKT-------------------------------------
RPOC1_PAUCH      -YLLTTVGRVIMNTSIMNSINAN-------------------------------------
RPOC1_PYRYE      -YIRTTAGRIIFNKIIQESLLA--------------------------------------
RPOC1_PORPU      -YIRTTPGRIIFNKIIQESLVA--------------------------------------
RPOC1_GRATL      -YIRTTAGRILFNKAIRESLL---------------------------------------
RPOC1_GUITH      -YILTTPGRILLNNVLFDSLQLQF------------------------------------
RPOC1_RHDSA      -YILTTPGRILLNKTLFDSLTLSN------------------------------------
RPOC1_CYAPA      -YIITTAGRVLFNKVVQKALIMEI------------------------------------
RPOC1_EMIHU      -YIRTTPGRILLNEIFQ-------------------------------------------
RPOC1_CYACA      -FIKTSVGRIFFNIAISGNLFFSTSNHNK-------------------------------
RPOC1_THAPS      -YLQTTTGRVLLNYIIQTTLNLKP------------------------------------
RPOC1_PHATC      -YVQTTTGRAILNYIIQKTLNFL-------------------------------------
RPOC1_TRICV      -YLQTTTGRVIFNYTVQTTLNLLS------------------------------------
RPOC1_NEPOL      -FIRTTTGRVVFNQLVHRHIEWSLHDQVMEEIETEFPESVLPPDVMRCLVRLYSAHAIGE
RPOC1_OSTTA      FYILTTPGRVLFNNLIYENLFL--------------------------------------
RPOC1_PHYPA      -YICTTVGRIIFNQQIEEAIQGTLKASLFRNQSLPAITI---------------------
RPOC1_MARPO      -YICTTAGRILFNQQIEEAIQGTYKASLKQKTFVQKIEKNG-------------------
RPOC1_ANTAG      -YICTTAGRILFNQQIEEAIQGFFEVSQHRSRPLPAIIA---------------------
RPOC1_ANEMR      -YICTTVGRVLFNQRIDEAIQGTCQASSRQTMLYIGNKEDRFLSSEKLNRRYK-------
RPOC1_PSINU      -YIRTTAGRVLFNQQIEEAIQGTLKAF---------------------------------
RPOC1_ANGEV      -YILTTAGRILFNQQIEEAIQSTLEASQHRNQQLLAITI---------------------
RPOC1_ADICA      -YVLTTAGRILFNQQLKEAMQGVSKNSFSYTTSSTLSTSTIDRCNTNSNNEE--------
RPOC1_CUCSA      -YIRTTVGHISLYREIEEAIQGFCRACS--YGT---------------------------
RPOC1_MORIN      -YLRTTVGHISLYREIEEAIQGFFRACS--YGT---------------------------
RPOC1_SOLBU      -YIRTTVGHIALYREIEEAIQGFSRAYS--YAT---------------------------
RPOC1_SOLTU      -YIRTTVGHIALYREIEEAIQGFSRAYS--YAT---------------------------
RPOC1_SOLLC      -YIRTTVGHIALYREIEEAIQGFSRAYS--YAT---------------------------
RPOC1_NICSY      -YIRTTVGHIALYREIEEAIQGFSRAYS--SGT---------------------------
RPOC1_TOBAC      -YIRTTVGHIALYREIEEAIQGFSRAYS--SGT---------------------------
RPOC1_ATRBE      -YIRTTVGHIALYREIEEAIQGFSRAYS--YGT---------------------------
RPOC1_NICTO      -YIRTTVGHIALYREIEEAIQGFSRAYS--YGT---------------------------
RPOC1_CUSEX      -YLRTTVGHISLYREIEEAIQGFSRAWS--SDT---------------------------
RPOC1_CUSRE      -YLRTTVGHISLYREIEEAIQGFSRAWS--SDT---------------------------
RPOC1_IPOPU      -YIRTTVGHISLYREIEEAIQGFSRAGS--SDT---------------------------
RPOC1_COFAR      -YIRTTVGHISLYREIEEAIQGFSHACS--YGT---------------------------
RPOC1_JASNU      -YIRTTVGHISLYREIEEAIEGFSQACSSSYGTYTKLSNSRI------------------
RPOC1_SPIOL      -YIRTTVGHISLYREIEEAIQGFYQACS--------------------------------
RPOC1_SILLA      -YIRTTVGHIYLYREIEEAIQGFSRACS--YGKTVLK-----------------------
RPOC1_FAGEA      -YIRTTVGHISFYREIEEAIQGFYRACS--YGT---------------------------
RPOC1_LEPVR      -YIRTTVGHISFYREIEEAIQGFSQACS--YDT---------------------------
RPOC1_CAPBU      -YIRTTVGHISFYREIEEAIQGFSQACS--YDT---------------------------
RPOC1_BARVE      -YIRTTVGHISFYREIEEAIQGFSQACS--YDT---------------------------
RPOC1_NASOF      -YIRTTVGHISFYRELEEAVQGFSQACS--YDT---------------------------
RPOC1_ARATH      -YIRTTVGHISFYREIEEAIQGFSQACS--YDT---------------------------
RPOC1_OLIPU      -YIRTTVGHISFYREIEEAIQGFSQACS--YAT---------------------------
RPOC1_DRANE      -YIRTTAGHISFYREIEEAIQGFSQACS--YDT---------------------------
RPOC1_LOBMA      -YIRTTAGHISFYREIEEAIQGFSQACS--YDT---------------------------
RPOC1_ARAHI      -YIRTTVGHISFYREIEEAIQGFSQACS--YDT---------------------------
RPOC1_SINAL      -YIRTTVGHISLYREIEEAIQGFSQACS--YDT---------------------------
RPOC1_CRUWA      -YIRTTVGHISFYREIEEAIQGFSQACS--YDT---------------------------
RPOC1_AETCO      -YIRTTVGHISFYREIEEAIQGFSQACS--YDT---------------------------
RPOC1_AETGR      -YIRTTVGHISFYREIEEAIQGFSQACS--YDT---------------------------
RPOC1_CARPA      -YIRTTVGHISLYREIEEAIQGFCRACS--YDT---------------------------
RPOC1_GOSHI      -YIRTTVGHISLYREIEEAIQGFFRAYSYDTQSYGI------------------------
RPOC1_GOSBA      -YTFEPLLVIFLFTEKSKKLYKGFFGPTHMIPNHMVSKLKNSMTPI--------------
RPOC1_POPTR      -YIRTTVGHIYLYREIEEAIQGFCQACS--DGT---------------------------
RPOC1_POPAL      -YIRTTVGHIYLYREIEEAIQGFCQACS--DGT---------------------------
RPOC1_MANES      -YIRTTVGHISLYREIEEAIQGFCQACS--DGI---------------------------
RPOC1_CITSI      -YIRTTVGHISLYREIEEAIQGFCRACS--YGT---------------------------
RPOC1_VITVI      -YIRTTVGHISLYREIEEAIQGFCRACS--YET---------------------------
RPOC1_PHAAO      -YIRTTAGHISFYREIEEAIQGFWRAYS--------------------------------
RPOC1_DIOEL      -YIRTTIGHISFYREIEEAVQGFCWAYS--YVI---------------------------
RPOC1_LEMMI      -YIRTTVGHISFYREIEEAIQGFYRAYS--YAS---------------------------
RPOC1_ACOAM      -YIRTTVGHISFYREIEESVQGFCRAYS--YGT---------------------------
RPOC1_ACOCL      -YIRTTVGHISFYREIEESVQGFCRAYS--YGT---------------------------
RPOC1_ACOGR      -YIRTTVGHISFYREIEESVQGFCRAYS--YGT---------------------------
RPOC1_NYMAL      -YIRTTVGHISFYREIEEAIQGFCRSYS--YGT---------------------------
RPOC1_NUPAD      -YIRTTVGHISFYREIEEAVQGFCRSYS--YSYGT-------------------------
RPOC1_AMBTC      -YIRTTVGHISFYREIEEAIQGFCRTY---------------------------------
RPOC1_ILLOL      -YIRTTIGHISFYREIEEAVQGFCRAYS--YGT---------------------------
RPOC1_CHLSC      -YIRTTVGHISFYREIEEAIQGFCRAYS--YGT---------------------------
RPOC1_CALFG      -YIRTTVGHISFYREIEEAIQGFCRAYS--------------------------------
RPOC1_LIRTU      -YIRTTVGHISFYREIEEAIQGFCRAYL--YDT---------------------------
RPOC1_DRIGR      -YIRTTVGHISFYREIEEAIQGFCRAYS--------------------------------
RPOC1_CERDE      -YIRTTVGHISFYREIEEAIQGFCRAYS--YGT---------------------------
RPOC1_PIPCE      -YIRTTVGHISFYREIEEAIQGFCRAYS--YDGT--------------------------
RPOC1_NANDO      -DIRTTVGHISFYREIEEAIQGFCRACS--YGT---------------------------
RPOC1_RANMC      -DIRTTVGLISFYREIEEAIQGFCRACS--YST---------------------------
RPOC1_PLAOC      -YIRTTVGHISFYREIEEAIQGFCRACS--YGT---------------------------
RPOC1_BUXMI      -YIRTTVGHIYFYRKIEEAVQGFFRACS--YGT---------------------------
RPOC1_OENAR      -YIRTTVGHISLFREMEEAIQGFCRARW--YLS---------------------------
RPOC1_OENBI      -YIRTTVGHISLFREMEEAIQGFCRARW--YLS---------------------------
RPOC1_OENPA      -YIRTTVGHISLFREMEEAIQGFCRARW--YLS---------------------------
RPOC1_OENEH      -YIRTTVGHISLFREMEEAIQGFCRARW--YLS---------------------------
RPOC1_OENGL      -YIRTTVGHISLFREMEEAIQGFCRARW--YLS---------------------------
RPOC1_EUCGG      -YIRTTVGHISLFREIEEAIQGFCRACS--FGT---------------------------
RPOC1_PANGI      -YIRTTVGHISLYREIEEAIQGFCQACSYGP-----------------------------
RPOC1_DAUCA      -YIRTTVGHISIYREIEEAIQGFCQAC---------------------------------
RPOC1_SOYBN      -YIRTNVGHISFYREIEEAIQGFCRAYS--YDI---------------------------
RPOC1_PHAVU      -YIRTNVGHISFYREIEEAVQGFCRAYS--YDI---------------------------
RPOC1_LOTJA      -YIRTTIGHISFYREIEEAIQGFCRGYS--YGI---------------------------
RPOC1_HELAN      -YIRTTLGHISLYREIEEAIQGFWQGCYNSMLPARIRVSPG-------------------
RPOC1_GUIAB      -YIRTTLGHIYLYREIEEAIQGFWQGCCNSMLPAGIRVSPG-------------------
RPOC1_LACSA      -YIRTTLGHISLYREIEEAIQGFWQGCCNSMLPTGIRVSPG-------------------
RPOC1_AGRST      -YIRTTLGHISFYREIEEAIQGFSQAYS--YTI---------------------------
RPOC1_BRADI      -YIRTTLGHISFYREIEEAVQGFSQAYS--YTI---------------------------
RPOC1_WHEAT      -YIRTTLGHISFYREIEEAIQGFSQAYS--YTT---------------------------
RPOC1_HORVU      -YIRTTLGHISFYREIEEAVQGFSQAYS--YTT---------------------------
RPOC1_LOLPR      -YIRTTLGHISFYRELEEAIQGFSQAYS--YTI---------------------------
RPOC1_ORYNI      -YIRTTLGHISFYREIEEAIQGFSQAYS--YTI---------------------------
RPOC1_ORYSA      -YIRTTLGHISFYREIEEAIQGFSQAYS--YTI---------------------------
RPOC1_ORYSI      -YIRTTLGHISFYREIEEAIQGFSQAYS--YTI---------------------------
RPOC1_ORYSJ      -YIRTTLGHISFYREIEEAIQGFSQAYS--YTI---------------------------
RPOC1_SACHY      -YIRTTLGHISFYREIEEAVQGFSRAYS--YTI---------------------------
RPOC1_SACOF      -YIRTTLGHISFYREIEEAVQGFSRAYS--YTI---------------------------
RPOC1_SORBI      -YIRTTLGHISFYREIEEAIQGFSRAYS--YTI---------------------------
RPOC1_MAIZE      -YIRTTLGHISFYREIEEAIQGFSRAYS--YTI---------------------------
RPOC1_PELHO      -YIRTTVGHLFLDREIEDALKDFRARVV--------------------------------
RPOC1_PINKO      -YIRTTVGRTRFNREMEEAIQGFA-CFEHPKKSLPALRI---------------------
RPOC1_PINTH      -YIRTTVGRTRFNREMEEAIQGFA-CSEHPNKSLPALRI---------------------
RPOC1_CYCTA      -YIRTTVGRIRFDREIEEAIQGFSRASEHPNKSLPAIII---------------------
RPOC1_WELMI      -YIRTTVGRILFNREIEKAFLSFSKLLESPQTNPVF------------------------
RPOC1_GNEPA      -YIRTTVGRIIFNREIENAFLAFSKLSESPRAMPVFLNKSDTMFLMILNSCSAKQNCGKP
RPOC1_CRYJA      -YIRTTVGRIRFNREIEEAIKGLWTY-DIRQEMLLFRI----------------------
RPOC1_HUPLU      -YICTTAGRTIFDQQIEAALQGFSKITPF-------------------------------
RPOC1_CHAGL      -YLFTTPGRIIFNQLLEQSIQATVRI----------------------------------
RPOC1_STAPU      -YILTTAGRVLFNQQIQQSIQEHFSSLRK-------------------------------
RPOC1_ZYGCR      -YIRTTAGRAVLNQQIEQAIQGTEHAYKAVKQLNIILN----------------------
RPOC1_CHAVU      -YAYTTVGRVIFNQQFRSALQKRIDY----------------------------------
RPOC1_OEDCA      -VVRTTPGRILFNLMLNNCFN---------------------------------------
RPOC1_OLTVI      -FIRTTPGRILLNQTISQTLFTKQV-----------------------------------
RPOC1_TUPAK      -YIRTTPGRVLMNKLIFEALNKPSLKKSF-------------------------------
RPOC1_TETOB      -IIRTTPGRILMNFMIQQCSMS--------------------------------------
RPOC1_BIGNA      -YIKTTVGRVIFNSLLY-------------------------------------------
                                                                             

RPOC1_MESVI      -------------------------------------------
RPOC1_CHLAT      -------------------------------------------
RPOC1_CYAP4      -------------------------------------------
RPOC1_ACAM1      -------------------------------------------
RPOC1_THEEB      -------------------------------------------
RPOC1_TRIV2      -------------------------------------------
RPOC1_NOSS1      -------------------------------------------
RPOC1_NOSP7      -------------------------------------------
RPOC1_NOSCO      -------------------------------------------
RPOC1_SYNE7      -------------------------------------------
RPOC1_SYNP6      -------------------------------------------
RPOC1_RIPO1      -------------------------------------------
RPOC1_CROS5      -------------------------------------------
RPOC1_MICAN      -------------------------------------------
RPOC1_SYNY3      -------------------------------------------
RPOC1_GLOC7      -------------------------------------------
RPOC1_SYNP2      -------------------------------------------
RPOC1_TRIEI      -------------------------------------------
RPOC1_SYNJA      -------------------------------------------
RPOC1_SYNJB      -------------------------------------------
RPOC1_GLOVI      -------------------------------------------
RPOC1_PROMT      -------------------------------------------
RPOC1_PROM1      -------------------------------------------
RPOC1_SYNS3      -------------------------------------------
RPOC1_SYNPW      -------------------------------------------
RPOC1_SYNPX      -------------------------------------------
RPOC1_SYNS9      -------------------------------------------
RPOC1_SYNSC      -------------------------------------------
RPOC1_PROMM      -------------------------------------------
RPOC1_PROM3      -------------------------------------------
RPOC1_PROMA      -------------------------------------------
RPOC1_PROM4      -------------------------------------------
RPOC1_SYNR3      -------------------------------------------
RPOC1_PROM0      -------------------------------------------
RPOC1_PROM2      -------------------------------------------
RPOC1_PROMS      -------------------------------------------
RPOC1_PROM9      -------------------------------------------
RPOC1_PROM5      -------------------------------------------
RPOC1_PROMP      -------------------------------------------
RPOC1_PAUCH      -------------------------------------------
RPOC1_PYRYE      -------------------------------------------
RPOC1_PORPU      -------------------------------------------
RPOC1_GRATL      -------------------------------------------
RPOC1_GUITH      -------------------------------------------
RPOC1_RHDSA      -------------------------------------------
RPOC1_CYAPA      -------------------------------------------
RPOC1_EMIHU      -------------------------------------------
RPOC1_CYACA      -------------------------------------------
RPOC1_THAPS      -------------------------------------------
RPOC1_PHATC      -------------------------------------------
RPOC1_TRICV      -------------------------------------------
RPOC1_NEPOL      RPAMLGLASPGTPSPGRACAYPPRDDYADPNQIKEYLNRIGHW
RPOC1_OSTTA      -------------------------------------------
RPOC1_PHYPA      -------------------------------------------
RPOC1_MARPO      -------------------------------------------
RPOC1_ANTAG      -------------------------------------------
RPOC1_ANEMR      -------------------------------------------
RPOC1_PSINU      -------------------------------------------
RPOC1_ANGEV      -------------------------------------------
RPOC1_ADICA      -------------------------------------------
RPOC1_CUCSA      -------------------------------------------
RPOC1_MORIN      -------------------------------------------
RPOC1_SOLBU      -------------------------------------------
RPOC1_SOLTU      -------------------------------------------
RPOC1_SOLLC      -------------------------------------------
RPOC1_NICSY      -------------------------------------------
RPOC1_TOBAC      -------------------------------------------
RPOC1_ATRBE      -------------------------------------------
RPOC1_NICTO      -------------------------------------------
RPOC1_CUSEX      -------------------------------------------
RPOC1_CUSRE      -------------------------------------------
RPOC1_IPOPU      -------------------------------------------
RPOC1_COFAR      -------------------------------------------
RPOC1_JASNU      -------------------------------------------
RPOC1_SPIOL      -------------------------------------------
RPOC1_SILLA      -------------------------------------------
RPOC1_FAGEA      -------------------------------------------
RPOC1_LEPVR      -------------------------------------------
RPOC1_CAPBU      -------------------------------------------
RPOC1_BARVE      -------------------------------------------
RPOC1_NASOF      -------------------------------------------
RPOC1_ARATH      -------------------------------------------
RPOC1_OLIPU      -------------------------------------------
RPOC1_DRANE      -------------------------------------------
RPOC1_LOBMA      -------------------------------------------
RPOC1_ARAHI      -------------------------------------------
RPOC1_SINAL      -------------------------------------------
RPOC1_CRUWA      -------------------------------------------
RPOC1_AETCO      -------------------------------------------
RPOC1_AETGR      -------------------------------------------
RPOC1_CARPA      -------------------------------------------
RPOC1_GOSHI      -------------------------------------------
RPOC1_GOSBA      -------------------------------------------
RPOC1_POPTR      -------------------------------------------
RPOC1_POPAL      -------------------------------------------
RPOC1_MANES      -------------------------------------------
RPOC1_CITSI      -------------------------------------------
RPOC1_VITVI      -------------------------------------------
RPOC1_PHAAO      -------------------------------------------
RPOC1_DIOEL      -------------------------------------------
RPOC1_LEMMI      -------------------------------------------
RPOC1_ACOAM      -------------------------------------------
RPOC1_ACOCL      -------------------------------------------
RPOC1_ACOGR      -------------------------------------------
RPOC1_NYMAL      -------------------------------------------
RPOC1_NUPAD      -------------------------------------------
RPOC1_AMBTC      -------------------------------------------
RPOC1_ILLOL      -------------------------------------------
RPOC1_CHLSC      -------------------------------------------
RPOC1_CALFG      -------------------------------------------
RPOC1_LIRTU      -------------------------------------------
RPOC1_DRIGR      -------------------------------------------
RPOC1_CERDE      -------------------------------------------
RPOC1_PIPCE      -------------------------------------------
RPOC1_NANDO      -------------------------------------------
RPOC1_RANMC      -------------------------------------------
RPOC1_PLAOC      -------------------------------------------
RPOC1_BUXMI      -------------------------------------------
RPOC1_OENAR      -------------------------------------------
RPOC1_OENBI      -------------------------------------------
RPOC1_OENPA      -------------------------------------------
RPOC1_OENEH      -------------------------------------------
RPOC1_OENGL      -------------------------------------------
RPOC1_EUCGG      -------------------------------------------
RPOC1_PANGI      -------------------------------------------
RPOC1_DAUCA      -------------------------------------------
RPOC1_SOYBN      -------------------------------------------
RPOC1_PHAVU      -------------------------------------------
RPOC1_LOTJA      -------------------------------------------
RPOC1_HELAN      -------------------------------------------
RPOC1_GUIAB      -------------------------------------------
RPOC1_LACSA      -------------------------------------------
RPOC1_AGRST      -------------------------------------------
RPOC1_BRADI      -------------------------------------------
RPOC1_WHEAT      -------------------------------------------
RPOC1_HORVU      -------------------------------------------
RPOC1_LOLPR      -------------------------------------------
RPOC1_ORYNI      -------------------------------------------
RPOC1_ORYSA      -------------------------------------------
RPOC1_ORYSI      -------------------------------------------
RPOC1_ORYSJ      -------------------------------------------
RPOC1_SACHY      -------------------------------------------
RPOC1_SACOF      -------------------------------------------
RPOC1_SORBI      -------------------------------------------
RPOC1_MAIZE      -------------------------------------------
RPOC1_PELHO      -------------------------------------------
RPOC1_PINKO      -------------------------------------------
RPOC1_PINTH      -------------------------------------------
RPOC1_CYCTA      -------------------------------------------
RPOC1_WELMI      -------------------------------------------
RPOC1_GNEPA      AKRGLKYFVNSAEKILEVSLYETKKTSPFLQ------------
RPOC1_CRYJA      -------------------------------------------
RPOC1_HUPLU      -------------------------------------------
RPOC1_CHAGL      -------------------------------------------
RPOC1_STAPU      -------------------------------------------
RPOC1_ZYGCR      -------------------------------------------
RPOC1_CHAVU      -------------------------------------------
RPOC1_OEDCA      -------------------------------------------
RPOC1_OLTVI      -------------------------------------------
RPOC1_TUPAK      -------------------------------------------
RPOC1_TETOB      -------------------------------------------
RPOC1_BIGNA      -------------------------------------------