CLUSTAL format seed alignment for MF_01324

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RPOC2_STAPU      ---------------------------------------------------MARLTAEFG
RPOC2_ZYGCR      -------------------------------------------------------MAELK
RPOC2_CHAVU      -------------------------------------------------------MRQFK
RPOC2_ANEMR      ------------------------------------------------------MAE-PV
RPOC2_MARPO      ------------------------------------------------------MAE-PV
RPOC2_PHYPA      ------------------------------------------------------------
RPOC2_ANTAG      ------------------------------------------------------MAE-SA
RPOC2_ANGEV      ------------------------------------------------------MAD-QA
RPOC2_PSINU      -----------------------------------------------------MMVD-QI
RPOC2_PINKO      ------------------------------------------MKIWRFLLMKKQTRLPFD
RPOC2_PINTH      ------------------------------------------MKIWRFFLMKERTRLPFD
RPOC2_CYCTA      --------------------------------------------MRRFFPMAERAK----
RPOC2_CRYJA      ---------------------------------------------MTQNPVKFVHPFPFE
RPOC2_AGRST      ------------------------------------------------------MAE-RA
RPOC2_LOLPR      ------------------------------------------------------MAE-RA
RPOC2_HORVU      ------------------------------------------------------MAE-RA
RPOC2_WHEAT      ------------------------------------------------------MAE-RA
RPOC2_SACHY      ------------------------------------------------------MAE-RA
RPOC2_SACOF      ------------------------------------------------------MAE-RA
RPOC2_SORBI      ------------------------------------------------------MAE-RA
RPOC2_MAIZE      ------------------------------------------------------MAE-RA
RPOC2_ORYNI      ------------------------------------------------------MAE-RA
RPOC2_ORYSI      ------------------------------------------------------MAE-RA
RPOC2_ORYSA      ------------------------------------------------------MAE-RA
RPOC2_ORYSJ      ------------------------------------------------------MAE-RA
RPOC2_DIOEL      --------------------------------------------------MGVFMTE-RA
RPOC2_PHAAO      --------------------------------------------------MEVLMAE-RT
RPOC2_LEMMI      ------------------------------------------------------MAE-RA
RPOC2_ACOCL      --------------------------------------------------MEVLMAE-RA
RPOC2_AMBTC      --------------------------------------------------MEVLMAE-RA
RPOC2_NYMAL      --------------------------------------------------MEVLMAE-RA
RPOC2_ILLOL      --------------------------------------------------MEVLMAE-RA
RPOC2_CALFG      --------------------------------------------------MEVLMAE-RA
RPOC2_LIRTU      --------------------------------------------------MEVLMAE-RA
RPOC2_DRIGR      --------------------------------------------------MEVLMAE-RA
RPOC2_CHLSC      ------------------------------------------------------MAE-RA
RPOC2_CERDE      --------------------------------------------------MEVLMAE-RA
RPOC2_PIPCE      --------------------------------------------------MEVLMAEQRA
RPOC2_BUXMI      --------------------------------------------------MEVLMAE-RA
RPOC2_PLAOC      --------------------------------------------------MEVLMAE-RA
RPOC2_NANDO      ------------------------------------------------------MAE-RA
RPOC2_RANMC      ------------------------------------------------------MAE-RA
RPOC2_SOLBU      --------------------------------------------------MEVLMAE-RA
RPOC2_SOLTU      --------------------------------------------------MEVLMAE-RA
RPOC2_SOLLC      --------------------------------------------------MEVLMAE-RA
RPOC2_ATRBE      --------------------------------------------------MEVLMAE-RA
RPOC2_NICSY      --------------------------------------------------MEVLMAE-RA
RPOC2_TOBAC      --------------------------------------------------MEVLMAE-RA
RPOC2_NICTO      --------------------------------------------------MEVLMAE-RA
RPOC2_COFAR      --------------------------------------------------MEVLMAE-RA
RPOC2_JASNU      --------------------------------------------------MEVLMAE-RA
RPOC2_CUSEX      --------------------------------------------------MEVLMAE-RI
RPOC2_CUSRE      ------------------------------------------------------MAE-RI
RPOC2_IPOPU      --------------------------------------------------MEVLMAE-RA
RPOC2_DAUCA      --------------------------------------------------MEVLMAE-RA
RPOC2_PANGI      --------------------------------------------------MEVLMAE-RA
RPOC2_GUIAB      --------------------------------------------------MEVLMAE-RP
RPOC2_HELAN      --------------------------------------------------MEVLMAE-RP
RPOC2_LACSA      --------------------------------------------------MEVLMAE-RP
RPOC2_SILLA      ------------------------------------------------------MAE-RA
RPOC2_SPIOL      --------------------------------------------------MEVLMAE-RA
RPOC2_FAGEA      --------------------------------------------------MEVLMAK-GA
RPOC2_SOYBN      ------------------------------------------------------MAE-RA
RPOC2_PHAVU      ------------------------------------------------------MAE-RT
RPOC2_LOTJA      ------------------------------------------------------MAE-RA
RPOC2_PELHO      -----------------------------------------------------MKEW-PP
RPOC2_OENAR      ------------------------------------------------------MDE-GV
RPOC2_OENPA      ------------------------------------------------------MDE-GV
RPOC2_OENEH      ------------------------------------------------------MDE-GV
RPOC2_OENGL      ------------------------------------------------------MDE-GV
RPOC2_OENBI      ------------------------------------------------------MDE-GV
RPOC2_EUCGG      --------------------------------------------------MEVLMAE-RV
RPOC2_AETCO      ------------------------------------------------------MAE-RA
RPOC2_AETGR      ------------------------------------------------------MGE-RA
RPOC2_ARATH      ------------------------------------------------------MAE-RA
RPOC2_CAPBU      ------------------------------------------------------MAE-RA
RPOC2_CRUWA      ------------------------------------------------------MAE-RA
RPOC2_OLIPU      ------------------------------------------------------MAE-RA
RPOC2_BARVE      ------------------------------------------------------MAE-RA
RPOC2_NASOF      ------------------------------------------------------MAE-RA
RPOC2_LEPVR      ------------------------------------------------------MAE-RA
RPOC2_LOBMA      ------------------------------------------------------MAE-RA
RPOC2_ARAHI      ------------------------------------------------------MAE-RA
RPOC2_DRANE      ------------------------------------------------------MAE-RA
RPOC2_SINAL      --------------------------------------------------MEVLMAE-RA
RPOC2_CARPA      ------------------------------------------------------MAE-RA
RPOC2_GOSBA      ------------------------------------------------------MAE-RA
RPOC2_GOSHI      ------------------------------------------------------MAE-RA
RPOC2_CITSI      ------------------------------------------------------MAE-RV
RPOC2_CUCSA      --------------------------------------------------MEVLMAE-RA
RPOC2_MORIN      --------------------------------------------------MEVLMAE-RA
RPOC2_POPAL      ------------------------------------------------------MAE-RA
RPOC2_POPTR      ------------------------------------------------------MAE-RA
RPOC2_MANES      --------------------------------------------------MEVLMAE-RA
RPOC2_VITVI      --------------------------------------------------MGVLMTE-RA
RPOC2_WELMI      -------------------------------------------------------MKLKK
RPOC2_ADICA      ------------------------------------------------------MMD-RN
RPOC2_CHAGL      ------------------------------------------------------MSK-KT
RPOC2_ACAM1      -----------------------------------------------MAENSTHSPREAT
RPOC2_THEEB      -----------------------------------------------MTEKK--------
RPOC2_NOSS1      -----------------------------------------------MTNEKM-------
RPOC2_TRIV2      -----------------------------------------------MTNEKM-------
RPOC2_NOSP7      -----------------------------------------------MTNEKM-------
RPOC2_SYNE7      -----------------------------------------------MAEAKS-------
RPOC2_SYNP6      -----------------------------------------------MAETKS-------
RPOC2_TRIEI      ------------------------------------------------------------
RPOC2_CROS5      ------------------------------------------------------------
RPOC2_SYNY3      ------------------------------------------------------------
RPOC2_MICAN      ------------------------------------------------------------
RPOC2_SYNP2      -------------------------------------------------------MTKEK
RPOC2_SYNJB      ----------------------------------MSEKGRFSAGLSRQAADGNKADAPLP
RPOC2_SYNJA      ----------------------------------MSEKGRFSAGLVRQAADGAKAKTPPP
RPOC2_GLOVI      ----------------------------------MTQE---------------------P
RPOC2_PROMA      -----------------MTSTSPKS-----RKS--SSK-RKGSKKKAARSKNVIPPLSKT
RPOC2_PROM4      -----------------MTSTSPKS-----RRS--SGKGRKGSKKKGKQ-VSQIPPLSKT
RPOC2_PROM1      -----------------MTSSSPKT-----RKSSTKSKAKRGSKSKKAAEIKAVQRLSKT
RPOC2_PROMT      -----------------MTSSSPKT-----RKSSTKSKAKRGSKSKKAAEIIAVQRLSKT
RPOC2_PROM3      -----------------MTSTSPKSRKPSTKTTKSKSKSKSKSKAAKAAAASASPALART
RPOC2_PROMM      -----------------MTSTSPKSRKPSTKTTKSKSKSKSKSKAAKAAAAGASPALART
RPOC2_SYNS3      -----------------MTSTPSKS--------RKSAKAAKAAKAEAAAF-AKSRALSKT
RPOC2_SYNPW      -----------------MTSTPSKS--------RKSSKGSKAAKAAASA--PETRPLAKT
RPOC2_SYNSC      ------------------MTSSSKS--------RKS-KSSKASKAAKEAPVSASRPLSKT
RPOC2_SYNPX      -----------------MTSSSSKS--------NKSRKSSKAAKDTTPVHESASRPLSKT
RPOC2_SYNS9      -----------------MTTSKPRK--------PSKAKAAKAAKAAKAALEKISKPLSKT
RPOC2_PROMS      -----------------MTSSKPKK----------TSRVRKTTKNSKKNNPVTMPALAKT
RPOC2_PROM0      -----------------MTSSKPKK----------TSRVRKTTKNSKKNNPLTMPALAKT
RPOC2_PROM2      -----------------MTSSKPKK----------TSRVRKTTKNSKKNNPVTMPVLPKT
RPOC2_PROM9      -----------------MTSSKPKK----------TSRVRKTTKNSKKNIPLTMPPLAKT
RPOC2_PROM5      -----------------MTSSKPKK----------SSRVRKTSKNSKKNNKIIMPTLAKT
RPOC2_PROMP      -----------------MTSSKPKK----------SSRVRKTTKNSKKNHNTMMPLLPKT
RPOC2_SYNR3      -----------------MTSSSKPA--------RKTSKSKSKASKAAEAPAAPSNELSRE
RPOC2_PAUCH      -----------------MTPSSNSV------KTSRFNKVRTDIIGDTDLPNNLIKSLSKS
RPOC2_GUITH      --------------------------------------------------MKEKYLFVPP
RPOC2_RHDSA      --------------------------------------------------MKEKYLFIPP
RPOC2_PORPU      --------------------------------------------------MNSRKSLS--
RPOC2_PYRYE      --------------------------------------------------MDNRRSLA--
RPOC2_GRATL      --------------------------------------------------MTQDKSI---
RPOC2_CYAPA      ----------------------------------------------------MSENLFSK
RPOC2_CYACA      -------------------------------------------------MVIDKKKVKNR
RPOC2_EMIHU      -----------------------------------------------------MQPDFKK
RPOC2_PHATC      ----------------------------------------------------------MK
RPOC2_THAPS      ----------------------------------------------------------MK
RPOC2_TRICV      ----------------------------------------------------------MK
RPOC2_CHLVU      MVKKKKFKTKNIQNPPFSSQNSSHLFFSLKKKEEKESTPEVFVIDDHFNTFKTPKALKFR
RPOC2_OSTTA      -----------------------------------------------------------M
RPOC2_BIGNA      -----------------------------------------------------------M
RPOC2_CHLAT      -----------------------------------------------------------M
RPOC2_MESVI      ------------------------------------------MGRMKKIFFNQKSDLNSM
RPOC2_NEPOL      ------------------------------------MNTQEKHQFEPVLPQAHDDPTLSK
                                                                             

RPOC2_STAPU      DRIYYNQVMDRGAMRQLIGRLIIYLGSNCTSQILDQLKTLGFRHATQAGISLGVDDLITT
RPOC2_ZYGCR      NRIFYNQVMDKSAIKQLIIRLVACLGRVCTAHILDQLKTLGFQYSTQTGISLGIDDLLAS
RPOC2_CHAVU      EIPFYNQIVDKGTIKQLIGRLVAHFGSTYTSHILDKLKELGFEYGTKTGISLGIDDLLIT
RPOC2_ANEMR      DLIFYNRVMDRITIKQIMNGLMTHFGITYATHVLDQPKTLGFQQATRGATSLGIDDLLTT
RPOC2_MARPO      NLIFYNKVMDRTAIKQLISRLIAHFGITYTTHILDQLKTLGFQQATFGAISLGIDDLLTA
RPOC2_PHYPA      -MLFYNKVMDRTAIKQLISRLITHFGITYTTYILDQLKTVGFKQATQAAISLGIDDLLTA
RPOC2_ANTAG      KLLFYNKVIDGTAIKQFIGRLVAHFGITYTAHILDQLKTLGFQQATYAATSLGIDDLLTA
RPOC2_ANGEV      KLLFYNKMMDRTAIKHLIRRLISHFGITFTANILDQIKTLGFHQATNASISLGIDDLLTA
RPOC2_PSINU      KLLFYNKMMDRTAIKQLISRLIAQFGITYTTNILDQLKTLGFKQATNASVSLGIDDLLEA
RPOC2_PINKO      NLPFYNKVMDKTAIKKLISRLIDHFGMTYTSHILDQLKTSGFKQATDTAISLGIDDLLTA
RPOC2_PINTH      NLPFYNKVMDKTAIKKLISRLIDHFGMTYTSHILDQLKTSGFQQATDTAISLGIDDLLTA
RPOC2_CYCTA      -LLFHNEAMDKTAMKQLISRLINHFGMTYTSNISDQLKTSGFQRATDAAISLGIDDLLTA
RPOC2_CRYJA      -VPFFNKGMDKFVMKHLIRRFVNQFGMTYTSHILDQLKILGFQQATDAAISLGIDDLLTT
RPOC2_AGRST      NLVFHNKEIDGTGMKRLISRLIDHFGMGYTSHILDQLKTLGFHQATTTSISLGIEDLLTI
RPOC2_LOLPR      NLVFHNKEIDGTGMKRLISRLIDHFGMGYTSHILDQLKTLGFHQATTTSISLGIEDLLTI
RPOC2_HORVU      NLVFHNKEIDGTGMKRLISRLIDHFGMGYTSHILDQLKTLGFYQATTTSISLGIEDLLTI
RPOC2_WHEAT      NLVFHNKEIDGTGMKRLISRLIDHFGMGYTSHILDQLKTLGFHQATTTSISLGIEDLLTI
RPOC2_SACHY      NLVFHNKEIDGTAIKRLISRLIDHFGMGYTSHILDQIKTLGFHQATTTSISLGIEDLLTI
RPOC2_SACOF      NLVFHNKEIDGTAIKRLISRLIDHFGMGYTSHILDQIKTLGFHQATTTSISLGIEDLLTI
RPOC2_SORBI      NLVFHNKEIDGTAMKRLISRLIDHFGMGYTSHILDQIKTLGFHQATTTSISLGIEDLLTI
RPOC2_MAIZE      NLVFHNKEIDGTAMKRLISRLIDHFGMGYTSHILDQIKTLGFHQATTTSISLGIEDLLTI
RPOC2_ORYNI      NLVFQNKEIDGTAMKRLISRLIDHFGMGYTSHILDQIKTLGFHQATTTSISLGIEDLLTI
RPOC2_ORYSI      NLVFQNKEIDGTAMKRLISRLIDHFGMGYTSHILDQIKTLGFHQATTTSISLGIEDLLTI
RPOC2_ORYSA      NLVFQNKEIDGTAMKRLISRLIDHFGMGYTSHILDQIKTLGFHQATTTSISLGIEDLLTI
RPOC2_ORYSJ      NLVFQNKEIDGTAMKRLISRLIDHFGMGYTSHILDQIKTLGFHQATTTSISLGIEDLLTI
RPOC2_DIOEL      DLVFHNKVIDGTAMKRLISRLIDHFGMGYTSHILDQSKILGFQQATATSISLGIDDLLTI
RPOC2_PHAAO      NLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKALGLRRATATSISLGIDDLLTI
RPOC2_LEMMI      DLVFHNKVIDGAAMKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_ACOCL      DLVYHNKAIDGTAMKRLISRLIDHFGMAYTSHILDQVKTLGFRQATATSISLGIDDLLTI
RPOC2_AMBTC      DLVFHNKAIDGTAMKRLISRLIDHFGMAYTSHILDQVKTLGFRQATLTSISLGIDDLLTT
RPOC2_NYMAL      DLVFHNKVIDGTAMKRLISRLIDHFGIAYTSHILDQVKTLGFQQATATSISLGIDDLLTT
RPOC2_ILLOL      NLVFHNKVIDGTAMKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_CALFG      DLVFHNKVIDGAAMKRLISRLIDHFGMAYTSHILDQVKTLGFQQATTTSISLGIDDLLTI
RPOC2_LIRTU      DLVFHNKVIDATAMKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_DRIGR      DLVFHNKVIDGTAMKRLISRLIDHFGMAYTSHILDQVKTMGFQQATATSISLGIDDLLTI
RPOC2_CHLSC      DLVFHNKVIDGTAMKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_CERDE      DLVFHNKAIDGTAMKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_PIPCE      DLVFHNKAIDGTAMKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_BUXMI      DLVFHNKVIDGTAMKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTT
RPOC2_PLAOC      DLVFHNKAIDGTAMKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_NANDO      DLVFHNKAIDGTAMKRLISRLIDHFGMAYTSHILDQIKTLGFQQATATSISLGIDDLLTI
RPOC2_RANMC      DLVFHNKAIDGTAMKRLISRLIDHFGMAYTSHILDQVKTLGFQQATTTSISLGIDDLLTI
RPOC2_SOLBU      NLVFHNKAIDGTAMKRLISRLIEHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_SOLTU      NLVFHNKAIDGTAMKRLISRLIEHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_SOLLC      NLVFHNKAIDGTAMKRLISRLIEHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_ATRBE      NLVFHNKAIDGTAMKRLISRLIEHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_NICSY      NLVFHNKAINGTAMKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_TOBAC      NLVFHNKAINGTAMKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_NICTO      NLVFHNKAIDGTAMKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_COFAR      NLVFHNKSIDGTAMKRLISRLIDHFGMAYTSHILDQVKTLGFKQATATSISLGIDDLLTI
RPOC2_JASNU      NLVFHNKVIDGTAMKRLINRLIEHFGMAYTSHILDQVKALGFHQATTTSISLGIDDLLTI
RPOC2_CUSEX      NLVFHNKVLDRTAMKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_CUSRE      NLVFHNKVLDGTAMKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_IPOPU      NLVFHNKVIDGTAMKRLISRLINHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_DAUCA      NLVFHNKVIDGTAMKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_PANGI      NLVFHNKVIDGTAMKRLISRLIEHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_GUIAB      TQVFHNKVIDGTAMKRLISRFIDHYGIGYTSHILDQVKTLGFRQATAASISLGIDDLLTI
RPOC2_HELAN      TQVFHNKVIDGTAMKRLISRFIDHYGIGYTSHILDQVKTLGFRQATAASISLGIDDLLTI
RPOC2_LACSA      TQVFHNKVIDGTAMKRLISRFIDHYGIGYTSHILDQVKTLGFRQATAASISLGIDDLLTI
RPOC2_SILLA      NLVFHNKSIDGTAMKRLISRLIDHFGMAYTAHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_SPIOL      NLVFHNKAIDGTAMKRLISRLIDHFGMAYTSHILDQLKTLGFQQATATSISLGIDDLLTI
RPOC2_FAGEA      NLVFHNKVIDGIAMKRLISRFIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_SOYBN      NLVFHNKVIGGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFRQATDTSISLGIDDLLTI
RPOC2_PHAVU      NLMFHNKVIGGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFRQATATSISLGIDDLLTI
RPOC2_LOTJA      NLVFHNKVIGGTAIKRIISRLIDHFGMAYTSHILDQVKTLGFRQATTTSISLGIDDLLTI
RPOC2_PELHO      NLAFHNKVIDGAAIKQLISRLIQRFGMLYTSHVLDQVKLLGFKQATASSISLGIDDLLTI
RPOC2_OENAR      NLVFPKKVIDGTAIKRLISRLIDHFGMAHTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_OENPA      NLVFHKKVIDGTAIKRLISRLIDHFGMAHTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_OENEH      NLVFHKKVIDGTAIKRLISRLIDHFGMAHTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_OENGL      NLVFHKKVIDGTAIKRLISRLIDHFGMAHTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_OENBI      NLVFHKKVIDGTAIKRLISRLIDHFGMAHTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_EUCGG      NLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_AETCO      NLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_AETGR      NLVFHNKIIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_ARATH      NLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_CAPBU      NLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_CRUWA      NLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_OLIPU      NLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_BARVE      NLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_NASOF      NLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_LEPVR      NLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_LOBMA      NLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_ARAHI      NLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_DRANE      NLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_SINAL      NLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_CARPA      NLVFHNKVIDGTAIKRLISRLIDRFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_GOSBA      NLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKALGFQQATATSISLGIDDLLTI
RPOC2_GOSHI      NLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKALGFQQATATSISLGIDDLLTI
RPOC2_CITSI      SLVFHNKMIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_CUCSA      DLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQLKTLGFQQATATSISLGIDDLLTI
RPOC2_MORIN      DLVFRNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFRQATATSISLGIDDLLTI
RPOC2_POPAL      NLFFHNKVIDGTAIKRIISRFIDHFGMAYTSHILDQVKTLGFHQATATSISLGIDDLLTI
RPOC2_POPTR      NLFFHNKVIDGTAIKRIISRFIDHFGMAYTSHILDQVKTLGFHQATATSISLGIDDLLTI
RPOC2_MANES      NLVFHNKAIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_VITVI      NLVFHNKVIDGTAMKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTI
RPOC2_WELMI      QIRFYNKAMSRTALNELIRRLIDRFGMMCTSHILDQLKTLGFHQATDASFSLGIDDLLAA
RPOC2_ADICA      ELPFCNKTIDRAAMKRLIGKLVVCFGIASTTNILDQVKVLGFQQATEASISLGIDDLSAV
RPOC2_CHAGL      KILYYNQVMDRSGMKNLISRLISYIGVTSASEVLDQLKTIGFNYATKFGISLGIDDLLTT
RPOC2_ACAM1      PPAFCNKIVNKGQLKSLVHWAFTHYGTARTAEMADHLKDLGFRYATKAGVSISVDDLQVP
RPOC2_THEEB      -PIFFNRIIDKKGLRDLIAWSFSNFGTARTAEMADKIKDLGFHYATRAGVSISVDDLLVP
RPOC2_NOSS1      --IFRNRVVDKGQLRNLISWAFTHYGTARTAVMADKLKDLGFRYATRAGVSISVDDLMVP
RPOC2_TRIV2      --IFRNRVVDKGQLRNLISWAFTHYGTARTAVMADKLKDLGFRYATRAGVSISVDDLMVP
RPOC2_NOSP7      --IFRNRVVDKGQLRNLISWAFTNYGTARTAVMADKLKDLGFRYATKAGVSISVDDLMIP
RPOC2_SYNE7      APIFRNRVIDKKQLKKLIGWTFAHYGTAKTAVVADDLKALGFRYATRAGVSISIDDLKVP
RPOC2_SYNP6      APIFRNRVIDKKQLKKLIGWTFAHYGTAKTAVVADDLKALGFRYATRAGVSISIDDLKVP
RPOC2_TRIEI      -MIFYNRVINKGQLKKLISWSFNNYGTAITAQMANKLKDLGFRYATKAGVSISVDDLQVP
RPOC2_CROS5      -MTFYNQIVDKGRLKKLISWAYRNYGAARSSQVADNLKDLGFRYATKAGVSISIDDLTVP
RPOC2_SYNY3      -MTFYNYTIDKGRLKKLIALAYRRYGSARCSQLADELKELGFRFATKAGVSISVDDLTIP
RPOC2_MICAN      --MFYNQTVDKGKLKKLIAWAYQNYGSARCSQMADELKNLGFRFATKAGVSISVDDLTVP
RPOC2_SYNP2      PAVFYNRIIDKGRLKKLMSWAYTSFGSAHCATMADELKTLGFRYATQAGVSISVDDLQVP
RPOC2_SYNJB      PVPFRNYQIGKKELRNLIAWSFARYGTARTAQMADALKTLGFKYATQAAVSISVEDLRVP
RPOC2_SYNJA      PVPFRNYQIGKKELRNLIAWSFARYGTARTAQMADALKALGFKYATQAAVSISIEDLRIP
RPOC2_GLOVI      QPKFINRKIDKKGLGKLISWAFSHYGTARTALLADNLKNLGFRFATRGAVSISVEDLQVP
RPOC2_PROMA      PPSFRNCVVDKKSLKQLVAWAFKNHGTAVTAAMADNLKDLGFKYATQAAVSISVDDLKVP
RPOC2_PROM4      PPSFRNRIVDKKALKQLVAWAYKNHGTAVTAAMADNLKDLGFKYATQAAVSISVDDLKVP
RPOC2_PROM1      PPPFRNKVVDKKVLKNLVAWAFKHHGTAATAAMADNLKDLGFRYATQAAVSISVDDLKVP
RPOC2_PROMT      PPPFRNKVVDKKVLKNLVAWAFKHHGTAATAAMADNLKDLGFRYATQAAVSISVDDLKVP
RPOC2_PROM3      PPQFRNRVVDKKALKQLVAWAYKTHGTAVTASMADNLKDLGFRYATQAAVSISVEDLKVP
RPOC2_PROMM      PPQFRNRVIDKKALKQLVAWAYKTHGTAVTASMADNLKDLGFRYATQAAVSISVEDLKVP
RPOC2_SYNS3      PPPFRNRVVDKKVLKELVAWAFKNHGTAATASMADQLKDLGFKYATQAAVSISVNDLKVP
RPOC2_SYNPW      PPPFRNRVVDKKGLKQLVAWAYKHHGTAATSAMADQLKDLGFRYATQAAVSISVNDLKVP
RPOC2_SYNSC      PPPFRNQVIDKRALKQLVAWSYKNHGTAVTSSMADNLKDLGFKYATQAAVSISVDDLKVP
RPOC2_SYNPX      PPPFRNHIVDKRGLKQLVAWAYKNHGTAVTSSMADKLKDLGFRYATQAAVSISVNDLQVP
RPOC2_SYNS9      PPPFRNHIIDKKALKNLVAWSFKHHGTAVTSSMADDLKDLGFKYATQAAVSISVDDLKVP
RPOC2_PROMS      PPSFKNKVVDKKALKNLVSWAYKTHGTAITAAMADNLKDLGFKYATQAAVSISVDDLKVP
RPOC2_PROM0      PPSFKNKVVDKKALKNLVSWAYKTHGTAVTAAMADNLKDLGFKYATQAAVSISVDDLKVP
RPOC2_PROM2      PPSFKNKVVDKKALKNLVSWAYKTHGTAITSAMADNLKDLGFKYATQAAVSISVDDLKVP
RPOC2_PROM9      PPSFKNKVVDKKALKNLVSWAYKTHGTAITAAMADNLKDLGFKYATQAAVSISVDDLKVP
RPOC2_PROM5      PPSFKNKVVDKKALKNLVSWAYKTHGTAVTAAMADNLKDLGFKYATQAAVSISVEDLKVP
RPOC2_PROMP      PPSFKNKVVDKKALKNLVSWAYKTHGTAVTAAMADNLKDLGFKYATQAAVSISVNDLKVP
RPOC2_SYNR3      APTFQNKVIDKKALRSLVAWSYKHHGTAATSALADDLKDLGFRFATQAAVSISVDDLRVP
RPOC2_PAUCH      PPHFYNHIIDKKGLRDIIAWAYKSHGIAATAELADDIKDLGFKYATVAAVSISIDDLKIP
RPOC2_GUITH      KPKFTNKVIDKKELKKLMAWAFSNYGTGRASFMADKIKDLGFHYATKAGLSLSVEDLRVP
RPOC2_RHDSA      KPKFTNKTIDKKELKKLMAWAFSNYGTGRASYLADKIKDLGFQYATKAGLSLSVEDLRVP
RPOC2_PORPU      QPSFSNKVIDKNQLKNLIVWAFRNYGIARAANMADKLKDLGFHYATQAGISLSLEDLRIP
RPOC2_PYRYE      QPSFSNKVIDTNELKNLIVWAFRNYGIARAANMADKLKDLGFHYATQAGISLSLEDLRIP
RPOC2_GRATL      EPFFLNKVVDKSQLRQLIIWAFRNYGIARASNMADTLKDLGFLYATKAGISLSLEDLRIP
RPOC2_CYAPA      KKIFFNQTIGKKEVKNVIAWAFTSYGAARTAYLVEQLKDLGFHYATKAGISLSVEDLLIP
RPOC2_CYACA      TPYFLNRIIEKSELREIIEVVFHKNGIAKASLIADNLKEIGFGFATKAGISISIEDLKIP
RPOC2_EMIHU      IHSFENNLINKRSLKDLMYQAFLNYGIVKSSIIADRVKNLTFHFATQSGVSLSVEDLRVP
RPOC2_PHATC      NYKYQNTLIGKKQLRQLLAWSFTNYDSMQACALADELKYLGFKYASQAGISISIEDLKIP
RPOC2_THAPS      DYIYQNTLINKKQLKELLAWSFSKYDSMQASLLADELKYLGFKYATQAGISISIEDLKVP
RPOC2_TRICV      TYTYQNTLISKKQLKQLLSWSFTTYDSMQACSLADELKYLGFKYASKAGISISIEDLKVP
RPOC2_CHLVU      TPIFFNVSFDKNTLKTVIAWFLDQYGGKATVDLVETLKQVGFHQATRAGVSLGLEDLQIP
RPOC2_OSTTA      KTFFCNRTVDKGEMKRLIKWVLLNYGTEKTTRLIDKLKTMGFHYATHAGISLGIDDLSIP
RPOC2_BIGNA      EKIFFNYPFNKGKLKTLLIWSILNTGQYNMINLVENLKKVGFQYATTAGISLGIDDLKTI
RPOC2_CHLAT      NLFFCNRTIEKGEIRRFIAWFIFHHGTARTTQMVERLKVLGFRHATKAGVSLSVDDLKIP
RPOC2_MESVI      KLFFCNRIMNKGEIRRIIAWFLFNHGTSRTAHMVDRLKILGFYHATKAGISLSIDDLSIP
RPOC2_NEPOL      PPIFFNRTADKGMIKRLIAWFLVHYGLADTVSMIEDLKQVGFQYATRAGISLGIEDLRIP
                    : :       :  .:       .      : :  *   :  .:  . *:.::**   

RPOC2_STAPU      PSKTWLIRDAEYQAYTSEEQYRRGSIHAVEKLRHVVETWHTTSEYLKREMTSHFRITDPL
RPOC2_ZYGCR      PLKNWILQDAENEANVSQEYCRHGYIHAVERLRQIVETWHTTSEFLKREMTVSFNILDGF
RPOC2_CHAVU      PSKKWLIQDAEQQAQASDSHYNSGNLHAVEKLRQLIETWHTTSEYLKQEMNPNFRITDPF
RPOC2_ANEMR      PSKGWLIKDAEHHGNLSGKHYNYGNLYAVEKLRQLIETWYTTSEYLKRGMNLNFGITDPS
RPOC2_MARPO      PSKSWLIEDAEQYGNLSEKHHNYGSLHAVEKLRQLIETWYATSEYLKQEMNPNFRITDPL
RPOC2_PHYPA      PSKSWLIQDAEQQGYISEKHYRYGNVHAVEKLRQLIETWYATSEYLKQEMNPNFRMTDPL
RPOC2_ANTAG      PSKGWLIQDAEHHSYTLEKHHRYGNVHAVEKLRQLIETWYATSEYLKQEMNPNFRMTDPL
RPOC2_ANGEV      PLKSWLIQDAEKQGYSSEQHHRYGSVHSVEKLRQLIETWYATSEYLKQEMNPNFRMTDPL
RPOC2_PSINU      PSKAWLIQDAERQGSIFEQHHRFGSVHAVEKLRQLIETWYATSEYLKREMIPNFRIIDPL
RPOC2_PINKO      PSKGWLVQDAEQQGSVSEKQNHYGNLHAVEKLRQSIEIWYATSEYLRKEMNTNFSMTDPL
RPOC2_PINTH      PSKGWLVQDAEQQGSVSEKQNHYGNVHAVEKLRQSIEIWYATSEYLRKEMNPNFSMTDPL
RPOC2_CYCTA      PSKGWLVQDAEQQGSISEKHHHYGNVHAVEKLRQSIETWYATSEYLRQEMNPNFRMTDPF
RPOC2_CRYJA      PSKAWLIQDAQQRGFASERHHDYGNVHAVEKLRQLIEVWHATSEYLRREMNPNFRMTDPL
RPOC2_AGRST      PSKGWLVQDAEQQSFLLEKHYYYGAIHAVEKLRQSVEIWYATSEYLKQEMNSNFRITDPS
RPOC2_LOLPR      PSKGWLVQDAEQQSFLLEKHYYYGAIHAVEKLRQSVEIWYATSEYLKQEMNSNFRITDPS
RPOC2_HORVU      PSKGWLVQDAEQQSFLLEKHYYYGAVHAVEKLRQSVEIWYATSEYLKQEMNSNFRITDPS
RPOC2_WHEAT      PSKGWLVQDAEQQSFLLEKHYYYGAVHAVEKLRQSVEIWYATSEYLKQEMNSNFRITDPS
RPOC2_SACHY      PSKGWLVQDAEQQSFLLEKHYYYGAVHAVEKLRQSVEIWYATSEYLKQEMNSNFRITDPS
RPOC2_SACOF      PSKGWLVQDAEQQSFLLEKHYYYGAVHAVEKLRQSVEIWYATSEYLKQEMNSNFRITDPS
RPOC2_SORBI      PSKGWLVQDAEQQSFLLEKHYYYGAVHAVEKLRQSVEIWYATSEYLKQEMNSNFRITDPS
RPOC2_MAIZE      PSKGWLVQDAEQQSFLLEKHYYYGAIHAVEKLRQSVEIWYATSEYLKQEMNSNFRITDPS
RPOC2_ORYNI      PSKGWLVQDAEQQSFLLEKHYYYGAVHAVEKLRQSVEIWYATSEYLKHEMNSNFRITDPS
RPOC2_ORYSI      PSKGWLVQDAEQQSFLLEKHYYYGAVHAVEKLRQSVEIWYATSEYLKHEMNSNFRITDPS
RPOC2_ORYSA      PSKGWLVQDAEQQSFLLEKHYYYGAVHAVEKLRQSVEIWYATSEYLKHEMNSNFRITDPS
RPOC2_ORYSJ      PSKGWLVQDAEQQSFLLEKHYYYGAVHAVEKLRQSVEIWYATSEYLKHEMNSNFRITDPS
RPOC2_DIOEL      PSKEWLVQDTEQQRFILEKHYHYANVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPS
RPOC2_PHAAO      PSKRWLVQDAEQQSFLLEKNHHYGNVHVVEKLRQSIEVWYATSEYLRQEMNPNFQMTDPS
RPOC2_LEMMI      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPS
RPOC2_ACOCL      PSKGWLVQDAEQQSFILEKHHSYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPS
RPOC2_AMBTC      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_NYMAL      PSKRWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNLNFKMTDPS
RPOC2_ILLOL      SSKGWLVQDAEQQSLLLEKHHRYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPS
RPOC2_CALFG      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMHPNFRMTDPS
RPOC2_LIRTU      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMHPNFRMTDPS
RPOC2_DRIGR      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMHPNFRMTDPS
RPOC2_CHLSC      PSKGWLVQDAEQQSLILEKYHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPS
RPOC2_CERDE      PSKGWLVQDAEQQSLTLEKNHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPS
RPOC2_PIPCE      PSKGWLVRDAEQQGLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMHTNFRMTDPS
RPOC2_BUXMI      PSKRWLVQDAEQQSFILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNTNFRMTDPS
RPOC2_PLAOC      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTNPS
RPOC2_NANDO      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPS
RPOC2_RANMC      PSKGWLVQDAEQQSLILEKHHNYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPS
RPOC2_SOLBU      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_SOLTU      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_SOLLC      PSKGWLVQDAEQQSLILEKHHQYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_ATRBE      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_NICSY      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_TOBAC      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_NICTO      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_COFAR      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_JASNU      PSKRWLVQDAEQQSLVLEKHHHYGNVHAVEKLRQSVEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_CUSEX      PSKGWLVQDAEQQSFIFEKYHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNLNFRMTDPL
RPOC2_CUSRE      PSKGWLVQDAEQQSFVFEKYQHSGNVHAVEKLRQSIEIWYATSEYLRQEMHLNFRMTDPL
RPOC2_IPOPU      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPL
RPOC2_DAUCA      PSKRWLVQDAEEQSFILEKHHHSGNVHAVEKLRQSIEIWYATSEFLRQEMNPNFRMTDPF
RPOC2_PANGI      PSKRWLVQDAEQQSLILEKQHHYGNVHAVEKLRQSIEIWYATSEFLRQEMKPNFRMTDPF
RPOC2_GUIAB      PSKRWLVQDAEQQSFILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMTPNFRMTDPF
RPOC2_HELAN      PSKRWLVQDAEQQSVLLEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMTPNFRMTDPF
RPOC2_LACSA      PSKRWLVQDAEQQSFILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_SILLA      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYSTSEYLRQEMNPNFRMTDPY
RPOC2_SPIOL      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYSTSEYLRQEMNPNFRMTDPY
RPOC2_FAGEA      PSKGWLVQDAEQQSFILEKQHHYGNIHAVEKLRQSIEIWYATSEHLRQEMNPNFRMTDPY
RPOC2_SOYBN      PSKGWLVQDAEQQSLILEQHHHYGNVHAVEKLRQSIEIWYATSEYFRQEMNPNFRMTDPF
RPOC2_PHAVU      PSKGWLVRDAEHQNLILEKQHHYGNVHAVEKLRQSIEIWYATSEYFRQEMNPNFRMTDPF
RPOC2_LOTJA      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFSMTDPF
RPOC2_PELHO      PSKRWLVQDAQQQSFLLEKYYQYGNVHAVEKLRQSIEIWDAISAYLRQEMTPNFGMTDPL
RPOC2_OENAR      PSKGWLVQDAEQQSLSLEKHHHYGNVHAVEKLRQSIEVWYATSEYLRQEMNPNFRMTDPF
RPOC2_OENPA      PSKGWLVQDAEQQSLSLEKHHHYGNVHAVEKLRQSIEVWYATSEYLRQEMNPNFRMTDPF
RPOC2_OENEH      PSKGWLVQDAEQQSLSLEKHHHYGNVHAVEKLRQSIEVWYATSEYLRQEMNPNFRMTDPF
RPOC2_OENGL      PSKGWLVQDAEQQSLSLEKHHHYGNVHAVEKLRQSIEVWYATSEYLRQEMNPNFRMTDPF
RPOC2_OENBI      PSKGWLVQDAEQQSLSLEKHHHYGNVHAVEKLRQSIEVWYATSEYLRQEMNPNFRMTDPF
RPOC2_EUCGG      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEVWYATSEYLRQEMNPNFRMTDPF
RPOC2_AETCO      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_AETGR      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_ARATH      PSKGWLVQDAEQQSWILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_CAPBU      PSKGWLVQDAEQQSWILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_CRUWA      PSKGWLVQDAEQQSWILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_OLIPU      PSKGWLVQDAEQQSWILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_BARVE      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPL
RPOC2_NASOF      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_LEPVR      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_LOBMA      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNLNFRMTDPF
RPOC2_ARAHI      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_DRANE      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_SINAL      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_CARPA      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRVTDPF
RPOC2_GOSBA      PSKGWLVQDAEQQSLILEKHHHFGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_GOSHI      PSKGWLVQDAEQQSLILEKHHHFGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_CITSI      PSKRWLVQDAEQQSFILEKHYHYGNVHAIEKLRQSIEIWYATSEYLRQEMNPNFRMTEPF
RPOC2_CUCSA      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_MORIN      PSKGWLVQDAEQQRLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPF
RPOC2_POPAL      PSKGWLVQDAEQQSLILEKHHHYGNVHAIEKLRQSIEIWYATSEYLRQEMNPNFRMTEPF
RPOC2_POPTR      PSKGWLVQDAEQQSLILEKHHHYGNVHAIEKLRQSIEIWYATSEYLRQEMNPNFRMTEPF
RPOC2_MANES      PSKGWLVQDAEQQSLILEKHYHYGNVHAVEKLRQSIEIWYATSEYLRQEMNLNFRMTEPF
RPOC2_VITVI      PSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNTNFRMTDPF
RPOC2_WELMI      PSKWWLVKEEDQQGFFSEKQNLSGNLHTVETLRQLMERWHTTSEYLKEEMYPKFQLTNSF
RPOC2_ADICA      PTRGWLVRDAEKQGYVSEGHYRCGSLHAIEKLRQSIEAWYATSECLKREMSPSFKMIDPL
RPOC2_CHAGL      PFKGWFMQDAEKHASISEKHNRYGTIHAVEKLRQLIETWYTTSEYLKQEMSPNFKITDPY
RPOC2_ACAM1      PSKRRLLETAEEEIRVTEDRYTRGEITEVERFQKVIDTWNGTSEELKDEVVKNFKSNNPL
RPOC2_THEEB      PKKQELLEAAEKEIKTAQERYSRGEITEVERFQKVIDTWNSTNEELKNEVVRHFRNTDVL
RPOC2_NOSS1      PSKRSLLEAAEEEIRATEVRYQRGEITEVERFQKVIDTWNGTSEALKDEVVTHFKQTNPL
RPOC2_TRIV2      PSKRSLLEAAEEEIRATEVRYQRGEITEVERFQKVIDTWNGTSEALKDEVVTHFKQTNPL
RPOC2_NOSP7      PTKRLLLEAAEEEIRATETRYQRGEITEVERFQKVIDTWNGTSEALKDEVVVHFKKTNPL
RPOC2_SYNE7      GSKAELLESAEKRIQETEDRYTRGEITEVERFQKVIDTWANTNDELTDRVVKNFRESDPL
RPOC2_SYNP6      GSKAELLESAEKRIQETEDRYTRGEITEVERFQKVIDTWANTNDELTDRVVKNFRESDPL
RPOC2_TRIEI      PSKRQLLDEAEQEIRNTTERYTKGKITEVERFQKVIDTWNSTSENLKNEVVRNFRSTDPL
RPOC2_CROS5      PTKRGMLDSAEKEINITEARYARGEITEVERFQKVIDTWNSTSEELKDEVVRNFRQTDPL
RPOC2_SYNY3      PEKKQMLEAAEKEIRTTEERYARGEITEVERFQKVIDTWNGTSEELKDQVVVNFRKTDPL
RPOC2_MICAN      PAKRQMIESAEQEIRQTEQRYVRGEITEVERFQKVIDTWNSTSESLKDEVIRNFQVTDPL
RPOC2_SYNP2      PIKRQMLDSAEQEIKTTEARYSRGEITEVERFQKVIDTWNSTSESLKDEVVKNFRETNPL
RPOC2_SYNJB      PSKRQLLAQAEAEIEAATERYTRGEITEVERYQKVIDTWNQINDQIKEEMLNNFRQNDPL
RPOC2_SYNJA      PSKRQLLAQAEAEIEAATERYTRGEITEVERYQKVIDTWNQTNDQIKEEMLSNFRQNDPL
RPOC2_GLOVI      DSKVNILETAEREIQRAEERFTRGEITEVERFQKVIDTWAGATQELTEGVKENFQERNPL
RPOC2_PROMA      EAKQDLLGQAEEQITATEECYRLGEITEVERHTKVIDTWTETNERLVDAVKKNFNHNDPL
RPOC2_PROM4      DAKQDLLGEAEQQITATEECYRLGEITEVERHTKVIDTWTETNERLVDAVKKNFNQNDPL
RPOC2_PROM1      EAKQDLLGQAEELITATEECYRLGEITEVERHTKVIDTWTETNERLVDAVKKNFNQNDPL
RPOC2_PROMT      EAKQDLLGQAEELITATEECYRLGEITEVERHTKVIDTWTETNERLVDAVKKNFNQNDPL
RPOC2_PROM3      EAKQDLLCQAEAQITATEECYRLGEITEVERHTKVIDTWTETNERLVDAVKKNFNQNDPL
RPOC2_PROMM      EAKQDLLGQAEAQITATEECYRLGEITEVERHTKVIDTWTETNERLVDAVKKNFNQNDPL
RPOC2_SYNS3      AAKKDLLDQAEELITETEESYRLGVITEVERHTKVIDTWTETNERLVDAVKKNFNDNDPL
RPOC2_SYNPW      EAKQNLLGQAEELITATEESYRLGVITEVERHTKVIDTWTETNERLVDAVKKNFNQNDPL
RPOC2_SYNSC      EAKKDLLGQAEEQITATEERYRLGEITEVERHTKVIDTWTETNERLVDAVKKNFDENAPL
RPOC2_SYNPX      EAKKALLGEAEEQITATEERYRLGEITEVERHTKVIDTWTETNERLVDAVKKNFNQNAPL
RPOC2_SYNS9      AAKKDLLGQAEEQITATEERYRLGEITEVERHTKVIDTWTETNERLVDAVKKNFDENAPL
RPOC2_PROMS      DAKQDLIGQAEEQISATEECYRLGEITEVERHTKVIDTWTETNERLVDAVKNNFNQNDPL
RPOC2_PROM0      EAKQDLIGQAEEQISATEECYRLGEITEVERHTKVIDTWTETNERLVDAVKNNFNQNDPL
RPOC2_PROM2      EAKQDLIGQAEEQISATEECYRLGEITEVERHTKVIDTWTETNERLVDAVKNNFNQNDPL
RPOC2_PROM9      AAKQDLIGQAEEQISATEECYRLGEITEVERHTKVIDTWTETNERLVDAVKDNFNQNDPL
RPOC2_PROM5      EAKQDLIGQAEAQITSTEECYRLGEITEVERHTKVIDTWTETNERLVDAVKNNFNQNDPL
RPOC2_PROMP      EAKQDLIGQAEAQITATEECYRLGEITEVERHTKVIDTWTETNERLVDAVKNNFNQNDPL
RPOC2_SYNR3      GDKSTLLQEAEDQITATEERYRLGEITEVERHTKVIDTWTETNERLVQSVRRNFDENDPL
RPOC2_PAUCH      KEKKFLLEQAEEQITATEERYRLGEITEVERHTKVIDTWTETNERLVLAIKKNFNENDPL
RPOC2_GUITH      PIKRDLLLQANREIQQTEQLYERGEITTIERFQKVIDTWNNTSEQLKDEVIKYFKQNDPL
RPOC2_RHDSA      PTKRELLKRTNEEINLTQQKYERGEITTVERFQKVIDTWNNASEELKDEVVKYFKETDPL
RPOC2_PORPU      PSKKSLLLSTIEEIKNTENKYRRGEITTVERFQKVIDTWNNASESLKQEVIEYFKETDPL
RPOC2_PYRYE      PSKQSLLLGTIEDIKATENKYRRGEITAVERFQKVIDTWNNASESLKQEVIKYFKETDPL
RPOC2_GRATL      PAKNNLLKTTIDLINDTDTKYRKGEITAVERFQKVIDTWNSASDTLKKQVIKYFTEKDPL
RPOC2_CYAPA      PLKDSLLQTAENEIKATLNRYLLGEITEVERFQKVIDIWHRTSETLKDEVVDYFKSTDPL
RPOC2_CYACA      PNKSRILQITNQELRKTEISFKRAEITTIEKSQKSTDTWNNASEALKDEIIKYYRLTDPL
RPOC2_EMIHU      AKKRELIGLTRNEVETTQKRYEIGSITSVEKFQKTIDIWNNANNFLKDDVLTYFRESDPL
RPOC2_PHATC      FVKNLMLEKANQEIINAEKIYLKGKITDVERFQKIIDTWSLTSESLKEQVIYYFKNYDPL
RPOC2_THAPS      ATKNEMLEKANKDILNAEKICLKGKITDVERFQKIIDTWSIASESLKDNVVSYFKTYDPL
RPOC2_TRICV      YNKNLLLKIAHQEINSSEKIYLKGKLTDVERFQKLIDTWNLTSESLKDELVSYFKRYDPL
RPOC2_CHLVU      PQKASFLSAASVSGVEAAQALETGNLTSVEKSQRLIDTWNKTSESLRQAAVHNFRATNPV
RPOC2_OSTTA      PIKSAFLLNAENDIYENDLRLKRGQITSVQRLEKALDIWNTTNDTLKTEVVKYFRSTDIF
RPOC2_BIGNA      STKYDLIEKTNDNIKDITNHLNLAVLNEVEHSQKLINSWQKISEILKININKKFKTVNKL
RPOC2_CHLAT      PSKRWLLEDAEEEIQFTERQYQKGKITAVERFQKVIDTWHSTSETLKDEVVQHFLQTDTL
RPOC2_MESVI      PTKKWLLEDAEQEIAKTQKNYSIGKITAVERFQKVIDTWHSTSETLKNEVVQYFEQTNPL
RPOC2_NEPOL      PTKPRLLQEAHREINRMEFRYQQGYVSLVERFQKVIDTWNGTSELLKDDVVENFLATDPL
                   :  ::                . :  ::   :  : *   .  :       :      

RPOC2_STAPU      NPVHIMSFSGARGNVSQVHQLVGMRGLMANPQGNIIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_ZYGCR      NPVHMMSFSGARGNVSQVHQLVGMRGLISDPQGNIIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_CHAVU      NPVHMMAFSGARGTTSQVHQLVGMRGLMSDPHGQIIDLPIQSNFREGLSLAEYIISCYGA
RPOC2_ANEMR      NPVHMMSFSGARGSTSQIHQLVGMRGLMSDPQGQIIDLPIQSNFREGLSLTEYIISCYGA
RPOC2_MARPO      NPVHMMSFSGARGSTSQVHQLVGMRGLMSDPQGQIIDLPIQSNFREGLSLTEYIISCYGA
RPOC2_PHYPA      NPVHMMSFSGARGSTSQVHQLVGMRGLMSDPQGQIIDLPIQSNFREGLSLTEYIISCYGA
RPOC2_ANTAG      NPVHMMSFSGARGSASQVHQLVGMRGLVSDPQGQIIDLPIKSNFREGLSLTEYIISCYGA
RPOC2_ANGEV      NPVHMMSFSGARGSISQVHQLVGMRGLMSDPQGQIIDLPIQNNFREGLSLTEYIISCYGA
RPOC2_PSINU      NPVHMMSFSGARGSTSQVHQLVGMRGLMSDPQGQIIDLPIRSNLREGLSLTEYIISCYGA
RPOC2_PINKO      NPVHVMSFSGARGNTSQVHQLVGMRGLMSDPQGQIIDLPIRRNLREGLSLTEYIISCYGA
RPOC2_PINTH      NPVHVMSFSGARGSTSQVHQLVGMRGLMSDPQGQIIDLPIRRNLREGLSLTEYIISCYGA
RPOC2_CYCTA      NPVHMMSFSGSRGSTSQVHQLVGMRGLVSDPQGQIVDLPIQSNFREGLSLTEYIISCYGA
RPOC2_CRYJA      NPVHMMSFSGARGSTSQVHQLVGMRGLMSDPRGKIVDLPIQGNFREGLSLTEYIISCYGA
RPOC2_AGRST      NPVYLMSFSGARGNASQVHQLVGMRGLMADPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_LOLPR      NPVYLMSFSGARGNASQVHQLVGMRGLMADPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_HORVU      NPVYLMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_WHEAT      NPVYLMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_SACHY      NPVYLMSFSGARGNASQVHQLVGMRGLMADPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_SACOF      NPVYLMSFSGARGNASQVHQLVGMRGLMADPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_SORBI      NPVYLMSFSGARGNASQVHQLVGMRGLMADPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_MAIZE      NPVYLMSFSGARGNASQVHQLVGMRGLMADPQGQMIHLPIQSNLREGLSLTEYIISCYGA
RPOC2_ORYNI      NPVYLMSFSGARGNASQVHQLVGMRGLMADPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_ORYSI      NPVYLMSFSGARGNASQVHQLVGMRGLMADPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_ORYSA      NPVYLMSFSGARGNASQVHQLVGMRGLMADPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_ORYSJ      NPVYLMSFSGARGNASQVHQLVGMRGLMADPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_DIOEL      NPVHLMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_PHAAO      NPVHLMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSVTEYIISCYGA
RPOC2_LEMMI      NPVHLMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_ACOCL      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_AMBTC      NPVYIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYTISCYGA
RPOC2_NYMAL      NPVHIMSYSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYTISCYGA
RPOC2_ILLOL      NPVHIMSFSGARGNVSQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYTISCYGA
RPOC2_CALFG      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_LIRTU      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_DRIGR      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYLISCYGA
RPOC2_CHLSC      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_CERDE      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_PIPCE      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_BUXMI      NPVHIMSFSGARGNPSQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_PLAOC      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_NANDO      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_RANMC      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_SOLBU      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_SOLTU      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_SOLLC      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_ATRBE      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_NICSY      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_TOBAC      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_NICTO      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_COFAR      NPVHIMSFSGARGNVSQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_JASNU      NPVHIMSFSGARGNASQVHQLIGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_CUSEX      NPVHLMYFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_CUSRE      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_IPOPU      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_DAUCA      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_PANGI      NPVHIMSFSGARGNASQVHQLVGMRGLMADPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_GUIAB      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_HELAN      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_LACSA      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_SILLA      NPVHIMSFSGARGNVSQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_SPIOL      NPVHIMSFSGARGNVSQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_FAGEA      NPVHMMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_SOYBN      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_PHAVU      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_LOTJA      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_PELHO      NPVHIMSFSGARGNASQVNQLIGMRGLMSDPLGQMIDLPIQSNLREGLSLTEYIISSYGA
RPOC2_OENAR      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_OENPA      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_OENEH      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_OENGL      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_OENBI      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_EUCGG      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_AETCO      NPVHMMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_AETGR      NPVHMMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_ARATH      NPVHMMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_CAPBU      NPVHMMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_CRUWA      NPVHMMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_OLIPU      NPVHMMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_BARVE      NPVHMMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_NASOF      NPVHMMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_LEPVR      NPVHMMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_LOBMA      NPVHMMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_ARAHI      NPVHMMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_DRANE      NPVHMMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_SINAL      NPVHMMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_CARPA      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_GOSBA      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_GOSHI      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_CITSI      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_CUCSA      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_MORIN      NPVHMMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_POPAL      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_POPTR      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_MANES      NPVHIMSFSGARGNTSQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_VITVI      NPVHIMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGA
RPOC2_WELMI      NPVYMMSFSGARGNKSQVHQLLGIRGLMSDPQGKIVDLPIQGNFQEGLSLTEYIISSYGA
RPOC2_ADICA      NPVHMMSVSGARGTISQVHQLLGMRGLMADPRGQVIDLPIRRNLREGLSLTEYIISCYGA
RPOC2_CHAGL      NPVHMMSFSGARGNASQVHQLVGMRGLMADPQGQIIDLPIQSNFREGLSLTEYIISCYGA
RPOC2_ACAM1      NSVYMMAFSGARGNLSQVRQLVGMRGLMADPQGEIIDLPIKTNFREGLTVTEYIISSYGA
RPOC2_THEEB      NSVYMMAFSGARGNLSQVRQLVGMRGLMANPQGEIIDLPIKTNFREGLTVTEYIISSYGA
RPOC2_NOSS1      NSVYMMAFSGARGNISQVRQLVGMRGLMADPQGEIIDLPIKTNFREGLTVTEYIISSYGA
RPOC2_TRIV2      NSVYMMAFSGARGNISQVRQLVGMRGLMADPQGEIIDLPIKTNFREGLTVTEYIISSYGA
RPOC2_NOSP7      NSVYMMAFSGARGNISQVRQLVGMRGLMADPQGEIIDLPIKTNFREGLTVTEYIISSYGA
RPOC2_SYNE7      NSVYMMAFSGARGNISQVRQLVGMRGLMANPQGEIIDLPIKTNFREGLTVTEYIISSYGA
RPOC2_SYNP6      NSVYMMAFSGARGNISQVRQLVGMRGLMANPQGEIIDLPIKTNFREGLTVTEYIISSYGA
RPOC2_TRIEI      NSVYMMAFSGARGNISQVRQLVGMRGLMADPQGEIIDLPIKTNFREGLTVTEYIISSYGA
RPOC2_CROS5      NSVYMMAFSGARGNMSQVRQLVGMRGLMADPQGQIIDQPIKTNFREGLTVTEYVISSYGA
RPOC2_SYNY3      NSVYMMAFSGARGNMSQVRQLVGMRGLMADPQGEIIDLPIKTNFREGLTVTEYVISSYGA
RPOC2_MICAN      NSVYMMAFSGARGNMSQVRQLVGMRGLMANPQGEIIDLPIKTNFREGLTVTEYVISSYGA
RPOC2_SYNP2      NSVYMMAFSGARGNLSQVRQLVGMRGLMADPQGEIIDLPIKTNFREGLTVTEYIISSYGA
RPOC2_SYNJB      NSVYMMANSGARGNVSQVRQLVGMRGLMANPQGRIIDLPIKTNFREGLTVTEYIISSYGA
RPOC2_SYNJA      NSVYMMANSGARGNVSQVRQLVGMRGLMANPQGEIIDLPIKTNFREGLTVTEYIISSYGA
RPOC2_GLOVI      NSVGMMAFSGARGNLSQVRQLVGMRGLMANPQGEIIDLPIKANFREGLNVTEYIISSYGA
RPOC2_PROMA      NSVWMMANSGARGNMSQVRQLVGMRGLMANPQGEIIDLPIRTNFREGLTVTEYVISSYGA
RPOC2_PROM4      NSVWMMANSGARGNMSQVRQLVGMRGLMANPQGEIIDLPIRTNFREGLTVTEYVISSYGA
RPOC2_PROM1      NSVWMMANSGARGNMSQVRQLVGMRGLMANPQGEIIDLPIRTNFREGLTVTEYVISSYGA
RPOC2_PROMT      NSVWMMANSGARGNMSQVRQLVGMRGLMANPQGEIIDLPIRTNFREGLTVTEYVISSYGA
RPOC2_PROM3      NSVWMMANSGARGNMSQVRQLVGMRGLMANPQGEIIDLPIRTNFREGLTVTEYVISSYGA
RPOC2_PROMM      NSVWMMANSGARGNMSQVRQLVGMRGLMANPQGEIIDLPIRTNFREGLTVTEYVISSYGA
RPOC2_SYNS3      NSVWMMANSGARGNMSQVRQLVGMRGLMANPQGEIIDLPIRTNFREGLTVTEYVISSYGA
RPOC2_SYNPW      NSVWMMANSGARGNMSQVRQLVGMRGLMANPQGEIIDLPIRTNFREGLTVTEYVISSYGA
RPOC2_SYNSC      NSVWMMANSGARGNMSQVRQLVGMRGLMANPQGEIIDLPIRTNFREGLTVTEYVISSYGA
RPOC2_SYNPX      NSVWMMANSGARGNMSQVRQLVGMRGLMANPQGEIIDLPIRTNFREGLTVTEYVISSYGA
RPOC2_SYNS9      NSVWMMANSGARGNMSQVRQLVGMRGLMANPQGEIIDLPIRTNFREGLTVTEYVISSYGA
RPOC2_PROMS      NSVWMMANSGARGNMSQVRQLVGMRGLMANPQGEIIDLPIRTNFREGLTVTEYVISSYGA
RPOC2_PROM0      NSVWMMANSGARGNMSQVRQLVGMRGLMANPQGEIIDLPIRTNFREGLTVTEYVISSYGA
RPOC2_PROM2      NSVWMMANSGARGNMSQVRQLVGMRGLMANPQGEIIDLPIRTNFREGLTVTEYVISSYGA
RPOC2_PROM9      NSVWMMANSGARGNMSQVRQLVGMRGLMANPQGEIIDLPIRTNFREGLTVTEYVISSYGA
RPOC2_PROM5      NSVWMMANSGARGNMSQVRQLVGMRGLMANPQGEIIDLPIRTNFREGLTVTEYVISSYGA
RPOC2_PROMP      NSVWMMANSGARGNMSQVRQLVGMRGLMANPQGEIIDLPIRTNFREGLTVTEYVISSYGA
RPOC2_SYNR3      NSVWMMANSGARGNMSQVRQLVGMRGLMANPQGEIIDLPIRTNFREGLTVTEYVISSYGA
RPOC2_PAUCH      NSVWMMANSGARGNISQVRQLVGMRGLMANPQGEIIDLPIRANFKEGLTVTEYVISSYGA
RPOC2_GUITH      NPIYIMAFSGARGNISQVRQLVGMRGLMADPQGQIIDLPIKSNFREGLTVTEYLISSYGA
RPOC2_RHDSA      NTIYIMAFSGARGNISQVRQLVGMRGLMADPQGQIIDLPIKSNFREGLTVTDYIISSYGA
RPOC2_PORPU      NSVYMMAFSGARGNISQVRQLVGMRGLMADPQGQIIDLPISSNSREGLTVTDYFISSYGA
RPOC2_PYRYE      NAVSMMAFSGARGNISQVRQLVGMRGLMADPQGQIIDLPISSNFREGLTVTDYFISSYGA
RPOC2_GRATL      NSIYMMAFSGARANISQVRQLVGMRGLMADPQGQIIDLPISSNFREGLTITDYFISSYGA
RPOC2_CYAPA      NSLYMMSFSGARGNLSQVHQLVGMRGLMADPQGEIIDFPIRSNFKEGLTTTEYLISSYGA
RPOC2_CYACA      NPVYMMAFSGARGNLSQVKQLVGMRGLMADPNGQIIELPILSNFREGLNVTEYLISSYGA
RPOC2_EMIHU      NPLYIMAFSGARGNISQVRQLVGMRGLMSNPQGQIIDLPIKSNFREGLTVTEYIISSYGA
RPOC2_PHATC      NSVYIMAFSGARGNLSQVRQLVGMRGLMSDPSGEIMNLPIKKNFREGLTITDYLMSGYGA
RPOC2_THAPS      NSVYIMAFSGARGNLSQVRQLVGMRGLMADPSGEIMRVPIKKNFREGLTITDYLMSGYGA
RPOC2_TRICV      NSVYIMAFSGARGNLSQVRQLVGMRGLMSDPSGELLKLPIKKNFREGLTITDYLMSGYGA
RPOC2_CHLVU      NPVYMMAFSGARGNISQVRQLVAMRGLMADPQGAILEFPIQSNFREGLTITEYLLSCYGA
RPOC2_OSTTA      NPVYMMAFSGARGNISQVRQLVGMRGLMADPQGQILDFPIRRNFREGLTVTEYMISCYGA
RPOC2_BIGNA      NPIYMMAFSGARGNISQVRQLIGMRGLMADPNGQIIHLPIKSNFREGLTVTEYLISCYGA
RPOC2_CHLAT      NPVYMMAFSGARGNISQVRQLVGMRGLMSDPQGQIIDLPIRSNFREGLTVTEYVISCYGA
RPOC2_MESVI      NPVYMMAFSGARGNLSQVSQLVGMRGLMSDPQGQIIDLPIRSNFREGLTVTEYVISCYGA
RPOC2_NEPOL      NPVYMMAFSGARGNLSQVRQLVGMRGLMSNPQGEIIDLPIRSNFREGLTVTEYIISCYGA
                 *.: :*  **:*.. **: **:.:***:::* * ::  **  * :***. ::* :* ***

RPOC2_STAPU      RKGVVDTAVRTADAGYLTRRLVEVVQHVVIRNPDCETNQGIRLHSIRDRKTTRDAGGNSL
RPOC2_ZYGCR      RKGVVDTAIRTADAGYLTRRLVEVAQHVVIRNVDCNTYEGIILRSIRTR------QGNAY
RPOC2_CHAVU      RKGVVDTAIRTSDSGYLTRRLVDVAQHIVVRKTDCKTHKCISIQPFLEEW-----KMNIH
RPOC2_ANEMR      RKGVVDTAVRTSDAGYLTRRLVEVVQRIVVRKSDCGTTSGISMNHSWKKK---RI----I
RPOC2_MARPO      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRKVDCGTLYGINVNNLSEKK---NN----F
RPOC2_PHYPA      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRKVDCGTSENIFVTPLQNNY---K-----K
RPOC2_ANTAG      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRKTDCNTFRGISLNSTEDKK---KNLQIFT
RPOC2_ANGEV      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRKKDCGTLRGILLNSNRDGR---RSIQPFS
RPOC2_PSINU      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRKMDCGSTRGIPFKMTQD-----RFKRNLY
RPOC2_PINKO      RKGVVDTAVRTADAGYLTRRLVEVVQQIVVRRTDCGTVQGIFVSPIRGRE---RDINEVV
RPOC2_PINTH      RKGVVDTAVRTADAGYLTRRLVEVVQHIVVRRTDCGTIQGIFVSPIRGRE---RDRNEIV
RPOC2_CYCTA      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRKTDCGTIQGIFVNLIQGRE---RIKNRIV
RPOC2_CRYJA      RKGVVDTSIRTADAGYLTRRLVEVVQHLVVRKVDCGTIQGLFVNLIQDRE---TIKNKFV
RPOC2_AGRST      RKGVVDTAVRTADAGYLTRRLVEVVQHILVRRRDCGTIQGISVSPQNG------MTEKLF
RPOC2_LOLPR      RKGVVDTAVRTADAGYLTRRLVEVVQHIIVRRRDCGTIRGISVSPQNG------MTEKLF
RPOC2_HORVU      RKGVVDTAVRTADAGYLTRRLVEVVQHIIVRRRDCGTIRGISVSPQNG------MTEKLF
RPOC2_WHEAT      RKGVVDTAVRTADAGYLTRRLVEVVQHIIVRRRDCGTIRGISVSPQNG------MTEKLF
RPOC2_SACHY      RKGVVDTAVRTADAGYLTRRLVEVVQHIIVRRRDCGTIQGISVSPQNG------MTEKLF
RPOC2_SACOF      RKGVVDTAVRTADAGYLTRRLVEVVQHIIVRRRDCGTIQGISVSPQNG------MTEKLF
RPOC2_SORBI      RKGVVDTAVRTADAGYLTRRLVEVVQHIIVRRRDCGTIQGISVSPQNG------MTEKLF
RPOC2_MAIZE      RKGVVDTAVRTADAGYLTRRLVEVVQHIIVRRRDCGTIQGISVSPQNG------MTEKLF
RPOC2_ORYNI      RKGVVDTAVRTADAGYLTRRLVEVVQHIIVRRRDCGTIQAISVSPQNG------MTEKLF
RPOC2_ORYSI      RKGVVDTAVRTADAGYLTRRLVEVVQHIIVRRRDCGTIQAISVSPQNG------MTEKLF
RPOC2_ORYSA      RKGVVDTAVRTADAGYLTRRLVEVVQHIIVRRRDCGTIQAISVSPQNG------MTEKLF
RPOC2_ORYSJ      RKGVVDTAVRTADAGYLTRRLVEVVQHIIVRRRDCGTIQAISVSPQNG------MTEKLF
RPOC2_DIOEL      RKGVVDTAVRTSDAGYLTRRLVEVVQHIIVRRTDCGTIRSISVSPRK------GMTEKIF
RPOC2_PHAAO      RKGVVDTAVRTSDAGYLTRRLVEVVQHILVRRTDCGTIRGISVSPQN------GMTEKIF
RPOC2_LEMMI      RKGVVDTAVRTSDAGYLTRRLVEVVQHIIVRRTDCGTIRSISVSPRN------GVPERIF
RPOC2_ACOCL      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVQPRN------GMTERMF
RPOC2_AMBTC      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRNGV----GVTERIF
RPOC2_NYMAL      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGSTRGISVSFRK------GMTERIF
RPOC2_ILLOL      RKGVVDTAVRTSDAGYLTRRLVEVVQHVVVRRTDCGTIRGISISIRN------GMTGRIL
RPOC2_CALFG      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRN------GMTERIW
RPOC2_LIRTU      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRN------GMTEKIL
RPOC2_DRIGR      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRNGI----GMTEKML
RPOC2_CHLSC      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGIFVSPQN------GMAKRIF
RPOC2_CERDE      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRRISVSPQN------GMTEKIF
RPOC2_PIPCE      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISASPRN------SMEEKIW
RPOC2_BUXMI      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGIYVTSRNG-----MMTERIF
RPOC2_PLAOC      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTLQGISVSPRNG-----MITERIL
RPOC2_NANDO      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTLRGSSVSPRNG-----TITERIF
RPOC2_RANMC      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTTRGISVSPRNG-----MITERIF
RPOC2_SOLBU      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTARGISVSPRNG-----IMPERIF
RPOC2_SOLTU      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTARGISVSPRNG-----IMPERIF
RPOC2_SOLLC      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTARGISVSPRNG-----IMPERIF
RPOC2_ATRBE      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTARGISVSPRNG-----MMPERIF
RPOC2_NICSY      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTARGISVSPRNG-----MMPERIF
RPOC2_TOBAC      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTARGISVSPRNG-----MMPERIF
RPOC2_NICTO      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTARGISVSPRNG-----MMPERFF
RPOC2_COFAR      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTVRGISVSPPNG-----MMPEKFF
RPOC2_JASNU      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISLSPRNG-----MMPERVF
RPOC2_CUSEX      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTARGISVSPHNG-----MMPERMF
RPOC2_CUSRE      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRADCGTARGISVSPHNG-----MMPERIF
RPOC2_IPOPU      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRADCGTVRGVSVSPQNG-----MMPERIL
RPOC2_DAUCA      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRKDCGTARGISVSLGNG-----MMSENIF
RPOC2_PANGI      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRKDCGTVRGISVSPRNG-----MMPERVF
RPOC2_GUIAB      RKGVVDTAIRTSDAGYLTRRLVEVVQHIVVRRTDCGTVRGISVSPRNG-----MMADRIF
RPOC2_HELAN      RKGVVDTAIRTSDAGYLTRRLVEVVQHIVVRRTDCGTVRGISVSPRNG-----MMADRIF
RPOC2_LACSA      RKGVVDTAIRTSDAGYLTRRLVEVVQHIVVRRTDCGTVRGISVSPRNG-----MMTDRIF
RPOC2_SILLA      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRNG-----RMPERIF
RPOC2_SPIOL      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRRDCGTIRGISVSPQNS-----TMPERIL
RPOC2_FAGEA      RKGVVDTAVRTSDAGYLTRRLVEVVQHVVVRRRDCGTTRGISVSPQTG-----TIPEILF
RPOC2_SOYBN      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIQGISVNTQNG-----MMPERIW
RPOC2_PHAVU      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVIRRTDCGTIRGISVNTQNE-----MMPESTW
RPOC2_LOTJA      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTVRGISVNTRNR-----MMSERIL
RPOC2_PELHO      RKGVVDTAIRTADAGYLTRRLVDVVQHIIVRGTDCGTTRGLSLSPQNG-----GVPES--
RPOC2_OENAR      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTLRGISVSPRR-------MPERIF
RPOC2_OENPA      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTLRGISVSPRR-------MPERIF
RPOC2_OENEH      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTLRGISVSPRR-------MPERIF
RPOC2_OENGL      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTLRGISVSPRR-------MPERIF
RPOC2_OENBI      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTLRGISVSPRR-------MPERIF
RPOC2_EUCGG      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGVSVSPRNGM-----MPERIF
RPOC2_AETCO      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRNKNR---MMSERIF
RPOC2_AETGR      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRNKNR---MMSEPIF
RPOC2_ARATH      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRNKNR---MMSERIF
RPOC2_CAPBU      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRNKNR---MMSERIF
RPOC2_CRUWA      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRNKNR---MMSERIF
RPOC2_OLIPU      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRNKNR---MMSERIF
RPOC2_BARVE      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRNKNR---MMSERIF
RPOC2_NASOF      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRNKNR---MMSERIF
RPOC2_LEPVR      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRNKNR---MMSERIF
RPOC2_LOBMA      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRNKNR---MMSERIF
RPOC2_ARAHI      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRNKNR---MMSERIF
RPOC2_DRANE      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRNKNR---MMSERIF
RPOC2_SINAL      RKGVVDTAVRQSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRNKSR---MMSERIF
RPOC2_CARPA      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSP--KNR---TMPERIF
RPOC2_GOSBA      RKGVVDTAVLTSDAGYLTRRLVEVVQHIVVRRTDCGTTRGISVSP--QKR---TLPERIF
RPOC2_GOSHI      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTTRGISVSP--QKR---TLPERIF
RPOC2_CITSI      RKGVVDTAVRTSDAGYLTRRLVEVVQHIIVRRTDCGTVRGISVSPQNQNR---MMSERVF
RPOC2_CUCSA      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGILVSPGNR-----MIPERIF
RPOC2_MORIN      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIQGISVSPPNG-----MMPERIF
RPOC2_POPAL      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTTRGISVSSRNG-----MIPERIF
RPOC2_POPTR      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTTRGISVSSRNG-----MIPERIF
RPOC2_MANES      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTARGISVSPRNG-----MMPERIF
RPOC2_VITVI      RKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRNG-----MIPERIF
RPOC2_WELMI      RKGVVDTAVRTADAGYLTRRLVEVVQHIIVRKTDCGTTQGIFISPIQDRD---RSKENVF
RPOC2_ADICA      RKGVVDTAVRTSDAGYLTRRLVEVVQHIAVRRRDCETPRSLAFLTSNTGE---RRRGFLG
RPOC2_CHAGL      RKGVVDTAVRTADAGYLTRRLVEVVQHIVVRKIDCGSIDGIQLKPLKE------KKIKNL
RPOC2_ACAM1      RKGLVDTALRTADSGYLTRRLVDVSQDVIIRELDCGTQRGIPVQSMTDGD-------RVL
RPOC2_THEEB      RKGLVDTALRTADSGYLTRRLVDVSQDVIIREEDCETERGITLRSMTVGD-------KVL
RPOC2_NOSS1      RKGLVDTALRTADSGYLTRRLVDVSQDVIIREIDCGTTRGIPVRPMTEGS-------KTL
RPOC2_TRIV2      RKGLVDTALRTADSGYLTRRLVDVSQDVIIREIDCGTTRGIPVRPMTEGS-------KTL
RPOC2_NOSP7      RKGLVDTALRTADSGYLTRRLVDVSQDVIIREFDCGTTRGLTIGPMTEGA-------KTL
RPOC2_SYNE7      RKGLVDTALRTADSGYLTRRLVDVSQDVIIHEVDCGTSRGLFVEAMTDGD-------RIL
RPOC2_SYNP6      RKGLVDTALRTADSGYLTRRLVDVSQDVIIHEVDCGTSRGLFVEAMTDGD-------RIL
RPOC2_TRIEI      RKGLVDTALRTADSGYLTRRLVDVSQDVIVREADCGTKRGVMVTSMKDGD-------RVL
RPOC2_CROS5      RKGLVDTALRTADSGYLTRRLVDVSQDVIVREIDCGTRRGLKVTAMKDGD-------RVK
RPOC2_SYNY3      RKGLVDTALRTADSGYLTRRLVDVSQDVIVREQDCGTERSLRVTAMTDGD-------QVK
RPOC2_MICAN      RKGLVDTALRTADSGYLTRRLVDVSQDVIVREADCGTNRYVELTAMTDGD-------RVL
RPOC2_SYNP2      RKGLVDTALRTADSGYLTRRLVDVSQDVIVREEDCGTARGLKLRAMTDGE-------REQ
RPOC2_SYNJB      RKGLVDTALRTADSGYLTRRLVDVSQDVIVRESDCGTEQGILLEYLMDGD-------KVV
RPOC2_SYNJA      RKGLVDTALRTADSGYLTRRLVDVSQDVIVRESDCGTDQGILLEPLMDAD-------KVV
RPOC2_GLOVI      RKGLVDTALRTADSGYLTRRLVDVSQDVIVREEDCTTQRGIFLGSLRDGD-------KMI
RPOC2_PROMA      RKGLVDTALRTADSGYLTRRLVDVAQDVIVREEDCGTTRAILINAED-------------
RPOC2_PROM4      RKGLVDTALRTADSGYLTRRLVDVAQDVIVREEDCGTSRAILVKAED-------------
RPOC2_PROM1      RKGLVDTALRTADSGYLTRRLVDVAQDVIVREEDCGTTRSILISAED-------------
RPOC2_PROMT      RKGLVDTALRTADSGYLTRRLVDVAQDVIVREEDCGTTRSILISAED-------------
RPOC2_PROM3      RKGLVDTALRTADSGYLTRRLVDVAQDVIVREDDCGTTRGIIVKVED-------------
RPOC2_PROMM      RKGLVDTALRTADSGYLTRRLVDVAQDVIVREDDCGTTRGIIVKAED-------------
RPOC2_SYNS3      RKGLVDTALRTADSGYLTRRLVDVAQDVIVREDDCGTMRSIMVKAED-------------
RPOC2_SYNPW      RKGLVDTALRTADSGYLTRRLVDVAQDVIVREDDCGTSRCILVKAED-------------
RPOC2_SYNSC      RKGLVDTALRTADSGYLTRRLVDVAQDVIVREDDCGTTRHIVVDAED-------------
RPOC2_SYNPX      RKGLVDTALRTADSGYLTRRLVDVAQDVIVREDDCGTTRHIVVEAED-------------
RPOC2_SYNS9      RKGLVDTALRTADSGYLTRRLVDVAQDVIVREDDCGTMRHIVVEAED-------------
RPOC2_PROMS      RKGLVDTALRTADSGYLTRRLVDVAQDVIVREEDCGTERSIVVEAED-------------
RPOC2_PROM0      RKGLVDTALRTADSGYLTRRLVDVAQDVIVREEDCGTERSIVVEAED-------------
RPOC2_PROM2      RKGLVDTALRTADSGYLTRRLVDVAQDVIVREEDCGTELSIVVEAED-------------
RPOC2_PROM9      RKGLVDTALRTADSGYLTRRLVDVAQDVIVREEDCGTERSIVVEAED-------------
RPOC2_PROM5      RKGLVDTALRTADSGYLTRRLVDVAQDVIVREEDCGTERSIVIEAED-------------
RPOC2_PROMP      RKGLVDTALRTADSGYLTRRLVDVAQDVIVREEDCGTERSIVINSED-------------
RPOC2_SYNR3      RKGLVDTALRTADSGYLTRRLVDVAQDVIVREDDCGTTRSIKVAADDN------------
RPOC2_PAUCH      RKGLVDTALRTADSGYLTRRLVDVAQDVIVREDDCGTERGIVVEADEK------------
RPOC2_GUITH      RKGLVDTALRTADSGYLTRRLVDVAQDIIIREIDCGTQRGIVLRDMVDNN-------QIL
RPOC2_RHDSA      RKGLVDTALRTADSGYLTRRLVDVAQDIIIREIDCDTDRGILLKDMVSNN-------QIL
RPOC2_PORPU      RKGLVDTALRTADSGYLTRRLVDVSQDVIIREVDCKTKKGIILEDLVDTQ-------KVL
RPOC2_PYRYE      RKGLVDTALRTADSGYLTRRLVDVSQDVIIREVDCKTNKGIILEDLVDTQ-------KIL
RPOC2_GRATL      RKGLVDTALRTADSGYLTRRLVDVAQDVIIREADCNTSKGIVLESMIDNR-------KTL
RPOC2_CYAPA      RKGVVDTALRTADSGYLTRRLVDIAQEVIIREIDCETPRGVILTALKENG-------KIL
RPOC2_CYACA      RKGLVDTSLRTADSGYLTRRLVDVAQDIIVREIDCKTNNGITFSNIQNNE-------KII
RPOC2_EMIHU      RKGLVDTALRTADSGYLTRRLVDVAQDIIVRESDCGTTEGLWATELA-------------
RPOC2_PHATC      RKGIVDTALKTANSGYLTRRLIDVGQDVLIREKDCLTNHSFLFSVSNEEL-------KSL
RPOC2_THAPS      RKGIVDTALKTANSGYLTRRLIDIAQDIVIREKDCLTSSSFLIDSQTK------------
RPOC2_TRICV      RKGIIDTALKTANSGYLTRRLIDVAQDIIIREKDCLTKHSCLIINFESNL-------RIK
RPOC2_CHLVU      RKGLVDTALRTASAGYLTRRLVDAVQHVVIYTKNCKTEKGITF---------------KG
RPOC2_OSTTA      RKGLVDTALRTASSGYLTRRLVDVAQSVIIQQVDCQTTQGLRIV-------------PEL
RPOC2_BIGNA      RKGVVDTALRTATAGYLTRRLVDTAQHVIISQLDCGTKQGIFLSNLYQGT-------DIL
RPOC2_CHLAT      RKGLVDTALRTADSGYLTRRLVDVAQHVIIRETDCGTLSGISLMPMKDQD-------KII
RPOC2_MESVI      RKGLVDTALRTADSGYLTRRLVDVAQDMIIRETDCGTKSGILLGPVKDEQ-------KVV
RPOC2_NEPOL      RKGLVDTALRTANSGYLTRRLVDVAQDIVIRMTSCSPSAYPLISFTKSGK-------EVV
                 ***::**::  : :*******::  * : :   .* .                       

RPOC2_STAPU      LSLQERLIGRVLARNVFLGKRCIAIKN--------QDLAPDLVNSLVNFPKALLSPGSEG
RPOC2_ZYGCR      LTQENRIIGRVLARPLYFGKRCIAVRN--------QDIGPDLAAKLSIISPQAI------
RPOC2_CHAVU      LYVQQKLIGRILADYVLKDNRCIASRN--------QDISFDLAIRLLSFKFQSI------
RPOC2_ANEMR      YQR---LIGRVLAENVYINNRCLAMRN--------QDIGNLTVDKFIG-----------L
RPOC2_MARPO      QQK---LIGRVIAENIYIDHRCIAPRN--------QDIGALLANRLIT-----------L
RPOC2_PHYPA      NNK---LIGRILADNIYINGRCIAIRN--------QDITTNLVISLIN-----------F
RPOC2_ANTAG      QQK---LVGRVLADNLYINARCLAIRN--------QDINTNLIEKLIT-----------L
RPOC2_ANGEV      QQR---LIGRVLADNLYVNMRCIATRN--------QDISNELARRLVI-----------S
RPOC2_PSINU      QQR---LIGRVLADNVYLEMRCIAMRN--------QDIGNELANRLIT-----------I
RPOC2_PINKO      VRTQI-LIGRVLADDVYINRRCIATRN--------QDIGVGLANQLRN-----------I
RPOC2_PINTH      VRTQI-LIGRVLADDVYINRRCIATRN--------QDIGVGLANQLIN-----------L
RPOC2_CYCTA      LQT---LIGRVLADDVYIDMRCIATRN--------QDIGVGLAHQLIT-----------L
RPOC2_CRYJA      LQT---LIGRVLADDVYIHGRCIATRN--------EDIGIKLANQLYY-----------F
RPOC2_AGRST      AQT---LIGRVLADDIYIGSRCIAARN--------QDIGIGLVNRFITAFRAQP-----F
RPOC2_LOLPR      VQT---LIGRVLADDIYIGSRCIAARN--------QDIGIGLVNRFITAFRAQP-----F
RPOC2_HORVU      VQT---LIGRVLADDIYIGSRCIAARN--------QDIGIGLVNRFITAFRAQP-----F
RPOC2_WHEAT      VQT---LIGRVLADDIYIGSRCIAARN--------QDIGIGLVNRFITAFRAQP-----F
RPOC2_SACHY      VQT---LIGRVLADDIYIGSRCIASRN--------QDIGIGLVNRFITAFRAQP-----F
RPOC2_SACOF      VQT---LIGRVLADDIYIGSRCIASRN--------QDIGIGLVNRFITAFRAQP-----F
RPOC2_SORBI      VQT---LIGRVLADDIYIGSRCIASRN--------QDIGIGLVNRFITAFRAQP-----F
RPOC2_MAIZE      VQT---LIGRVLADDIYIGSRCIASRN--------QDIGIGLVNRFITAFRAQP-----F
RPOC2_ORYNI      VQT---LIGRVLANDIYIGSRCIATRN--------QDIGIGLVNRFITTFRAQP-----F
RPOC2_ORYSI      VQT---LIGRVLANDIYIGSRCIATRN--------QDIGIGLVNRFITTFRAQP-----F
RPOC2_ORYSA      VQT---LIGRVLANDIYIGSRCIATRN--------QDIGIGLVNRFITTFRAQP-----F
RPOC2_ORYSJ      VQT---LIGRVLANDIYIGSRCIATRN--------QDIGIGLVNRFITTFRAQP-----F
RPOC2_DIOEL      VQT---LIGRVLADDIYMGLRCIAVRK--------QEIGIGLANRLIT-----------F
RPOC2_PHAAO      VQT---LIGRVLADDIYIGLRCIGTRN--------KDIGIGLVNRFIT-----------F
RPOC2_LEMMI      IQT---LIGRVLADDIYIGPRCIAARN--------QDIGIGLVNRFIS-----------F
RPOC2_ACOCL      FQT---LIGRVLADDVYIGLRCIAARN--------QDIGIGLVNRFIT-----------F
RPOC2_AMBTC      IQT---LIGRVLANDVYMGLRCIATRN--------QDIGIGLVNRFIT-----------S
RPOC2_NYMAL      IQT---LIGRVLANDVYLGLRCIATRN--------QDIGIGLVNRFMT-----------S
RPOC2_ILLOL      IQT---LIGRVLADDVYMGLRCIAARN--------QDIGIGLVNRFIT-----------S
RPOC2_CALFG      IQT---LIGRVLAYDIYMGPRCIAARN--------QDIGIGLVNRFIT-----------F
RPOC2_LIRTU      IQT---LIGRVLADDIYMGLRCIATRN--------QDIGIGLVNRFIT-----------F
RPOC2_DRIGR      IQT---LIGRVLADDIYMGLRCIAARN--------QDIGVGLVNRFIA-----------F
RPOC2_CHLSC      IQT---LIGRVLADDIYMGPRCIAARN--------QYIGIGLVNRFIT-----------F
RPOC2_CERDE      IQT---LIGRVLADDIYIGPRCIATRN--------QDIGIGLINRFIT-----------F
RPOC2_PIPCE      IQR---LIGHVLAYDIYIGPRCIAARN--------QDIGIGLVNRFIT-----------F
RPOC2_BUXMI      IQT---LIGRVLADDIYMGPRCIATRN--------QDVGIELVNRFIT-----------F
RPOC2_PLAOC      IQT---LIGRVLADDIYMGPRCIAARN--------QDIGIGLVNRFIT-----------F
RPOC2_NANDO      IQT---LIGRVLADDIYIGSRCIAIRN--------QDIGIGLVNRFIT-----------F
RPOC2_RANMC      IQT---LIGRVLADDLYMGSRCIAIRN--------QDIGVGLVNRFIT-----------F
RPOC2_SOLBU      SQT---LIGRVLADDIYMGSRCIATRN--------QAIGIGLVNRFIT-----------F
RPOC2_SOLTU      SQT---LIGRVLADDIYMGSRCIATRN--------QAIGIGLVNRFIT-----------F
RPOC2_SOLLC      SQT---LIGRVLADDIYMGSRCIATRN--------QAIGIGLVNRFIT-----------F
RPOC2_ATRBE      SQT---LIGRVLADDIYMGPRCIATRN--------QDIGIGLVNRFIT-----------F
RPOC2_NICSY      IQT---LIGRVLADDIYMGPRCIATRN--------QDIGIGLVNRFIT-----------F
RPOC2_TOBAC      IQT---LIGRVLADDIYMGPRCIATRN--------QDIGIGLVNRFIT-----------F
RPOC2_NICTO      IQT---LIGRVLADDIYMGPRCIATRN--------QDIGIGLVNRFIT-----------F
RPOC2_COFAR      IQT---LVGRVLADDIYMGPRCIATRN--------QDIGIELVNRFIT-----------F
RPOC2_JASNU      IQT---LMGRVLADDIYIGTRCLATRN--------QDIGIGLVNRFIT-----------F
RPOC2_CUSEX      IQT---LIGRVLADDIYIGPRCIATRN--------QNIGVGLVNRFLN-----------F
RPOC2_CUSRE      IQT---LIGRVLADDIYIGPRCIATRN--------QNIGVGLVNKLLN-----------F
RPOC2_IPOPU      IQT---LIGRVLADDIYIGPRCIATRN--------QNIGVGLVNRFIT-----------F
RPOC2_DAUCA      IQT---LIGRVLADDIYMGTRCIATRN--------QDIGSGLVNQFIT-----------F
RPOC2_PANGI      IQT---LIGRVLADDIYLGPRCIATRN--------QDIGSGLVNRFIT-----------F
RPOC2_GUIAB      IQT---LIGRVLADDIYIGSRCIATRN--------QDIGVGLVNRFIT-----------F
RPOC2_HELAN      IQT---LIGRVLADDIYIGSRCIATRN--------QDIGVGLVNRFIT-----------F
RPOC2_LACSA      IQT---LIGRVLADDIYIGSRCIATRN--------QDIGVGLVSRFIT-----------F
RPOC2_SILLA      TQI---LIGRVLADDIYLGSRCIATRN--------QDIGVGLVNRFIT-----------F
RPOC2_SPIOL      IQT---LIGRVLADDIYMGSRCIATRN--------QDIGVGLVNRFIT-----------L
RPOC2_FAGEA      IQT---LIGRVLADDIYKGPRCIAARN--------QDIGVGLVNRLIT-----------F
RPOC2_SOYBN      IQT---LIGRVLADDIYRGSRCIAVRN--------QDIGIGLINRFKT-----------L
RPOC2_PHAVU      TQT---LIGRVLADDIYRGSRCIAVRN--------QDIGIGLFNQFKT-----------F
RPOC2_LOTJA      IQT---LIGRVLADDIYIGSRCIVVRN--------QDIGIGLINRFIN-----------F
RPOC2_PELHO      TQT---LIGRVLAKDIYIGPRCIAVRN--------QDLGGGLVNRLIT-----------F
RPOC2_OENAR      IQT---LIGRVLADDIYIGSRCIAIRN--------QDIGIGLVNRFIT-----------F
RPOC2_OENPA      IQT---LIGRVLADDIYIGSRCIAIRN--------QDIGIGLVNRFIT-----------F
RPOC2_OENEH      IQT---LIGRVLADDIYIGSRCIAIRN--------QDIGIGLVNRFIT-----------F
RPOC2_OENGL      IQT---LIGRVLADDIYIGSRCIAIRN--------QDIGIGLVNRFIS-----------F
RPOC2_OENBI      IQT---LIGRVLADDIYIGSRCIAIRN--------QDIGIGLVNRFIT-----------F
RPOC2_EUCGG      IQT---LIGRVLADDIYMGPRCIAIRN--------QDIGIGLVNRFIT-----------F
RPOC2_AETCO      IQT---LIGRVLADDIYIGSRCVAFRN--------QDLGIGLVNRFIT-----------F
RPOC2_AETGR      IQT---LIGRVLADDIYIGSRCVAFRN--------QDLGIGLVNRFIT-----------F
RPOC2_ARATH      IQT---LIGRVLADDIYIGSRCVAFRN--------QDLGIGLVNRLIT-----------F
RPOC2_CAPBU      IQT---LIGRVLADDIYIGSRCVAFRN--------QDLGIGLVNRLIT-----------F
RPOC2_CRUWA      IQT---LIGRVLADDIYIGSRCVAFRN--------QDLGIGLVNGLIT-----------S
RPOC2_OLIPU      IQT---LIGRVLADDIYIGSRCVAFRN--------QDLGIGLVNRLIT-----------F
RPOC2_BARVE      IQT---LIGRVLADDIYIGSRCVAFRN--------QDLGIGLVNRLIT-----------F
RPOC2_NASOF      IQT---LIGRVLADDIYIGSRCVAFRN--------QDLGIGLVNRLIT-----------F
RPOC2_LEPVR      IQT---LIGRVLADDIYIGSRCVAFRN--------QDLGIGLVNRLIT-----------F
RPOC2_LOBMA      IQT---LIGRVLADDIYIGSRCVAFRN--------QDLGIGLVNRFIT-----------F
RPOC2_ARAHI      IQT---LIGRVLADDIYIGSRCVAFRN--------QDLGIGLVNRFIT-----------F
RPOC2_DRANE      IQT---LIGRVLADDIYIGSRCVAFRN--------QDLGIGLVNRFIT-----------F
RPOC2_SINAL      IQT---LIGRVLADDIYIGSRCVAFRN--------QDLGIGLVNRFIT-----------F
RPOC2_CARPA      IQT---LIGRVLADDIYMGPRCIAIRN--------QDIGIGLVNRFIT-----------F
RPOC2_GOSBA      IQT---LIGRVLADDIYMGPRCIAIRN--------QDIGLGLVDRFRA-----------F
RPOC2_GOSHI      IQT---LIGRVLADDIYMGPRCIAIRN--------QDIGLGLVDRFRA-----------F
RPOC2_CITSI      SQT---LIGRVLADDIYMGQRSIAIRN--------QDIGIGLVNRLIT-----------L
RPOC2_CUCSA      IQT---LIGRVLADDIYMGPRCIGVRN--------QDIGIGLINRFIT-----------F
RPOC2_MORIN      IQT---LIGRVLADYIYIGSRCIAVRN--------QDIGIGLVNRFIT-----------F
RPOC2_POPAL      IQT---LIGRVLADNIYMGLRCIATRN--------QDIGIGLVNRFIT-----------F
RPOC2_POPTR      IQT---LIGRVLADNIYMGLRCIATRN--------QDIGIGLVNRFIT-----------F
RPOC2_MANES      IQT---FIGRVLADNIYMGLRCIAIRN--------QDIGIGLANRFIT-----------F
RPOC2_VITVI      IQT---LIGRVLADDIYMGPRCIAIRN--------QDIGIGLVNRFIT-----------F
RPOC2_WELMI      LQK---ITGRVLADDVYINRRCIATRN--------QDISAGLANQFKN-----------L
RPOC2_ADICA      TMPHQGLVGRVLADHVYWDVRCIATRN--------QDISDGLASNLMA------------
RPOC2_CHAGL      FGSADRLVGRVLATDLFIDKRCIAKRN--------QDIGSELAINIIN-----------Y
RPOC2_ACAM1      IPLANRLLGRVVLQEVVHPETGEVILP------KNEAVSESIAKEIAKAG----------
RPOC2_THEEB      -ALQDRLLGRVVLNDVRHPQTGEVLVA------KNQAISADLAKKIVDAG----------
RPOC2_NOSS1      IKLSTRLLGRVVGEDVIHPKTKEVIAP------RNTPISDDLAKEIEKAG----------
RPOC2_TRIV2      IKLSTRLLGRVVGEDVIHPKTKEVIAA------RNTPISDDLAKEIEKAG----------
RPOC2_NOSP7      IPLATRLMGRVIGEDVVHPVTKELIAA------RNSPIPEDLAKKIEKSG----------
RPOC2_SYNE7      IPISQRLLGRVTAEAVLDPSTDEVLAE------AGQDINEDLANRIEKAG----------
RPOC2_SYNP6      IPISQRLLGRVTAEAVLDPSTDEVLAE------AGQDINEDLANRIEKAG----------
RPOC2_TRIEI      IPVKDRLLGRVLADDVKDPKTGEIVTQGHIQAVKNQVLTEDLAKAIGKAG----------
RPOC2_CROS5      IALGDRLLGRVLAEDVMVGD--EVIAS------RNQSIDAALAAKIGKS-----------
RPOC2_SYNY3      ISLADRLFGRLLAKDVVGPDG-EIIAK------RNDEIDEALANRIAAV-----------
RPOC2_MICAN      IPLSDRLLGRSLAEDVVVNG--EVIAT------RNQIIDDETAEKLGRL-----------
RPOC2_SYNP2      ISLEDRLFGRVLNADVVDPKTGEVIAQ------RNQDIDADLAKKIATT-----------
RPOC2_SYNJB      VSLEERLVGRVLARDVVHPQTQEILAR------RNQEVDHDLARTIAEAG----------
RPOC2_SYNJA      VSLEERLVGRVLARDVVHPQTQEILAR------RNQEVDHDLAKAIVEAG----------
RPOC2_GLOVI      VSLEERLVGRVAGRDVVHPVTGEVLAP------RNTQFDYDSAARIARSG----------
RPOC2_PROMA      GRFGNRLVGRLVAEDIVDQ-EDAVIAK------RDTAIDPELSKKIEKAN----------
RPOC2_PROM4      GRFGNRLVGRLTAEQIVGD-ADEIIAK------KDTAIDPELSKKIEKAG----------
RPOC2_PROM1      GKFGNRLVGRLTSEQVVNA-DQEVLAE------RDTPIDPQLSKKFEQSN----------
RPOC2_PROMT      GKFGNRLVGRLTSEQVVNA-DEEVLAE------RDTPIDPQLSKKFEQSN----------
RPOC2_PROM3      GGFGSRLVGRLTADQVVNV-DGEILAE------RNTEIDPPLSKRFEKAA----------
RPOC2_PROMM      GGFGSRLVGRLTAEQVVNV-DGEILAE------RNTEIDPPLSKRFEKAA----------
RPOC2_SYNS3      GRFGNRLVGRLTADQVLGA-DGEVIAE------RNSEIDPPLSKRFEAAG----------
RPOC2_SYNPW      GKYGNRLVGRLTADQVVGA-DGEVLAE------RNTEIDPPLSKRFEKAA----------
RPOC2_SYNSC      GKFGSRLVGRLTAAQVVNA-DGEVLAE------RDTEIDPPLSKSFEAAG----------
RPOC2_SYNPX      GRFGNRLVGRLTASQVVSA-VGEVLAE------RDTEIDPPLSKRIEKAG----------
RPOC2_SYNS9      SKFAKRLVGRLTAAQVVSA-EGEVLAE------RDTEIDPALSSKIEKAG----------
RPOC2_PROMS      GKFGARLLGRLTAEDVLDA-EENLLVP------QNTAIDPALSGEIEKAS----------
RPOC2_PROM0      GKFGARLLGRLTAEDIFDA-EENLVVP------QNTAIDPALSGEIEKAS----------
RPOC2_PROM2      GKFGARLLGRLTAEDIFDA-EENIVVS------QNTAIDPSLSEEIEKAS----------
RPOC2_PROM9      GKFGARLLGRLTAEDILDS-EEKLIIP------QNTAIDPALSGKIETAS----------
RPOC2_PROM5      GKFGSRLIGRLSAEDVLDS-EDNLIIP------KNTAIDPSLSKTIETSL----------
RPOC2_PROMP      GKFGSRLIGRLSAEDILDS-EGNLIVP------KNTAIDPSLSKTLETSL----------
RPOC2_SYNR3      GKYKSRLVGRLLAEDVVDG-AGEVIAT------RNTEVDPPLSARIEAAG----------
RPOC2_PAUCH      GNYGTKLVGRLAAQSVVVDNENRVLVR------RNREIDLITACRIEAAD----------
RPOC2_GUITH      VSLKNRLIGRVLFETLYLPNDASVIGH------INQDLDHDITNSIIKCG----------
RPOC2_RHDSA      IPLQNRLLGRVLFETLHSPDSANVIAH------INQDLDHNTAEFIVKSG----------
RPOC2_PORPU      INLEQALAGRVLAENVFHPEKGSLIAH------TRQDISPNLAQEIVRAG----------
RPOC2_PYRYE      INLEQALSGRVLAENVFHPETNCLIAH------TNQDVSPKLAKEITKAG----------
RPOC2_GRATL      VSLHQALIGRVLAEDLFNPAGSKLVAK------LNTEISPDLANEIISLG----------
RPOC2_CYAPA      ISLKDRLVGRVLLHNLYHPKTHSLIAQ------KNESISVLLADDIIKAG----------
RPOC2_CYACA      IPLYKRLIGRILADDVKNPITPQVNIAS-----KNTLITGNLIKEFKKNN----------
RPOC2_EMIHU      SNNFLNLRGRLLAEPIFTQEGNLFAPA------NTEITETFLQTLKTLKD----------
RPOC2_PHATC      NLIYQKILGRVLSKPIHDPKTNRILVP------AGTQITPKLIEKFKEYN----------
RPOC2_THAPS      -FDTEQLIGRVLLKSVYDSKTEKLIAK------ANTQLTLDLLNLFNQKQ----------
RPOC2_TRICV      KSVYEKILGRLLNKSIYDEKTKELIAE------VNTQVTPNLIRTLKQKQ----------
RPOC2_CHLVU      LHIEQNLLGRVLLKDVILNTTTVIPKD---------TLVSSSLAKKLAAI----------
RPOC2_OSTTA      EKIESQLIGRVLFEDVVDLETGRMVGY---------KNQDISPALALKLI----------
RPOC2_BIGNA      LALKDQLYGRVLGKDIKINSLMYLKNQ---------QIDDSLSILLANHL----------
RPOC2_CHLAT      FSLEERLIGRVLAESIYSIQEKKYVAR------RNQDISANLATQIVRVK----------
RPOC2_MESVI      FSLQERLIGRVLAENIYSPKQKQYIAK------KNQDISASLSDKICEIK----------
RPOC2_NEPOL      YPLEERLLGRVLAIGAFN-QEGELISG------PDTAISQEIAVQLMDCD----------
                       : *:                                                  

RPOC2_STAPU      GHCEILVRSPLTCKSMPRACQKCYGW----DLSC----GNLVEIGAAIGIVAGQSIGEPG
RPOC2_ZYGCR      -----LVRSPITCKTTDWVCQLCYGW----GVNQ----GKMVSLGEAIGVVAGQSIGEPG
RPOC2_CHAVU      -----WVRSPLTCESTRWICQMCYGW----SIGY----RNLIEVGEAVGIIAAQSIGEPG
RPOC2_ANEMR      TAEPIRVRSPSTCKSMLWICQLCYGW----SLTN----GDLVEVGEAVGIIAGQSIGEPG
RPOC2_MARPO      KTKQIFLRSPLTCKSMNWICQLCYGW----SLSH----GNLIEMGEAVGIIAGQSIGEPG
RPOC2_PHYPA      QRKGIFIRSPLICKSMLWICQLCYGW----SLTH----GNLIELGEAVGIIAGQSIGEPG
RPOC2_ANTAG      KTPLISIRSPLTCKSMLWICQLCYGW----SLTHY---GDLVELGEAVGIIAGQSIGEPG
RPOC2_ANGEV      QVRQIYIRSPLTCKSMFCICQLCYGW----NLTY----NHLVELGEAVGIIAGQSIGEPG
RPOC2_PSINU      QKQLVYVRSPLTRKSISWVCQLCYGW----SLTH----QNLVELGEAVGIIAGQSIGEPG
RPOC2_PINKO      RPRPIYIRTPFTCKSISRICQLCYG------RST--THSHLIELGEAVGIIAGQSIGEPG
RPOC2_PINTH      RTQPIYIRTPFTCKSISRICQLCYG------RST--THSHLIELGEAVGIIAGQSIGEPG
RPOC2_CYCTA      RAQPIYIRTPSTCKSLSRICRLCYG------RSP--THGNLIELGEAVGIIAGQSIGEPG
RPOC2_CRYJA      QVQPIYIRTPFTCKSIYWICQLCYG------RNT--THSNLIELGEAVGIIAGQSIGEPG
RPOC2_AGRST      RAQPIYIRTPFTCRSTSWICQLCYG------RSP--THSDLVELGEAVGIIAGQSIGEPG
RPOC2_LOLPR      LAQPIYIRTPFTCRSTSWICQLCYG------RSP--THSDLVELGEAVGIIAGQSIGEPG
RPOC2_HORVU      RAQPIYIRTPFTCRSTSWICQLCYG------RSP--THSDLVELGEAVGIIAGQSIGEPG
RPOC2_WHEAT      RAQPIYIRTPFTCRSTSWICQLCYG------RSP--THSDLVELGEAVGIIAGQSIGEPG
RPOC2_SACHY      RAQPIYIRTPFTCRSTSWICQLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_SACOF      RAQPIYIRTPFTCRSTSWICQLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_SORBI      RAQPIYIRTPFTCRSTSWICQLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_MAIZE      RAQPIYIRTPFTCRSTSWICQLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_ORYNI      RAQPIYIRTPFTCRSTSWICQLCYG------RSS--THGDLVELGEAVGVIAGQSIGEPG
RPOC2_ORYSI      RAQPIYIRTPFTCRSTSWICQLCYG------RSS--THGDLVELGEAVGVIAGQSIGEPG
RPOC2_ORYSA      RAQPIYIRTPFTCRSTSWICQLCYG------RSS--THGDLVELGEAVGVIAGQSIGEPG
RPOC2_ORYSJ      RAQPIYIRTPFTCRSTSWICQLCYG------RSS--THGDLVELGEAVGVIAGQSIGEPG
RPOC2_DIOEL      RARPIYIRTPFTCRSTSWICQLCYG------RSP--THGDLVELGEAVGIIASQSIGEPG
RPOC2_PHAAO      QAHPIYIRTPFTCRSTSWICQLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_LEMMI      RAQPIHIRTPFTCRSTSWICQLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_ACOCL      RAQPVYIRTPFTCRSTSWICQLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_AMBTC      RAQPIYIRSPFTCRSTSWICQLCYG------RST--THGNLVELGEAVGIIAGQSIGEPG
RPOC2_NYMAL      RAQPIYIRTPFTCRSASWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_ILLOL      RAQPIYIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_CALFG      RAQPIYIRTPFLCRSTSWICRLCYG------RSP--AHGDLVELGEAVGIIAGQSIGEPG
RPOC2_LIRTU      RAQSIYIRTPFICRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_DRIGR      RAQSIYIRTPFICRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_CHLSC      RAQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_CERDE      RAQPIYIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_PIPCE      QAKSIYIRTPFICRSTSWICRLCYG------RSP--THGDLVELGEAVGVIAGQSIGEPG
RPOC2_BUXMI      RAQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_PLAOC      GAQPISIRTPFTCRSISWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_NANDO      RAQPISIRTPFTCKSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_RANMC      RSQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_SOLBU      RAQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_SOLTU      RAQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_SOLLC      RAQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_ATRBE      RAQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_NICSY      RAQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_TOBAC      RAQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_NICTO      RAQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_COFAR      RAQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_JASNU      RAQPISIRTPFTCRSASWICRFCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_CUSEX      RAEPILIRTPLTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_CUSRE      RAQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_IPOPU      RAQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_DAUCA      RAQPIYIRTPFTCRSTSWICQLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_PANGI      RAQPIYIRTPFTCRSTSWICRLCYG------RSP--THGDLAELGEAVGIIAGQSIGEPG
RPOC2_GUIAB      RAQPISIRTPFTCRSTSWICQLCYG------RSP--AHDDLVELGEAVGIIAGQSIGEPG
RPOC2_HELAN      RAQPISIRTPFTCRSTSWICQLCYG------RSP--AHDDLVELGEAVGIIAGQSIGEPG
RPOC2_LACSA      RAQPISIRTPFTCRSTSWICQLCYG------RSP--AHDDLVELGEAVGIIAGQSIGEPG
RPOC2_SILLA      RTQPIAIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_SPIOL      RTQLISIRTPFTCRSASWICRLCYG------RSP--THGGLVELGEAVGIIAGQSIGEPG
RPOC2_FAGEA      RVQTISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_SOYBN      QTQPISIRTPFTCRNTSWICRLCYG------QSP--THGHLVELGEAVGIIAGQSIGEPG
RPOC2_PHAVU      QTQPISIRTPFTCRNTSWICRLCYG------QSP--TQGHLVELGEAVGIIAGQSIGEPG
RPOC2_LOTJA      QTQPIFIRTPFTCRNTSWICRLCYG------RSP--IHGNLVELGEAVGIIAGQSIGEPG
RPOC2_PELHO      KKKPIYVRTPFTCRSTSWICRFCYG------RSPTSACGDLVELGEAVGIIAGQSIGEPG
RPOC2_OENAR      RIQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_OENPA      RIQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_OENEH      RIQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_OENGL      RIQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_OENBI      RIQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_EUCGG      RTQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_AETCO      GTQSISIRTPFTCRSTSWICRFCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_AETGR      GTQSISIRTPFTCRSTSWICRFCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_ARATH      GTQSISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_CAPBU      GTQSISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_CRUWA      GTQSISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_OLIPU      GTQSISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_BARVE      GTQSISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_NASOF      GTQSISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_LEPVR      GTQSISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_LOBMA      GTQSISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_ARAHI      GTQSISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_DRANE      GTQSISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_SINAL      GTQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_CARPA      RTQSISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_GOSBA      RTQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_GOSHI      RTQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_CITSI      RTQAISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_CUCSA      QTQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_MORIN      QTQPISIRTPFTCKSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_POPAL      RTQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_POPTR      RTQPISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_MANES      RTQTISIRTPFTCRSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_VITVI      QAQTISIRTPFTCKSTSWICRLCYG------RSP--THGDLVELGEAVGIIAGQSIGEPG
RPOC2_WELMI      LIQAISIRTPFTCKSLSWICQLCYG------RSL--SHNNLIELGEAVGIIAGQSIGEPG
RPOC2_ADICA      SSQPIHVRSPLTCKSIFWICQFCYG------WSL--AHCNLVELGEAVGIIAGQSIGEPG
RPOC2_CHAGL      QKKAILIRSPLTCKSKQWLCQYCYG------WSP--CYGDMVELGEAVGIIAGQSIGEPG
RPOC2_ACAM1      -VEEVVVRSPLTCEAARSVCQHCYGWSLAH--------AHLVDTGEAVGIIAAQSIGEPG
RPOC2_THEEB      -IEEVVVRSPLTCEATGSVCRLCYGWSLAH--------ARLVDMGEAVGIIAAQSIGEPG
RPOC2_NOSS1      -VAEVVVRSPLTCEAARSVCQHCYGWSLAH--------AKMVDLGEAVGIIAAQSIGEPG
RPOC2_TRIV2      -VAEVVVRSPLTCEAARSVCQHCYGWSLAH--------AKMVDLGEAVGIIAAQSIGEPG
RPOC2_NOSP7      -VGEVVVRSPLTCEAARSVCQHCYGWSLAH--------AKMVDLGEAVGIIAAQSIGEPG
RPOC2_SYNE7      -IKKVKVRSPLTCEAARSVCQKCYGWSLAH--------AQMVDMGEAVGIIAAQSIGEPG
RPOC2_SYNP6      -IKKVKVRSPLTCEAARSVCQKCYGWSLAH--------AQMVDMGEAVGIIAAQSIGEPG
RPOC2_TRIEI      -VENVFVRSPLTCESPRSVCQTCYGWSLAH--------GHMVDMGEAIGIIAAQSIGEPG
RPOC2_CROS5      -VESVMVRSPLTCEAARSVCRCCYGWSLAT--------GRPVDLGEAVGIIAAQSIGEPG
RPOC2_SYNY3      -TDEVYVRSPLTCEAARSVCQNCYGWSLAH--------GHKVDLGEAVGIIAAQSIGEPG
RPOC2_MICAN      -VDKIKVRSPLTCEAARSVCQTCYGWSLAH--------GHPVDMGEAVGIIAAQSIGEPG
RPOC2_SYNP2      -VAEVEVRSPLTCEAARSVCRKCYGWSLAH--------GHMVDMGEAVGIIAAQSIGEPG
RPOC2_SYNJB      -IRQVMVRSPLTCEANRSVCRMCYGWSLAH--------SRLVDLGEAVGIIAAQSIGEPG
RPOC2_SYNJA      -IRQVMVRSPLTCEANRSVCRMCYGWSLAH--------SRLVDLGEAVGIIAAQSIGEPG
RPOC2_GLOVI      -VDAVMVRSPLTCEANRSVCRMCYGWSLAH--------SHLVDIGEAVGIIAAQSIGEPG
RPOC2_PROMA      -VNGVMIRSPLTCEATRSVCRKCYGWALAH--------NQLVDLGEAVGIIAAQSIGEPG
RPOC2_PROM4      -LAGIMVRSPLTCEATRSVCRKCYGWALAH--------NNLVDLGEAVGIIAAQSIGEPG
RPOC2_PROM1      -LQGVRVRSPLTCEATRSVCRKCYGWALAH--------NQLVDLGEAVGIVAAQSIGEPG
RPOC2_PROMT      -MQGVRVRSPLTCEATRSVCRKCYGWALAH--------NQLVDLGEAVGIVAAQSIGEPG
RPOC2_PROM3      -ITEVMVRSPLTCEANRSVCRKCYGWALAH--------NELADLGEAVGIIAAQSIGEPG
RPOC2_PROMM      -ITEVMVRSPLTCEANRSVCRKCYGWALAH--------NELADLGEAVGIIAAQSIGEPG
RPOC2_SYNS3      -VSALMVRSPLTCEANRSVCRKCYGWALAH--------NQLVDLGEAVGIIAAQSIGEPG
RPOC2_SYNPW      -VQAVSVRSPLTCEANRSVCRKCYGWALAH--------NELVDLGEAVGIIAAQSIGEPG
RPOC2_SYNSC      -VKAVSVRSPLTCEANRSVCRKCYGWALAH--------NELVDLGEAVGIIAAQSIGEPG
RPOC2_SYNPX      -VTAVSVRSPLTCEANRSVCRKCYGWALAH--------NELVDLGEAVGIIAAQSIGEPG
RPOC2_SYNS9      -ITAVSIRSPLTCEANRSVCRKCYGWALAH--------NELVDLGEAVGIIAAQSIGEPG
RPOC2_PROMS      -INKVKIRSPLTCEANRSVCRRCYGWALAH--------NHLVDLGEAVGIIAAQSIGEPG
RPOC2_PROM0      -INKVKIRSPLTCEANRSVCRRCYGWALAH--------NHLVDLGEAVGIIAAQSIGEPG
RPOC2_PROM2      -INKVKIRSPLTCEANRSVCRRCYGWALAH--------NHLVDLGEAVGIIAAQSIGEPG
RPOC2_PROM9      -ITKVKIRSPLTCEANRSVCRRCYGWALAH--------NHLVDLGEAVGIIAAQSIGEPG
RPOC2_PROM5      -ISTVNIRSPLTCEANRSVCRKCYGWALAH--------NHLVDLGEAVGIIAAQSIGEPG
RPOC2_PROMP      -ISKVNIRSPLTCEANRSVCRKCYGWALAH--------NHLVDLGEAVGIIAAQSIGEPG
RPOC2_SYNR3      -IAQVQVRSPLTCEAARSVCRKCYGWALAH--------NELVDLGEAVGIIAAQSIGEPG
RPOC2_PAUCH      -IPSVIVRSPLTCEAARSVCRKCYGWALAH--------NALVDLGEAVGIIAAQSIGEPG
RPOC2_GUITH      -IKSVIVRSPLTCEAPRSVCQFCYGWNLAH--------GSLVDLGEAVGIIAAQSIGEPG
RPOC2_RHDSA      -IKSVIVRSPLTCESSRSVCQFCYGWNLAH--------GSLVDLGEAVGIIAAQSIGEPG
RPOC2_PORPU      -IKKVLVRSPVTCNSRSSVCQYCYGWNLAH--------GRLVDLGEAVGIIAAQSIGEPG
RPOC2_PYRYE      -IKKVLVRSPVTCNSRSSVCQYCYGWNLAH--------GRLVDLGEAVGIIAAQSIGEPG
RPOC2_GRATL      -ISSVLVRSPITCESIKSVCQSCYGWNLAH--------GRIVDLGEAVGIIAAQSIGEPG
RPOC2_CYAPA      -LKEVWIRSPLTCKATRSVCQYCYGWNLAH--------GRLVELGEAVGIIAAQSIGEPG
RPOC2_CYACA      -IQKIKLRSPLTCQSYRSICQKCYGASLSD--------GKLVDIGEAIGIIAAQSIGEPG
RPOC2_EMIHU      -HSPIKVRSSLTCTSTRSVCQNCYGWHLSH--------SKLVDLGEAVGIVAAQSIGEPG
RPOC2_PHATC      -VKKFYIRSPLTCNLYRAICQNCYGWDLAN--------ENLVDIGEAIGILAGQSIGEPG
RPOC2_THAPS      -ISKFYIRSPLTCNLYHSICQMCYGWDLSN--------QNLVDLGEAVGILAGQSIGEPG
RPOC2_TRICV      -IKHFYVRSPLTCSLYRSICQKCYGWDLAN--------ENLIDIGERIGIIAGQSIGEPG
RPOC2_CHLVU      -NQKIFVRSPLTCQTEKTVCQLCYGLDLAQ--------GKLVCFGEAVGIIAAQSIGEPG
RPOC2_OSTTA      -KQPALTIRSPLTCRFHAVCQLCYGWNLAQ--------QKLVQLGEAVGVLAAQSIGEPG
RPOC2_BIGNA      -KRVFIRSPLTCKASNSTLCQLCYGWNLSH--------SKLISLGEIVGVIAAQSIGEPG
RPOC2_CHLAT      -KNNIFVRSPLTCKANRSVCQLCYGWSLAH--------GSLVDLGEAVGIIAAQSIGEPG
RPOC2_MESVI      -RTNILVRSPLTCKSIRSVCQLCYGWSLAH--------GNLVDLGEAVGIIAAQSIGEPG
RPOC2_NEPOL      -PKEILVRSVLLCKSKRGLCRLCYGWNLGT--------GTIVSIGEAVGIIAAQSIGEPG
                                    *: ***                   *  :*::*.*******

RPOC2_STAPU      TQLTLRTFHTGGV--FTGGVAEHVRAPFNGIVHFSISSSTHKTKTIQPTRNRHGRPAWTC
RPOC2_ZYGCR      TQLTLRTFHTGGV--FTGDIANHLRAPFNGIAHF-------ETHNCKPTRNRHGRLVWKC
RPOC2_CHAVU      TQLTLRTFHTGGV--FTGDIAQQIRSPLNGIIQLN-------NSKIRSIRNRYGQPAFVC
RPOC2_ANEMR      TQLTLRTFHTGGV--FTGDIAEHVRTPSDG--VIEFD-----GRFVYPTRTRHGHPAWIC
RPOC2_MARPO      TQLTLRTFHTGGV--FTGDIAEHVRTPFNG--IIEFN-----ENFVYPTRTRHGHPAWMC
RPOC2_PHYPA      TQLTLRTFHTGGV--FTGDIAEHIRTPFNG--IIQFD-----TNSVYPTRTRHGHPAWIC
RPOC2_ANTAG      TQLTLRTFHTGGV--FTGDIAEHVRTPFNG--TIEFD-----TDLVYPTRTRHGHPAWVC
RPOC2_ANGEV      TQLTLRTFHTGGV--FTGDIAEHIRTPFNG--IIKFD-----EDLVYATRTRHGHPAWLC
RPOC2_PSINU      TQLTLRTFHTGGV--FTGDIAEHIRIPFNG--IISFA-----EDSVHPIRTRHGHPAWIC
RPOC2_PINKO      TQLTLRTFHTGGV--FTGDIAEHIRAPFNG--KIEFN-----ENLVYPTRTRNGHPAYLC
RPOC2_PINTH      TQLTLRTFHTGGV--FTGDIAEHIRAPFNG--KIEFN-----ENLVYPTRTRNGHPAYLC
RPOC2_CYCTA      TQLTLRTFHTGGI--FTGDIAEHVRAPFNG--KIEFD-----ENLVYPTRTRHGHPAFMC
RPOC2_CRYJA      TQLTLRTFHTGGV--FTGDIAEHVRAPFTG--KIEFN-----ENLVYPTRTRHGHPAYIC
RPOC2_AGRST      TQLTLRTFHTGGV--FTGGTADLVRSPSNG--KIQFT-----ENLVHPTRTRHGQPAFLC
RPOC2_LOLPR      TQLTLRTFHTGGV--FTGGTADLVRSPSNG--KIQFT-----ENLVHPTRTRHGQPAFLC
RPOC2_HORVU      TQLTLRTFHTGGV--FTGGTADLVRSPSNG--KIQFN-----ENLVHPTRTRHGQPAFLC
RPOC2_WHEAT      TQLTLRTFHTGGV--FTGGTADLVRSPSNG--KIKFN-----ENLVHPTRTRHGQPAFLC
RPOC2_SACHY      TQLTLRTFHTGGV--FTGGTADLIRSPSNG--KIQFN-----EDLVHPTRTRHGQPAFLC
RPOC2_SACOF      TQLTLRTFHTGGV--FTGGTADLIRSPSNG--KIQFN-----EDLVHPTRTRHGQPAFLC
RPOC2_SORBI      TQLTLRTFHTGGV--FTGGTADLIRSPSNG--KIQFN-----EDLVHPTRTRHGQPAFLC
RPOC2_MAIZE      TQLTLRTFHTGGV--FTGGTADLIRSPSNG--KIQFN-----EDLVHPTRTRHGQPAFLC
RPOC2_ORYNI      TQLTLRTFHTGGV--FTGGTADLVRSPSNG--KIQFN-----GDLVHPTRTRHGQPAFLC
RPOC2_ORYSI      TQLTLRTFHTGGV--FTGGTADLVRSPSNG--KIQFN-----GDLVHPTRTRHGQPAFLC
RPOC2_ORYSA      TQLTLRTFHTGGV--FTGGTADLVRSPSNG--KIQFN-----GDLVHPTRTRHGQPAFLC
RPOC2_ORYSJ      TQLTLRTFHTGGV--FTGGTADLVRSPSNG--KIQFN-----GDLVHPTRTRHGQPAFLC
RPOC2_DIOEL      TQLTLRTFHTGGV--FTGGTAEHVRAPSSG--KIKFN-----EDLVHRTRTRHGHPAFLC
RPOC2_PHAAO      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFD-----EGLVHPTRTRHGHPAFLC
RPOC2_LEMMI      TQLTLRTFHTGGV--FTGGTAEHVRAPFNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_ACOCL      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EELVHPTRTRHGHPAFLC
RPOC2_AMBTC      TQLTLRTFHTGGV--FTGGIAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_NYMAL      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_ILLOL      TQLTLRTFHTGGV--FTGGTAEHVRAPFNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_CALFG      TQLTLRTFHTGGV--FTGGTAEHVRAPFNG--KIQFN-----EDLVHPTRTRHGHPAFLC
RPOC2_LIRTU      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----ECLVHPTRTRHGHPAFLC
RPOC2_DRIGR      TQLTLRTFHTGGV--FTGGTAEHVRAPFNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_CHLSC      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_CERDE      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_PIPCE      TQLTLRTFHTGGV--FTGGTAEYVRAPSNG--KIKFH-----EDLVHPTRTRHGHPAFLC
RPOC2_BUXMI      TQLTLRTFHTGGV--FTGGTAEHVRAPFNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_PLAOC      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_NANDO      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFK-----EDLVHPTRTRHGHPAFLC
RPOC2_RANMC      TQLTLRTFHTGGV--FTGGTAEHVRAPDNG--KIKFN-----EGLVYPTRTRHGYPAFLC
RPOC2_SOLBU      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_SOLTU      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_SOLLC      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_ATRBE      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_NICSY      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_TOBAC      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_NICTO      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_COFAR      TQLTLRTFHTGGV--FAGGIAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_JASNU      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_CUSEX      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIRLN-----EDLVHPTRTRHGYPAFFC
RPOC2_CUSRE      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIRFT-----EDLVHPTRTRHGYPAFFC
RPOC2_IPOPU      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIRFH-----EDLVHPTRTRHGHPAFLC
RPOC2_DAUCA      TQLTLRTFHTGGV--FTGGIAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFVC
RPOC2_PANGI      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_GUIAB      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_HELAN      TQLTLRTFHTGGV--FTGGTAEHVRAPFNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_LACSA      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_SILLA      TQLTLRTFHTGGV--FTGGTAEHVRAPYNG--KIKFN-----EGLVHPTRTRHGHPAFLC
RPOC2_SPIOL      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIQFN-----EDLVHPTRTRHGHPAFLC
RPOC2_FAGEA      TQLTLRTFHTGGV--FTGGTAVHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_SOYBN      TQLTLRTFHTGGV--FTGGTAEQVRAPYNG--KIQFN-----EDLVHPTRTRHGHPAFLC
RPOC2_PHAVU      TQLTLRTFHTGGV--FTGGTAEQVRAPYNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_LOTJA      TQLTLRTFHTGGV--FTGGTAEYVRSPSNG--KIKFN-----ENSAYPTRTRHGHPAFLC
RPOC2_PELHO      TQLTLRTFHTGGV--FTGGTAEQVRAPFNG--KIKFN-----EDLVHPTRTRHGQPAFLC
RPOC2_OENAR      TQLTLRTFHTGGV--FTGGTAEHVRAPSNGKIKFNFN-----EALVHPARTRHGHPALLC
RPOC2_OENPA      TQLTLRTFHTGGV--FTGGTAEHVRAPSNGKIKFNFN-----EALVHPARTRHGHPALLC
RPOC2_OENEH      TQLTLRTFHTGGV--FTGGTAEHVRAPSNGKIKFNFN-----EALVHPARTRHGHPALLC
RPOC2_OENGL      TQLTLRTFHTGGV--FTGGTAEHVRAPSNGKIKFNFN-----EALVHPARTRHGHPALLC
RPOC2_OENBI      TQLTLRTFHTGGV--FTGGTAEHVRAPSNGKIKFNFN-----EALVHPARTRHGHPALLC
RPOC2_EUCGG      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----DDLVHPTRTRHGHPAFLC
RPOC2_AETCO      TQLTLRTFHTGGV--FTGGTAEHVRAPYNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_AETGR      TQLTLRTFHTGGV--FTGGTAEHVRAPYNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_ARATH      TQLTLRTFHTGGV--FTGGTAEHVRAPYNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_CAPBU      TQLTLRTFHTGGV--FTGGTAEHVRAPYNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_CRUWA      TQLTLRTFHTGGV--FTGGTAEHVRAPYNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_OLIPU      TQLTLRTFHTGGV--FTGGTAEHVRAPYSG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_BARVE      TQLTLRTFHTGGV--FTGGTAEHVRAPYNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_NASOF      TQLTLRTFHTGGV--FTGGTAEHVRAPYNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_LEPVR      TQLTLRTFHTGGV--FTGGTAEHVRAPYNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_LOBMA      TQLTLRTFHTGGV--FTGGTAEHVRAPYNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_ARAHI      TQLTLRTFHTGGV--FTGGTAEHVRAPYNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_DRANE      TQLTLRTFHTGGV--FTGGTAEHVRAPYNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_SINAL      TQLTLRTFHTGGV--FTGGTAEHVRAPYNG--KIKFN-----EDLVHSTRTRHGHPAFLC
RPOC2_CARPA      TQLTLRTFHTGGV--FTGGTAEHVRSPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_GOSBA      TQLTLRTFHTGGV--FTGGTAEHVRAPFNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_GOSHI      TQLTLRTFHTGGV--FTGGTAEHVRAPFNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_CITSI      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_CUCSA      TQLTLRTFHTGGV--FTGGTAEHIRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_MORIN      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EDLVHPTRTRHGHPAFLC
RPOC2_POPAL      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----KGLVHPTRTRHGHPAFLC
RPOC2_POPTR      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----KGLVHPTRTRHGHPAFLC
RPOC2_MANES      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EDLVHPIRTRHGHPAFLC
RPOC2_VITVI      TQLTLRTFHTGGV--FTGGTAEHVRAPSNG--KIKFN-----EDWVHPTRTRHGHPAFLC
RPOC2_WELMI      TQLTLRTFHTGGV--FTGNIVGTIRAPFNG--RIQFN-----SNLVYSTRTFFGHPAFIC
RPOC2_ADICA      TQLTLRTFHTGGV--FTGDIAEYVRIPFNG--LIKFD-----ERLLHPTRTRHGHPAWMC
RPOC2_CHAGL      TQLTLRTFHTGGV--FTGDIAEHVRAPFNG--IAFFS-----ETNLQATRSRHGHPAWIS
RPOC2_ACAM1      TQLTMRTFHTGGV--FTGEVARQIRAPFNG--KIKFPK----KMRSRPFRTRHGEDALTA
RPOC2_THEEB      TQLTMRTFHTGGV--FTGEVARQERAPFAG--TVEYGK----KLRVRPYRTRHGDDAFIV
RPOC2_NOSS1      TQLTMRTFHTGGV--FTGEVAQQVRSKMDG--TIKLPR----KLRTRTHRTRHGEDALFV
RPOC2_TRIV2      TQLTMRTFHTGGV--FTGEVAQQVRSKMDG--TIKLPR----KLRTRTHRTRHGEDALFV
RPOC2_NOSP7      TQLTMRTFHTGGV--FTGEVAQQVRSKIDG--TVKLPR----KLKTRTYRTRHGEDALYV
RPOC2_SYNE7      TQLTMRTFHTGGV--FTGETARLLRAPVAG--TIKLGK----KARTRPYRTRHGEEALLA
RPOC2_SYNP6      TQLTMRTFHTGGV--FTGETARLLRAPVAG--TIKLGK----KARTRPYRTRHGEEALLA
RPOC2_TRIEI      TQLTMRTFHTGGV--FTGEVARQFVASFGG--VVKYPS----NVRTRSFRTRHGDEAMIA
RPOC2_CROS5      TQLTMRTFHTGGV--FTGEVAEQIKAPDHG--TVKWGK----GLSTRKVRTRHGEDAFQV
RPOC2_SYNY3      TQLTMRTFHTGGV--FTGEVARQEKAPEDG--TVKWGK----GLSTRKVRTRHGEDAEQV
RPOC2_MICAN      TQLTMRTFHTGGV--FTGEVARQVRSPFEG--TVRFLP----GLSIRNVRTRHGDERDQV
RPOC2_SYNP2      TQLTMRTFHTGGV--FTKEAARTIKASKAG--TIQFKD----GLSTRRMRTPHGDEVEQV
RPOC2_SYNJB      TQLTMRTFHTGGV--FTGEVARQIRAPFAG--VVRFPK----NLRTRPFRTRHGDDALQV
RPOC2_SYNJA      TQLTMRTFHTGGV--FTGEVARQIRAPFAG--VVRFPK----NLRTRPFRTRHGDDALQL
RPOC2_GLOVI      TQLTMRTFHTGGV--FTGEVAKPLKAPFDG--KIKFSS----ALKARPMRTRHGDDAYQA
RPOC2_PROMA      TQLTMRTFHTGGV--STAETGV-VRSNLAG--KVEFGP----KARVRGYRTPHGVEAQQA
RPOC2_PROM4      TQLTMRTFHTGGV--STAETGV-VRSTIAG--KVEFGP----NARVRGYRTPHGVEAQQA
RPOC2_PROM1      TQLTMRTFHTGGV--STAETGV-VRSTLSG--KVEFGS----KARVRGYRTPHGVEAQQA
RPOC2_PROMT      TQLTMRTFHTGGV--STAETGV-VRSTLSG--KVEFGS----KARVRGYRTPHGVEAQQA
RPOC2_PROM3      TQLTMRTFHTGGV--STAETGV-VRSTVAG--TVEFGP----KARVRGYRTPHGLEAQQS
RPOC2_PROMM      TQLTMRTFHTGGV--STAETGV-VRSTVAG--TVEFGP----KARVRGYRTPHGLEAQQS
RPOC2_SYNS3      TQLTMRTFHTGGV--STAESGV-VRSKFEG--TVEFGS----KAKVRPYRTPHGVNAQQS
RPOC2_SYNPW      TQLTMRTFHTGGV--STAETGV-VRSKLEG--TVEFGA----KARVRPYRTPHGVNAQQA
RPOC2_SYNSC      TQLTMRTFHTGGV--STAETGV-VRSKVAG--TVEFGS----KARVRPYRTPHGVNAQQA
RPOC2_SYNPX      TQLTMRTFHTGGV--STAETGV-VRSVVAG--TIEFSA----KARVRPYRTPHGVNAQQA
RPOC2_SYNS9      TQLTMRTFHTGGV--STAESGV-VRSKVAG--DVEFGS----KARVRPYRTPHGVEAQQA
RPOC2_PROMS      TQLTMRTFHTGGV--STAESGV-VRSKISG--KVEFSS----KAKIRGYRTPHGVEAKQA
RPOC2_PROM0      TQLTMRTFHTGGV--STAESGV-VRSKITG--KVEFSS----KAKVRGYRTPHGVEAKQA
RPOC2_PROM2      TQLTMRTFHTGGV--STAESGV-VRSRISG--KVEFSS----KAKVRGYRTPHGVEAKQA
RPOC2_PROM9      TQLTMRTFHTGGV--STAESGV-VRSKISG--RVEFSS----KAKVRGYRTPHGVEAKQA
RPOC2_PROM5      TQLTMRTFHTGGV--STAESGV-VRSKIKG--KVEFSS----KAKIRGYRTPHGVEAKQA
RPOC2_PROMP      TQLTMRTFHTGGV--STAESGV-VRSKIKG--KVEFGS----KAKIRGYRTPHGVEAKQA
RPOC2_SYNR3      TQLTMRTFHTGGV--STAETGV-VRSVVEG--SVEFSA----KAKVRPHRTPHGVEAQLA
RPOC2_PAUCH      TQLTMRTFHTGGV--STAETGL-VRSTLEG--SIIFGS----KARVRPYRTPHGVEAQQA
RPOC2_GUITH      TQLTMRTFHTGGV--FTGELAEQIRAPFNG--IIRYPK----NLKIRIIRTRHGNEGVIL
RPOC2_RHDSA      TQLTMRTFHTGGV--FTGELAEQIRAPFDG--VLRIPK----SFRTRLIRTRHGEEAFVL
RPOC2_PORPU      TQLAMRTFHTGGV--FTGELAEQIYSPIDG--KLTNLD----FLSYMEVRTRHGEQALMT
RPOC2_PYRYE      TQLTMRTFHTGGV--FTGELAEQIYAPIDG--QLIDLD----IESYTDVRTRHGEQALIT
RPOC2_GRATL      TQLTMRTFHTGGV--FTGELAQTVISSSDC--QVEYPS----NIILSDTRTRHGDHAFLV
RPOC2_CYAPA      TQLTMRTFHTGGV--FTAEVAKQITAPFPG--RIYYPL----NTTFREIRTRYGDNAWWV
RPOC2_CYACA      TQLTMRTFHTGGV--FTAEFSKPIKTLFEG--VIKYPS----NLKFHHVRTRHGDDAIII
RPOC2_EMIHU      TQLTMRTFHTGGV--FSGDLTRQVRSPMEG--KIEYWE----GHKASLFRTMHGKMGFRL
RPOC2_PHATC      TQLTMRTFHTGGI--FTSEARQQITTPING--VIRFYK----TLKTVLLRTNRGEDVLIT
RPOC2_THAPS      TQLTMRTFHTGGI--FTSEARQQIISPKNG--IIKFSK----ILKTIILRTNRGEDVLLT
RPOC2_TRICV      TQLTMRTFHTGGI--FTSEIRGTIRSPISG--IVKFSK----RLKRIPIRTNRGEDVLLT
RPOC2_CHLVU      TQLTMRTFHTGGVGVFSEQAMKSFPAPFDG--KIEFQE----ALPGRFVRTPYGKIVYLL
RPOC2_OSTTA      TQLTMRTFHTGGV--FAGEATEKVYSPHNG--IVFYSK----QARGRKIVSKYGEVAFLT
RPOC2_BIGNA      TQLTMRTFHTGGV--FSGNVKSQLYSPFDG--IVEYSS----SLYGDIVNLYNGNFAFLV
RPOC2_CHLAT      TQLTMRTFHTGGV--FTGNVAKQIRSPIDG--IVHFPTI--LQNQMTTTRTRHGEEALLT
RPOC2_MESVI      TQLTMRTFHTGGV--FTGNIAKQIRSSIDG--KIIYS-----LTNTIPMRTRHGEIALIT
RPOC2_NEPOL      TQLTMRTFHTGGV--FAGGVTNEIRAPHAG--LVHYPR----PIHPKWVRTRHGQFGILI
                 ***::*******:   :                                    *      

RPOC2_STAPU      PEAFSVIIED-------------RIGKKKVLNVPQYSLLLVKNHQYVQSRQIIAEVRASI
RPOC2_ZYGCR      LQDLTITVIG-------------Q-GKKHSLNVPSQSLLLINNNQYVESKQVIAEVRASI
RPOC2_CHAVU      LDNIHIKVKG-------------K--DTYQSIIPTESLLFVKNNQKVQAKQVIAEIRSTI
RPOC2_ANEMR      HTSLFLSIR--------------GRNKRHNLLIPAKSLLLIRNNQYVESEQVIAEIRTKA
RPOC2_MARPO      HTNLFLVIK--------------SKNKVHNLTIPPKSLLLVQNNQYVESKQVIAEIRAKT
RPOC2_PHYPA      NNNLSVVIK--------------SKKKLHNLVIPTQSLLLVQSNQYVESKQVIAEVRAKT
RPOC2_ANTAG      RTDLAVTIK--------------SQNKIHNLIIPSQSLLLIQNNQYVESKQLIAEVHAKV
RPOC2_ANGEV      QDNLPVSIE--------------SKEKIHNFIVPAQSLLLVQNNQYVGSKQVIGQIRTTK
RPOC2_PSINU      QDNLSVSVK--------------NKNRIHNVIIPYQSLILVQNNQYVESKQVIAEVRINQ
RPOC2_PINKO      HNNLSITID--------------GQNQVQNLTIPPQSLLLVQNDQYVESEQIIAEVRART
RPOC2_PINTH      HNNLSITID--------------GQDQVQNLTIPPQSLLLVQNDQYVESEQLIAEVRART
RPOC2_CYCTA      HNNLSITLD--------------GQDQVHDLTISPQSLLLVQNNQYVESEQIIAEVHART
RPOC2_CRYJA      YNSLDVTIN--------------NQYEVQNLTIPPESLLFIQNNQLVESEQVIAEVRAKR
RPOC2_AGRST      YIDLHVTIQ--------------SQDILYSVSIPSKSLILVQNDQYVKSEQVIAEIRSGT
RPOC2_LOLPR      YIDLHVTIQ--------------SQDILYSVNIPSKSLILVQNDQYVKSEQVIAEIRAGT
RPOC2_HORVU      YIDLHVTIQ--------------SQDILYSVNIPSKSLILVQNDQYVKSEQVIAEIRAGT
RPOC2_WHEAT      YIDLHVTIQ--------------SQDILYSVNIPSKSLILVQNDQYVKSEQVIAEIRAGT
RPOC2_SACHY      YIDLHVTIQ--------------SQDILHSVNIPLKSLILVQNDQYVESEQVIAEIRAGM
RPOC2_SACOF      YIDLHVTIQ--------------SQDILHSVNIPLKSLILVQNDQYVESEQVIAEIRAGM
RPOC2_SORBI      YIDLHVTIQ--------------SQDILHSVNIPLKSLILVQNDQYVESEQVIAEIRAGT
RPOC2_MAIZE      YIDLHVTIQ--------------SQDILHSVNIPLKSLILVQNDQYVESEQVIAEIRAGT
RPOC2_ORYNI      YIDLHITIQ--------------SQDILHSVTIPSKSLILVQNDQYVESEQVIAEIRAGT
RPOC2_ORYSI      YIDLHITIQ--------------SQDILHSVTIPSKSLILVQNDQYVESEQVIAEIRAGT
RPOC2_ORYSA      YIDLHITIQ--------------SQDILHSVTIPSKSLILVQNDQYVESEQVIAEIRAGT
RPOC2_ORYSJ      YIDLHITIQ--------------SQDILHSVTIPSKSLILVQNDQYVESEQVIAEIRAGT
RPOC2_DIOEL      SIGLYVTLE--------------GRDIIHNLNIPPKGLILVQNGQYVESEQLIAEIRAGA
RPOC2_PHAAO      FIDFYVTIE--------------SRDIRHNVNIPTKSLILVQNDQYVESEQVIAEIRAET
RPOC2_LEMMI      SIDLYVTIE--------------SQDIIHNVNIPPKSLILVQNDQYVESEQVIAEIRAGA
RPOC2_ACOCL      SIDLYVTVE--------------GRDIIHNVNIPPKSLILVQNDQYVESEQVIAEIRAGT
RPOC2_AMBTC      HIDLHVTIE--------------SQDIIHKVNIPPKSFLLVQNDQYVESEQVIAEIRAGT
RPOC2_NYMAL      YVDLYVTIE--------------SQDIIHSVNIPPKSFLLVQNDQYVESEQVIAEIRAGT
RPOC2_ILLOL      YIDLYVTIE--------------SQDILHNVNIPPKSFILVQNDQYVESEQVIAEIRART
RPOC2_CALFG      YTDLYVTIE--------------SHDILHNVNIPQKSFLLVQNDQYVESEQVIAEIRAGT
RPOC2_LIRTU      YIDLYVTIE--------------SQDIIHNVNIPPKSFLLVQNDQYVESEQVIAEIRAGT
RPOC2_DRIGR      YIDLYVTIE--------------SQDILHNVNIPPKSFLLVQNDQYVESEQVIAEIRART
RPOC2_CHLSC      YIDLYVTIE--------------NQDIIHNVNIPPKSFLLVQNDQYVESEQVIAEIRAGA
RPOC2_CERDE      YIDLYVTIE--------------SQSIIHNVNIPPKSLILVQNDQYVESEQVIAEIRTGA
RPOC2_PIPCE      YIDLYVTIE--------------SRDILHKVNIPPKSFILVQNNQYVESEQVIAEIRAGT
RPOC2_BUXMI      YIDLYVTIE--------------SQDIIHNVNIPQKSFLLVQNNQYVESEQVIAEIRAET
RPOC2_PLAOC      YIDLYVTIE--------------SQDIIHNVNIPPKSFLLVQNDQYVESEQVIAEIRAGT
RPOC2_NANDO      YIDLYVTIE--------------GQDIRHNVTIPPKSFLLVQNDQYVESEQVIAEIRAGT
RPOC2_RANMC      YIDLSVTIE--------------GPDILHNVNIPPKSFILVKNDQYVESEQVIAEIRAEA
RPOC2_SOLBU      SIDLYVTIE--------------SEDILHNVNIPPKSLLLVQNDQYVESEQVIAEIRAGI
RPOC2_SOLTU      SIDLYVTIE--------------SEDILHNVNIPPKSLLLVQNDQYVESEQVIAEIRAGI
RPOC2_SOLLC      SIDLYVTIE--------------SEDILHNVNIPPKSLLLVQNDQYVESEQVIAEIRAGI
RPOC2_ATRBE      SIDLYVTIE--------------SEDILHNVNIPPKSLLLVQNDQYVESEQVIAEIRAGI
RPOC2_NICSY      SIDLYVTIE--------------SEDILHNVNIPPKSLLLVQNDQYVESEQVIAEIRAGI
RPOC2_TOBAC      SIDLYVTIE--------------SEDILHNVNIPPKSLLLVQNDQYVESEQVIAEIRAGI
RPOC2_NICTO      SIDLYVTIE--------------SEDILHNVNIPPKSLLLVQNDQYVESEQVIAEIRAGI
RPOC2_COFAR      FIDLYVTIK--------------SENILHNVNIPPKSFLLVQNDQYVEAEQVIAEIRAGT
RPOC2_JASNU      SIDLYVTIE--------------SEDILHNVNIPPKSFLLVQNDQYVESEQVIAEICVGT
RPOC2_CUSEX      SIYLYVTIE--------------SQDILHHVKIPPKSFILVQNDQYVESEQVIAESRAGT
RPOC2_CUSRE      SIYLYVTIQ--------------SQDILHHVKIPPKSFILVQNDQYVESEQVIAETRAGA
RPOC2_IPOPU      SIDLYVTIE--------------SEDILHNVNIPPKSFLLVQNDQYVESEQVIAEIRAGT
RPOC2_DAUCA      SIDLYVTIE--------------SEDILHNVNIPPKSFLLVQNDQYVESEQVIAEIRAGT
RPOC2_PANGI      SIDLYVTIE--------------SEDIIHNVNIPPKSFLLVQNDQYVESEQVIAEIRAGT
RPOC2_GUIAB      SRDLYVTIE--------------SEDIIHNVCIPPKSFLLVQNDQYVESEQVIAEIRART
RPOC2_HELAN      SRDLYVTIE--------------SEDIIHNVCIPPKSFLLVQNDQYVESEQVIAEIRART
RPOC2_LACSA      SRDLYVTIE--------------SEDIIHNVCIPPKSFLLVQNDQYVESEQVIAEIRART
RPOC2_SILLA      YIDLYVTIE--------------SEDSLHNVNIPPKSFLLVQNDQYVESEQVIAEIRAGA
RPOC2_SPIOL      YIDLYVTIE--------------SDDILHNVNIPPKSFLLVQNDQYVESEQVIAEIRAGT
RPOC2_FAGEA      YIDLAVTIE--------------SEDIIHNVNIPPKSFLLVQKDQYVESEQVIAEIRAGT
RPOC2_SOYBN      YIDLYVTIE--------------SGDIIHNVTIPPKSFLLVQNNQYVKSEQVIAEIRAGT
RPOC2_PHAVU      YIDLYVSIE--------------NGDIIHNVTIPPKSFLLVQNNQYVKSEQVIAEILAGT
RPOC2_LOTJA      YIDLYVTIE--------------SNDIMHNVIIPPKSFLLVQNDQYVKSEQIIAEIRAGT
RPOC2_PELHO      YIDLYLTIE--------------SEDIIHSVPIPPKSFLLVQNDQYVESEQVIAEISAGT
RPOC2_OENAR      SMDLDVTIE--------------SEDILHNLTIPPKSFLLVQNNQYVESEQVIAEICAGT
RPOC2_OENPA      SMDLDVTIE--------------SEDILHNLTIPPKSFLLVQNNQYVESEQVIAEICAGT
RPOC2_OENEH      SMDLDVTIE--------------SEDILHNLTIPPKSFLLVQNNQYVESEQVIAEICAGT
RPOC2_OENGL      SMDLDVTIE--------------SEDILHNLTIPPKSFLLVQNNQYVESEQVIAEICAGT
RPOC2_OENBI      SMDLDVTIE--------------SEDILHNLTIPPKSFLLVQNNQYVESEQVIAEICAGT
RPOC2_EUCGG      SIDLYVTIE--------------SEDILHNVTIPPKSFLLVQNNQYVESEQVIAEIRAGT
RPOC2_AETCO      YIDLSVIIE--------------SEDIIHSVTIPPKSFLLVQNDQYVESEQVIAEIREGT
RPOC2_AETGR      YIDLSVIIE--------------SEDIIHSVTIPPKSFLLVQNDQYVESEQVIAEIREGT
RPOC2_ARATH      YIDLSVIIE--------------SEDIIHSVTIPPKSFLLVQNDQYVESEQVIAEIREGT
RPOC2_CAPBU      YIDLSVIIE--------------SEDIIHSVTIPPKSFLLVQNDQYVESEQVIAEIREGT
RPOC2_CRUWA      YIDLSVIIE--------------SEDIIHSVTIPPKSFILVQNDQYVESEQVIAEIREGT
RPOC2_OLIPU      YIDLSVIIE--------------SEDIIHSVTIPPKSFLLVQNDQYVESEQVIAEIREGT
RPOC2_BARVE      YIDLSVIIE--------------SEDIIHSVTIPPKSFLLVQNDQYVESEQVIAEIREGT
RPOC2_NASOF      YIDLSVIIE--------------SEDIIHSVTIPPKSFLLVQNDQYVESEQVIAEIREGT
RPOC2_LEPVR      YMDLSVIIE--------------SEDIIHSVTIPPKSFLLVQNDQYVESEQVIAEIREGT
RPOC2_LOBMA      YIDLSVIIE--------------SEDIIHSVTIPPKSFLLVQNDQYVESEQVIAEIREGT
RPOC2_ARAHI      YRDLSVIIE--------------SEDIIHSVTIPPKSFLLVQNDQYVDSEQVIAEIREGT
RPOC2_DRANE      YIDLSVIIE--------------SDDIIHNVTIPPKSFLLVQNDQYVESEQVIAEIREGA
RPOC2_SINAL      YIDLSVIIE--------------SEDIIHSVTIPPKSFLLVQNDQYVESEQVIAEIREGT
RPOC2_CARPA      YIDLSVVIE--------------SEDIIHNVTIPPKSFLLVQNDQYVESEQVIAEIRAGT
RPOC2_GOSBA      YRDLYVIIE--------------SEDIIHKVTIPPKSFLLVQNDQYVESEQVIAEIRAGT
RPOC2_GOSHI      YRDLYVIIE--------------SEDIIHKVAIPPKSFLLVQNDQYVESEQVIAEIRAGT
RPOC2_CITSI      SIDLDVIIE--------------GEDIMHNVTIPPKSFLLVQNDQYVESEQVIAEIRAGA
RPOC2_CUCSA      YIDLYVTIE--------------SEDIIHNVTIPPKSLLLVQNDQYVESEQVIAEIRAGT
RPOC2_MORIN      SIDLYVTIE--------------SEDIIHNVTIPPKSFILVQNDQYVESEQVIAEIRAGT
RPOC2_POPAL      SMDLYVTIE--------------SQDIIHNVTIPPKSFLLVQNDQYVESEQVIAEIRSGT
RPOC2_POPTR      SMDLYVTIE--------------SQDIIHNVTIPPKSFLLVQNDQYVESEQVIAEIRSGT
RPOC2_MANES      YIDLYVTIK--------------SQDIIHNVTIPPKSFLLVQNDQYVESEQVIAEIRAGA
RPOC2_VITVI      YIDLYVTIE--------------SEGIIHNVNIPPKSFLLVQNDQYVESEQVIAEIRAGT
RPOC2_WELMI      RKKLFIIIDD-------------GGDKVDYSLLPTKSWVFVQNHQYVESEQLIGEFRTTT
RPOC2_ADICA      RNDLPLFIG--------------NSVGTQNSLIPAQSLLMIRTGQYVESQQVIAEVRAKE
RPOC2_CHAGL      KEDIKITIQ--------------YEEIEHKLNIPANSLILIKTNQYVKSKQVLAEVRAKI
RPOC2_ACAM1      EVSTSLTLEGDD--------------QTETFEITQNSTLLVKDGQAVKMGQMLAEVAAAG
RPOC2_THEEB      ETAGKLVVKGGQ--------------QRQEFDLSQGSIVLVADGETVAAGQLLAEVAQAA
RPOC2_NOSS1      ESNGIMILEPRKEGSE--------TPAPQEIHVTQGSTIYIVDGQQVKKGQLLAEVALGG
RPOC2_TRIV2      ESNGIMILEPRKEGSE--------TPAPQEIHVTQGSTIYIVDGQQVKQGQLLAEVALGG
RPOC2_NOSP7      EANGIMLLEPTKVGDV--------TPENQEVHLTQGSTLYVFDGNKVKQGQLLAEVALGG
RPOC2_SYNE7      EANFDLVLEGKG--------------RKETFAILQGSTIFVQDGDKVAAEAILAEVPVSG
RPOC2_SYNP6      EANFDLVLEGKG--------------RKETFAILQGSTIFVQDGDKVAAEAILAEVPVSG
RPOC2_TRIEI      ENNFDMIILGVD-------------GRKETIPIAQGSILMVQNNQQVSAGIVLAEVPKVG
RPOC2_CROS5      ELAGDLIWTPTGS------------GKKMTYSVTPGSVLFAADGDTVEKDKMLAEVTA-A
RPOC2_SYNY3      EIAGDLIWKGEGKK-----------AATQTYSLTPGSLLFVQDGQTVTAGQLMTEISL-S
RPOC2_MICAN      EAPGEIKLTPKDKT-----------KETVTYSLTPGSLLFVTDGETVSEEQLLAEITS-D
RPOC2_SYNP2      EVAGTLVLKPSDN------------GKMVSHALSPGSFVLVAEGASVKKGDLLVEVGAGQ
RPOC2_SYNJB      EVNNQIILEGPD-------------GQRESFDMTQGSTLLVRDGAQVQRDQLIAEVSLA-
RPOC2_SYNJA      EANNQIVLEGPD-------------GQREVFDMTQGSTLLVRDGAQVQRDQLIAEVTVA-
RPOC2_GLOVI      DQAGTMSLEGSD-------------GKKETVTITPGSLLLVRDGQRIEAGTMYAELALVG
RPOC2_PROMA      EVDFLLHIKPTE------------KGKGQKVEISSGSLIFVEDGQEVDADVTLAQIAAG-
RPOC2_PROM4      EVDFTLKVKPTG------------SGKTQTIEISNGSLIFVDNAQEIAADVTVAQITAG-
RPOC2_PROM1      EVDFNLSIVPTS------------GSKPQKIDIPIGSLLFVDNGQNIDIDVTVAQIASG-
RPOC2_PROMT      EVDFNLSIVPTS------------GGKPQKIDIPIGSLLFVDNGQNIDIDVTVAQIASG-
RPOC2_PROM3      EVDFTLTVKPSG------------KGRAQRIDITTGSLLFVSDGQEIEADVTVVQIASV-
RPOC2_PROMM      EVDFTLTVKPSG------------KGRAQRIDITTGSLLFVSDGQEIEADVTVVQIAAV-
RPOC2_SYNS3      DVDFSLTIKPSG------------SGKPQKIEITNGSLLFVDDGQKIASDVTVATIAAG-
RPOC2_SYNPW      EVDFNLTIQPSG------------KGKPQKIEITNGSLLFVDNGQAIDADVTVAQIAAG-
RPOC2_SYNSC      EVDFNLTIKPSG------------KGKAQKIEITNGSLLFVDNGAEIDADVTVAQIAAG-
RPOC2_SYNPX      EVDFNLSIKPVG------------KGKTQKIEITNGSLLFVENGQTIDADVTVAQIAAG-
RPOC2_SYNS9      EVDFTLTIKPSG------------KGRPQKIDITLGSLLFVDNGQAIESDVTVVQIAAG-
RPOC2_PROMS      EVDFILKIVPQGNN----------SGKAQKIEVSSGSLLFVDDGEEINSDITVAQITAG-
RPOC2_PROM0      EVDFILKIVPQGSN----------SGKPQKIEVSSGSLLFVEDGEEINSDITVAQIIAG-
RPOC2_PROM2      EVDFTLKIVPQSNN----------SGKAQKIEVSSGSLLFVDDGEEINSDITVAQITAG-
RPOC2_PROM9      EVDFILKIVPQGNN----------SNKSQKVEVSSGSLLFVDDGEEISSDITVAQIIAG-
RPOC2_PROM5      EVDFLLKIIPSGNN----------SNKAQKIEVTSGSLLFVDDGQEIDSDITVAQITSG-
RPOC2_PROMP      EVDFLLKIIPTGSI----------TNKAQKIEVTSGSLLFVEDGQDIDSDITVAQITSG-
RPOC2_SYNR3      ETDFSLTVKPSG------------KGKTQKLDVTAGSILFVNAGGSVPNDTILAQISSGS
RPOC2_PAUCH      ETDFVLQVKPNN------------GKKSQKVDITNGSLLFVSDSQEVASDTILAQIISGS
RPOC2_GUITH      DENYKLNILNQR-------------GEKTRLEFKQGTTLFISDNEEFKKGQIIGETKSR-
RPOC2_RHDSA      EDSYKLDLYDSS-------------YKKHKIEFKQGTILFLNDNEQFKKSQVIGELSTK-
RPOC2_PORPU      EKPTQVIIESSG-------------KQKSIINLSKGTTLLVDNNEVVSKDQVIAESPRR-
RPOC2_PYRYE      KKPTQVTIRSKK-------------NQKSIINLSKGTTLLICDGELVSKDQVIAESPRR-
RPOC2_GRATL      EKDIKLKLLDFN-------------KKQTSLSLVKGSLLFVKHLEYITSGQVIAEYPIS-
RPOC2_CYAPA      ENNAKLRLEGEN-------------GKRVSFNLTQGSIIRIKDQSWVETNDLLAEIASTA
RPOC2_CYACA      EKSATFDIRTTQ--------------SERKITLETGTTLLVKDNSFIKKNQVIAETSTS-
RPOC2_EMIHU      KEEVNLIIKNSF-------------GTTISFEIPAESLLLVNTDQYVYENEIIAEIQKD-
RPOC2_PHATC      KNSGSVILIPDDED-----------QDLVQIEILRNTILFPKNNQYIVKDTVIGELLNT-
RPOC2_THAPS      KNSGSLILIPEKHT-----------DEIIQIELLRNTMLFVKSNQYIKQSAIIGELIST-
RPOC2_TRICV      KNAGSLIIIPEEKN-----------SKPVKLELFRNTVVFHKNNQYIQKNAIIAELVDD-
RPOC2_CHLVU      KHTGTNPKQVLLRVVSSSLTMRPLVYEILHQDVPAGSLLWVKQGEDVRTGQLLVQGS---
RPOC2_OSTTA      FEPLKVKIKN--------------DNTTSVLEFPSFTLLYIPPGQTVGEHQSLAELS---
RPOC2_BIGNA      KRKGLIIINPIIK-----------KIKPKKFEAILYTLVFVKNNEKVKKNQLIAQQSNKI
RPOC2_CHLAT      NIDVEILIQTNAEKS-------------VQLKLPQYTVLFIKDGQFVRSKQLIAEVSSKN
RPOC2_MESVI      QSNINICIQ-GKNKE-------------FNIEVPINTILLVNNGSMVRAKQLIAEVSAP-
RPOC2_NEPOL      SEKIEIIFEHESKK--------------TIQVFDAGTVLTIHEGEKVHTNQLIGEIPAH-
                                                       :       .             

RPOC2_STAPU      APL---------------------------------------------------------
RPOC2_ZYGCR      API---------------------------------------------------------
RPOC2_CHAVU      RQS---------------------------------------------------------
RPOC2_ANEMR      SPP---------------------------------------------------------
RPOC2_MARPO      SPF---------------------------------------------------------
RPOC2_PHYPA      SPF---------------------------------------------------------
RPOC2_ANTAG      SPF---------------------------------------------------------
RPOC2_ANGEV      SPL---------------------------------------------------------
RPOC2_PSINU      SLP---------------------------------------------------------
RPOC2_PINKO      SSF---------------------------------------------------------
RPOC2_PINTH      SSF---------------------------------------------------------
RPOC2_CYCTA      SPS---------------------------------------------------------
RPOC2_CRYJA      SPF---------------------------------------------------------
RPOC2_AGRST      STLHF-------------------------------------------------------
RPOC2_LOLPR      PTLHF-------------------------------------------------------
RPOC2_HORVU      STLHF-------------------------------------------------------
RPOC2_WHEAT      STLHF-------------------------------------------------------
RPOC2_SACHY      STLHF-------------------------------------------------------
RPOC2_SACOF      STLHF-------------------------------------------------------
RPOC2_SORBI      STLHF-------------------------------------------------------
RPOC2_MAIZE      STLHF-------------------------------------------------------
RPOC2_ORYNI      SALHF-------------------------------------------------------
RPOC2_ORYSI      SALHF-------------------------------------------------------
RPOC2_ORYSA      SALHF-------------------------------------------------------
RPOC2_ORYSJ      SALHF-------------------------------------------------------
RPOC2_DIOEL      FTLNF-------------------------------------------------------
RPOC2_PHAAO      STFHF-------------------------------------------------------
RPOC2_LEMMI      ATLNF-------------------------------------------------------
RPOC2_ACOCL      STFNF-------------------------------------------------------
RPOC2_AMBTC      STL---------------------------------------------------------
RPOC2_NYMAL      STFHF-------------------------------------------------------
RPOC2_ILLOL      STFSF-------------------------------------------------------
RPOC2_CALFG      STFNLKV-----------------------------------------------------
RPOC2_LIRTU      STFNF-------------------------------------------------------
RPOC2_DRIGR      STFNF-------------------------------------------------------
RPOC2_CHLSC      STLNF-------------------------------------------------------
RPOC2_CERDE      STFHF-------------------------------------------------------
RPOC2_PIPCE      SALSF-------------------------------------------------------
RPOC2_BUXMI      STFNF-------------------------------------------------------
RPOC2_PLAOC      STLNF-------------------------------------------------------
RPOC2_NANDO      STLNF-------------------------------------------------------
RPOC2_RANMC      STLNF-------------------------------------------------------
RPOC2_SOLBU      STLNF-------------------------------------------------------
RPOC2_SOLTU      STLNF-------------------------------------------------------
RPOC2_SOLLC      STLNF-------------------------------------------------------
RPOC2_ATRBE      STLNF-------------------------------------------------------
RPOC2_NICSY      STLNF-------------------------------------------------------
RPOC2_TOBAC      STLNF-------------------------------------------------------
RPOC2_NICTO      STLNF-------------------------------------------------------
RPOC2_COFAR      STLSF-------------------------------------------------------
RPOC2_JASNU      STLNF-------------------------------------------------------
RPOC2_CUSEX      STFNY-------------------------------------------------------
RPOC2_CUSRE      STLNY-------------------------------------------------------
RPOC2_IPOPU      STLNL-------------------------------------------------------
RPOC2_DAUCA      STLNF-------------------------------------------------------
RPOC2_PANGI      STLNF-------------------------------------------------------
RPOC2_GUIAB      STLNL-------------------------------------------------------
RPOC2_HELAN      STLNL-------------------------------------------------------
RPOC2_LACSA      STLNL-------------------------------------------------------
RPOC2_SILLA      STLNF-------------------------------------------------------
RPOC2_SPIOL      STLNF-------------------------------------------------------
RPOC2_FAGEA      STLNF-------------------------------------------------------
RPOC2_SOYBN      YTFNL-------------------------------------------------------
RPOC2_PHAVU      YTFNF-------------------------------------------------------
RPOC2_LOTJA      YTLNL-------------------------------------------------------
RPOC2_PELHO      STFAF-------------------------------------------------------
RPOC2_OENAR      STFHF-------------------------------------------------------
RPOC2_OENPA      STFHF-------------------------------------------------------
RPOC2_OENEH      STFHF-------------------------------------------------------
RPOC2_OENGL      STFHF-------------------------------------------------------
RPOC2_OENBI      STFHF-------------------------------------------------------
RPOC2_EUCGG      YTFNL-------------------------------------------------------
RPOC2_AETCO      YTFRF-------------------------------------------------------
RPOC2_AETGR      YTFRF-------------------------------------------------------
RPOC2_ARATH      YTFHF-------------------------------------------------------
RPOC2_CAPBU      YTFHF-------------------------------------------------------
RPOC2_CRUWA      YTFHF-------------------------------------------------------
RPOC2_OLIPU      YTFHF-------------------------------------------------------
RPOC2_BARVE      HTFHF-------------------------------------------------------
RPOC2_NASOF      YTFHF-------------------------------------------------------
RPOC2_LEPVR      YTFHF-------------------------------------------------------
RPOC2_LOBMA      YTFHF-------------------------------------------------------
RPOC2_ARAHI      STFHF-------------------------------------------------------
RPOC2_DRANE      STFHF-------------------------------------------------------
RPOC2_SINAL      YTFQF-------------------------------------------------------
RPOC2_CARPA      YTLNY-------------------------------------------------------
RPOC2_GOSBA      YTLNL-------------------------------------------------------
RPOC2_GOSHI      YTLNL-------------------------------------------------------
RPOC2_CITSI      YTLNF-------------------------------------------------------
RPOC2_CUCSA      YTLNL-------------------------------------------------------
RPOC2_MORIN      YTFHF-------------------------------------------------------
RPOC2_POPAL      YTLNF-------------------------------------------------------
RPOC2_POPTR      YTLNF-------------------------------------------------------
RPOC2_MANES      YTLNF-------------------------------------------------------
RPOC2_VITVI      YTFNF-------------------------------------------------------
RPOC2_WELMI      SLL---------------------------------------------------------
RPOC2_ADICA      FPP---------------------------------------------------------
RPOC2_CHAGL      APL---------------------------------------------------------
RPOC2_ACAM1      ------------------------------------------------------------
RPOC2_THEEB      ------------------------------------------------------------
RPOC2_NOSS1      ------------------------------------------------------------
RPOC2_TRIV2      ------------------------------------------------------------
RPOC2_NOSP7      ------------------------------------------------------------
RPOC2_SYNE7      ------------------------------------------------------------
RPOC2_SYNP6      ------------------------------------------------------------
RPOC2_TRIEI      ------------------------------------------------------------
RPOC2_CROS5      ------------------------------------------------------------
RPOC2_SYNY3      ------------------------------------------------------------
RPOC2_MICAN      ------------------------------------------------------------
RPOC2_SYNP2      ------------------------------------------------------------
RPOC2_SYNJB      ------------------------------------------------------------
RPOC2_SYNJA      ------------------------------------------------------------
RPOC2_GLOVI      ------------------------------------------------------------
RPOC2_PROMA      ------------------------------------------------------------
RPOC2_PROM4      ------------------------------------------------------------
RPOC2_PROM1      ------------------------------------------------------------
RPOC2_PROMT      ------------------------------------------------------------
RPOC2_PROM3      ------------------------------------------------------------
RPOC2_PROMM      ------------------------------------------------------------
RPOC2_SYNS3      ------------------------------------------------------------
RPOC2_SYNPW      ------------------------------------------------------------
RPOC2_SYNSC      ------------------------------------------------------------
RPOC2_SYNPX      ------------------------------------------------------------
RPOC2_SYNS9      ------------------------------------------------------------
RPOC2_PROMS      ------------------------------------------------------------
RPOC2_PROM0      ------------------------------------------------------------
RPOC2_PROM2      ------------------------------------------------------------
RPOC2_PROM9      ------------------------------------------------------------
RPOC2_PROM5      ------------------------------------------------------------
RPOC2_PROMP      ------------------------------------------------------------
RPOC2_SYNR3      ------------------------------------------------------------
RPOC2_PAUCH      ------------------------------------------------------------
RPOC2_GUITH      ------------------------------------------------------------
RPOC2_RHDSA      ------------------------------------------------------------
RPOC2_PORPU      ------------------------------------------------------------
RPOC2_PYRYE      ------------------------------------------------------------
RPOC2_GRATL      ------------------------------------------------------------
RPOC2_CYAPA      ------------------------------------------------------------
RPOC2_CYACA      ------------------------------------------------------------
RPOC2_EMIHU      ------------------------------------------------------------
RPOC2_PHATC      ------------------------------------------------------------
RPOC2_THAPS      ------------------------------------------------------------
RPOC2_TRICV      ------------------------------------------------------------
RPOC2_CHLVU      --------------RLQKSKQKMPESTHIVRTPFSGELFFEHMPIVSLEKIITRGPRTNP
RPOC2_OSTTA      --------------RIENKQ----------------------------------------
RPOC2_BIGNA      SNTQQIEGKYTVNSKLEGEILFDENHLSTNKKKIWILHGKIYKSVFPLQLFPKKNDFLSY
RPOC2_CHLAT      ------------------------------------------------------------
RPOC2_MESVI      ------------------------------------------------------------
RPOC2_NEPOL      ------------------------------------------------------------
                                                                             

RPOC2_STAPU      --------------------KEKIEKNIYSHLQGE-------------------------
RPOC2_ZYGCR      --------------------KEKVQRNIYSYLQGE-------------------------
RPOC2_CHAVU      --------------------KEEVNKNINSELAGE-------------------------
RPOC2_ANEMR      --------------------KERIHKYIYSDLDGE-------------------------
RPOC2_MARPO      --------------------KEKVQKYIYSNLEGE-------------------------
RPOC2_PHYPA      --------------------KEKVQKYIYSNLSGE-------------------------
RPOC2_ANTAG      --------------------KEKVQKYIYCNIEGE-------------------------
RPOC2_ANGEV      --------------------KERVKKPIYSNLDGE-------------------------
RPOC2_PSINU      --------------------KERVKKHIYSNSEGE-------------------------
RPOC2_PINKO      --------------------KEKVRKNIYSDLEGE-------------------------
RPOC2_PINTH      --------------------KEKVRKNIYSDLEGE-------------------------
RPOC2_CYCTA      --------------------KEKVRKHIYSNLEGE-------------------------
RPOC2_CRYJA      --------------------KEKVKKHIYSDLTGE-------------------------
RPOC2_AGRST      --------------------KERVQKHIYSESDGE-------------------------
RPOC2_LOLPR      --------------------KERVQKHIYSESDGE-------------------------
RPOC2_HORVU      --------------------KERVQKHIYSESDGE-------------------------
RPOC2_WHEAT      --------------------KERVQKHIYSESDGE-------------------------
RPOC2_SACHY      --------------------KEKVQKHIYSESDGE-------------------------
RPOC2_SACOF      --------------------KEKVQKHIYSESDGE-------------------------
RPOC2_SORBI      --------------------KEKVQKHIYSESDGE-------------------------
RPOC2_MAIZE      --------------------KEKVQKHIYSESDGE-------------------------
RPOC2_ORYNI      --------------------KEKVQKHIYSESDGE-------------------------
RPOC2_ORYSI      --------------------KEKVQKHIYSESDGE-------------------------
RPOC2_ORYSA      --------------------KEKVQKHIYSESDGE-------------------------
RPOC2_ORYSJ      --------------------KEKVQKHIYSESDGE-------------------------
RPOC2_DIOEL      --------------------KERVRKHIYSESEGE-------------------------
RPOC2_PHAAO      --------------------KERVQKHIYSESEGE-------------------------
RPOC2_LEMMI      --------------------KEKVRKHIYSESEGE-------------------------
RPOC2_ACOCL      --------------------KERVQKHIYSESAGE-------------------------
RPOC2_AMBTC      --------------------KERVQKHIYSDSEGE-------------------------
RPOC2_NYMAL      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_ILLOL      --------------------KEKVRKHIYSDSEGE-------------------------
RPOC2_CALFG      --------------------KEKVRKHIYSDSEGE-------------------------
RPOC2_LIRTU      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_DRIGR      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_CHLSC      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_CERDE      --------------------KERVRKHIYSDSQGE-------------------------
RPOC2_PIPCE      --------------------KEKVRKHIYSDSEGE-------------------------
RPOC2_BUXMI      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_PLAOC      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_NANDO      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_RANMC      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_SOLBU      --------------------KEKVRKHIYSDSDGE-------------------------
RPOC2_SOLTU      --------------------KEKVRKHIYSDSDGE-------------------------
RPOC2_SOLLC      --------------------KEKVRKHIYSDSDGE-------------------------
RPOC2_ATRBE      --------------------KEKVRKHIYSDSDGE-------------------------
RPOC2_NICSY      --------------------KEKVRKHIYSDSDGE-------------------------
RPOC2_TOBAC      --------------------KEKVRKHIYSDSDGE-------------------------
RPOC2_NICTO      --------------------KEKVRKHIYSDSDGE-------------------------
RPOC2_COFAR      --------------------KEKVRKHIYSDSDGE-------------------------
RPOC2_JASNU      --------------------KEKVRKHIFSDSDGE-------------------------
RPOC2_CUSEX      --------------------KEKVRKHIYSDSGGE-------------------------
RPOC2_CUSRE      --------------------KEKIRKHIYSDSGGE-------------------------
RPOC2_IPOPU      --------------------KEKVRKHIYSDSDGE-------------------------
RPOC2_DAUCA      --------------------KEKVRKHIYSDSEGE-------------------------
RPOC2_PANGI      --------------------KEKVRKHIYSDSEGE-------------------------
RPOC2_GUIAB      --------------------KEKVRKHIYSDSEGE-------------------------
RPOC2_HELAN      --------------------KEKVRKHIYSDSEGE-------------------------
RPOC2_LACSA      --------------------KEKVRKHIYSDSEGE-------------------------
RPOC2_SILLA      --------------------KEKVRKHIYSDSEGE-------------------------
RPOC2_SPIOL      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_FAGEA      --------------------KEKVRKHIYSDSQGE-------------------------
RPOC2_SOYBN      --------------------KEKVRKHVYSDLEGE-------------------------
RPOC2_PHAVU      --------------------KEKVRKHVYSDLEGE-------------------------
RPOC2_LOTJA      --------------------KEKVRKHIFSDSEGE-------------------------
RPOC2_PELHO      --------------------KDRVRKHIYSDSSGE-------------------------
RPOC2_OENAR      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_OENPA      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_OENEH      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_OENGL      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_OENBI      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_EUCGG      --------------------KERVRKHIYSESEGE-------------------------
RPOC2_AETCO      --------------------KERVRKYIYSDSEGE-------------------------
RPOC2_AETGR      --------------------KERVRKYIYSDSEGE-------------------------
RPOC2_ARATH      --------------------KERVRKYIYSDSEGE-------------------------
RPOC2_CAPBU      --------------------KERVRKYIYSDSEGE-------------------------
RPOC2_CRUWA      --------------------KERVRKYIYSDSEGE-------------------------
RPOC2_OLIPU      --------------------KERVRKYIYSDSEGE-------------------------
RPOC2_BARVE      --------------------KERVRKYIYSDSEGE-------------------------
RPOC2_NASOF      --------------------KERVRKYIYSDSEGE-------------------------
RPOC2_LEPVR      --------------------KERVRKYIYSDSEGE-------------------------
RPOC2_LOBMA      --------------------KERVRKYIYSDSEGE-------------------------
RPOC2_ARAHI      --------------------KERVRKYIYSDSEGE-------------------------
RPOC2_DRANE      --------------------KERVRKYIYSGSEGE-------------------------
RPOC2_SINAL      --------------------KERVRKYIYSDSEGG-------------------------
RPOC2_CARPA      --------------------KERVRKHIYSNSEGE-------------------------
RPOC2_GOSBA      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_GOSHI      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_CITSI      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_CUCSA      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_MORIN      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_POPAL      --------------------TERVRKHIYSDSEGE-------------------------
RPOC2_POPTR      --------------------TERVRKHIYSDSEGE-------------------------
RPOC2_MANES      --------------------KEKVRKHIYSDSEGE-------------------------
RPOC2_VITVI      --------------------KERVRKHIYSDSEGE-------------------------
RPOC2_WELMI      --------------------KEKVLKYIYSELNGE-------------------------
RPOC2_ADICA      --------------------KECIRKPIYPNSRGE-------------------------
RPOC2_CHAGL      --------------------KEQIEKYIYSDLSGE-------------------------
RPOC2_ACAM1      --------------RNVRKTTEKATKDVASDLAGE-------------------------
RPOC2_THEEB      --------------RSVRKATEKVTKDVASDLAGQ-------------------------
RPOC2_NOSS1      --------------RTTRTNTEKAVKDVASDLAGE-------------------------
RPOC2_TRIV2      --------------RTTRTNTEKAVKDVASDLAGE-------------------------
RPOC2_NOSP7      --------------RTTRTNTEKAVKDVASDLAGE-------------------------
RPOC2_SYNE7      --------------RTKRT-VEKATKDVATDLAGE-------------------------
RPOC2_SYNP6      --------------RTKRT-VEKATKDVATDLAGE-------------------------
RPOC2_TRIEI      --------------Q-VRKTTEKVTKEVASDLAGE-------------------------
RPOC2_CROS5      --------------KSTRS-TERATKDVSTDLAGE-------------------------
RPOC2_SYNY3      --------------KTQRS-TERATKDVAGDLAGE-------------------------
RPOC2_MICAN      --------------KVQKS-TEKATKDVTSDLAGE-------------------------
RPOC2_SYNP2      --------------KTQKS-TERATKDVSSDLAGE-------------------------
RPOC2_SYNJB      --------------KASRKSTEKAQKEVVADLAGE-------------------------
RPOC2_SYNJA      --------------KAVRKSTEKAQKEVVADLAGE-------------------------
RPOC2_GLOVI      --------------KTARKSTEKAQKEVFSDLAGE-------------------------
RPOC2_PROMA      --------------AIKKS-VEKATKDVICDLAGQ-------------------------
RPOC2_PROM4      --------------AVKKS-VEKATKDVICDLAGQ-------------------------
RPOC2_PROM1      --------------TVQKS-VEKATKDVICDLAGQ-------------------------
RPOC2_PROMT      --------------TVQKS-VEKATKDVICDLAGQ-------------------------
RPOC2_PROM3      --------------AVKKS-VEKATKDVICDLAGQ-------------------------
RPOC2_PROMM      --------------AVKKS-VEKATKDVICDLAGQ-------------------------
RPOC2_SYNS3      --------------AVQKS-VEKATKDVICDLAGQ-------------------------
RPOC2_SYNPW      --------------AVKKS-VEKATKDVICDLAGQ-------------------------
RPOC2_SYNSC      --------------AVKKS-VEKATKDVICDLAGQ-------------------------
RPOC2_SYNPX      --------------AVKKS-VEKATKDVICDLAGQ-------------------------
RPOC2_SYNS9      --------------AVQKS-VEKATKDVICDLAGQ-------------------------
RPOC2_PROMS      --------------AVKKS-VEKATKDVICDLAGQ-------------------------
RPOC2_PROM0      --------------TVKKS-VEKATKDVICDLAGQ-------------------------
RPOC2_PROM2      --------------AVKKS-VEKATKDVICDLAGQ-------------------------
RPOC2_PROM9      --------------AVKKS-VEKATKDVVCDLAGQ-------------------------
RPOC2_PROM5      --------------AVKKS-VEKATKDVICDLAGQ-------------------------
RPOC2_PROMP      --------------AVKKS-VEKATKDVICDLAGE-------------------------
RPOC2_SYNR3      --------------AVKKS-VEKATKDVVCDLAGQ-------------------------
RPOC2_PAUCH      --------------SVKKS-VEKATKDVICDLAGQ-------------------------
RPOC2_GUITH      ----------------STLVTEKATRDLVTETSGE-------------------------
RPOC2_RHDSA      ----------------SSMITERVTKDLNTENSGE-------------------------
RPOC2_PORPU      ----------------NRLMIERAQKHVLSDLSGK-------------------------
RPOC2_PYRYE      ----------------NRLMTERAQKHVVSDLSGK-------------------------
RPOC2_GRATL      ----------------NRLITEKAQKAVLADFSGS-------------------------
RPOC2_CYAPA      --------------PNTRRAKEKTTRELRTDIAGE-------------------------
RPOC2_CYACA      ----------------GRLITEKSTKDLISNSAGE-------------------------
RPOC2_EMIHU      ----------------TNLILEEEQKEIYSETSGE-------------------------
RPOC2_PHATC      -----------------NRQIKTEVKPILSDTCGE-------------------------
RPOC2_THAPS      -----------------DKQTLTERKPILSDTAGE-------------------------
RPOC2_TRICV      -----------------EKQTRTEIKPVLTTTSGE-------------------------
RPOC2_CHLVU      KEEFSPIKVFLKDLGRFWVFSSFIQKQTFSFLDQKKGKANSFFFKGDLVSAETPLSQYNL
RPOC2_OSTTA      ------------NFQQFEVGTENVQKEFMSNCSGQ-------------------------
RPOC2_BIGNA      KFPLAQAKLLNLSASFLKVCVVRKKRHFIKDNISQSNEILLFTEYPLYKFLIKNIKNYHQ
RPOC2_CHLAT      ---------------KKLQSVEIASKYVTSDLYGE-------------------------
RPOC2_MESVI      ---------------VNAQSVEIASKYVASDFSGE-------------------------
RPOC2_NEPOL      ------------------GTLVTGWRSLKSGVDGE-------------------------
                                          :                                  

RPOC2_STAPU      --------------------------------------------VFYNPIGLRASC----
RPOC2_ZYGCR      --------------------------------------------VVHTRSALRLSN----
RPOC2_CHAVU      --------------------------------------------VFWSNKYYFKEQ----
RPOC2_ANEMR      --------------------------------------------MSWITGVCHTSE----
RPOC2_MARPO      --------------------------------------------MHWSTKVRHASE----
RPOC2_PHYPA      --------------------------------------------MHWSSKVQHSSE----
RPOC2_ANTAG      --------------------------------------------MHWSKRVRHASK----
RPOC2_ANGEV      --------------------------------------------LHWDTTVRHLSE----
RPOC2_PSINU      --------------------------------------------MHWSTIVRHSPQ----
RPOC2_PINKO      --------------------------------------------MHWSTNVCHAPE----
RPOC2_PINTH      --------------------------------------------MHWSTNVCHAPE----
RPOC2_CYCTA      --------------------------------------------MHWSTNVCHAPE----
RPOC2_CRYJA      --------------------------------------------MHRSIPMSN-------
RPOC2_AGRST      --------------------------------------------MHWSTDVYHAPE----
RPOC2_LOLPR      --------------------------------------------MHWSTDVYHAPE----
RPOC2_HORVU      --------------------------------------------MHWSTDVYHAPE----
RPOC2_WHEAT      --------------------------------------------MHWSTDVYHAPE----
RPOC2_SACHY      --------------------------------------------MHWSTDVYHAPE----
RPOC2_SACOF      --------------------------------------------MHWSTDVYHAPE----
RPOC2_SORBI      --------------------------------------------MHWSTDVYHAPE----
RPOC2_MAIZE      --------------------------------------------MHWSTDVYHAPE----
RPOC2_ORYNI      --------------------------------------------MHWSTDVYHAPE----
RPOC2_ORYSI      --------------------------------------------MHWSTDVYHAPE----
RPOC2_ORYSA      --------------------------------------------MHWSTDVYHAPE----
RPOC2_ORYSJ      --------------------------------------------MHWSTDVYHAPE----
RPOC2_DIOEL      --------------------------------------------MHWSTNVYHAPE----
RPOC2_PHAAO      --------------------------------------------MHWSTDGYHTPK----
RPOC2_LEMMI      --------------------------------------------MHWSTDVYHAPE----
RPOC2_ACOCL      --------------------------------------------MHWSTDVYHAPE----
RPOC2_AMBTC      --------------------------------------------MHWSTDVYHTPE----
RPOC2_NYMAL      --------------------------------------------MHWSTGVYHAPE----
RPOC2_ILLOL      --------------------------------------------IHWSTDVYHVPE----
RPOC2_CALFG      --------------------------------------------MHWSTDVYHAPE----
RPOC2_LIRTU      --------------------------------------------MHWSTDVYHAPE----
RPOC2_DRIGR      --------------------------------------------MHWSTDVYHAPE----
RPOC2_CHLSC      --------------------------------------------MHWSTDVYHASE----
RPOC2_CERDE      --------------------------------------------MHWSTDVYHAPE----
RPOC2_PIPCE      --------------------------------------------MHWSTNVYHTPQ----
RPOC2_BUXMI      --------------------------------------------MHWSTDVYHAPE----
RPOC2_PLAOC      --------------------------------------------MHWSTNVYHAPE----
RPOC2_NANDO      --------------------------------------------MHWSTAVYHAPE----
RPOC2_RANMC      --------------------------------------------MHWSTAVYHAPE----
RPOC2_SOLBU      --------------------------------------------MHWSTDVYHAPE----
RPOC2_SOLTU      --------------------------------------------MHWSTDVYHAPE----
RPOC2_SOLLC      --------------------------------------------MHWSTDVYHAPE----
RPOC2_ATRBE      --------------------------------------------MHWSTDVYHAPE----
RPOC2_NICSY      --------------------------------------------MHWSTDVYHAPE----
RPOC2_TOBAC      --------------------------------------------MHWSTDVYHAPE----
RPOC2_NICTO      --------------------------------------------MHWSTDVYHAPE----
RPOC2_COFAR      --------------------------------------------IHWSTDVYHAPQ----
RPOC2_JASNU      --------------------------------------------MHWSTDVYHAPE----
RPOC2_CUSEX      --------------------------------------------MHWSTNVYHAPE----
RPOC2_CUSRE      --------------------------------------------MHWSTNVYHAPE----
RPOC2_IPOPU      --------------------------------------------MHWSTDVYHAPE----
RPOC2_DAUCA      --------------------------------------------MHWNTDVYHAPE----
RPOC2_PANGI      --------------------------------------------MHWNTDVYHAPA----
RPOC2_GUIAB      --------------------------------------------MHWNTDVYHAPE----
RPOC2_HELAN      --------------------------------------------MHWNTDVYHAPE----
RPOC2_LACSA      --------------------------------------------MHWNTDVYHAPE----
RPOC2_SILLA      --------------------------------------------MHWSTDVYHAPE----
RPOC2_SPIOL      --------------------------------------------MHWSTDVYHAPE----
RPOC2_FAGEA      --------------------------------------------MHWSTDVDHAPE----
RPOC2_SOYBN      --------------------------------------------MHWSTDVYHASE----
RPOC2_PHAVU      --------------------------------------------MHWSTNVYHASE----
RPOC2_LOTJA      --------------------------------------------MHWSTNIYHVSE----
RPOC2_PELHO      --------------------------------------------MHSNTGMYHARK----
RPOC2_OENAR      --------------------------------------------MHWSTDVYHAPE----
RPOC2_OENPA      --------------------------------------------MHWSTDVYHAPE----
RPOC2_OENEH      --------------------------------------------MHWSTDVYHAPE----
RPOC2_OENGL      --------------------------------------------MHWSTDVYHAPE----
RPOC2_OENBI      --------------------------------------------MHWSTDVYHAPE----
RPOC2_EUCGG      --------------------------------------------MHWSTDVYHAPE----
RPOC2_AETCO      --------------------------------------------MHWSTDVYHAPE----
RPOC2_AETGR      --------------------------------------------MHWSTDVYHAPE----
RPOC2_ARATH      --------------------------------------------MHWSTDVSHAPE----
RPOC2_CAPBU      --------------------------------------------MHWSTDVSHAPE----
RPOC2_CRUWA      --------------------------------------------MHWSTDVSHAPE----
RPOC2_OLIPU      --------------------------------------------MHWSTDVSHAPE----
RPOC2_BARVE      --------------------------------------------MHWSTDVSHAPE----
RPOC2_NASOF      --------------------------------------------MHWSTDVSHAPE----
RPOC2_LEPVR      --------------------------------------------MHWSTDVSHAPE----
RPOC2_LOBMA      --------------------------------------------MHWSTDVSHAPE----
RPOC2_ARAHI      --------------------------------------------MHWSTDVSHAPE----
RPOC2_DRANE      --------------------------------------------MHWSTDVSHAPE----
RPOC2_SINAL      --------------------------------------------MHWSTDVSHAPE----
RPOC2_CARPA      --------------------------------------------MHWSTDVYHAPE----
RPOC2_GOSBA      --------------------------------------------MHWSTDVYHSPE----
RPOC2_GOSHI      --------------------------------------------MHWSTDVYHSPE----
RPOC2_CITSI      --------------------------------------------MHWSTDVYHAPE----
RPOC2_CUCSA      --------------------------------------------MHWSTDVYHAPE----
RPOC2_MORIN      --------------------------------------------MHWSTDVYHAPD----
RPOC2_POPAL      --------------------------------------------MHWSTDVYHASE----
RPOC2_POPTR      --------------------------------------------MHWSTDVYHASE----
RPOC2_MANES      --------------------------------------------MHWSTDVYHAPE----
RPOC2_VITVI      --------------------------------------------MHWSTDVYHAPE----
RPOC2_WELMI      --------------------------------------------MHWSTFVCHALK----
RPOC2_ADICA      --------------------------------------------IHWSKFVWHVRD----
RPOC2_CHAGL      --------------------------------------------IHWGFPVRHTSE----
RPOC2_ACAM1      --------------------------------------------VQFSNLVP-EEK----
RPOC2_THEEB      --------------------------------------------VKFVNLDA-EEK----
RPOC2_NOSS1      --------------------------------------------VKFAEVVP-EQK----
RPOC2_TRIV2      --------------------------------------------VKFAEVVP-EQK----
RPOC2_NOSP7      --------------------------------------------VQFAEVVP-EQK----
RPOC2_SYNE7      --------------------------------------------IRFQDIVP-EEK----
RPOC2_SYNP6      --------------------------------------------IRFQDIVP-EEK----
RPOC2_TRIEI      --------------------------------------------LKFAQLVQ-EEK----
RPOC2_CROS5      --------------------------------------------VFFANLIA-EEK----
RPOC2_SYNY3      --------------------------------------------VLFDRLVP-EEK----
RPOC2_MICAN      --------------------------------------------VLFSQLVP-EEK----
RPOC2_SYNP2      --------------------------------------------VLFDNLIA-EEK----
RPOC2_SYNJB      --------------------------------------------IRFADLPI-EEK----
RPOC2_SYNJA      --------------------------------------------IRFADLPI-EEK----
RPOC2_GLOVI      --------------------------------------------IKFADLVP-EVK----
RPOC2_PROMA      --------------------------------------------VRYEEAIQPKEV----
RPOC2_PROM4      --------------------------------------------VRYESVIQPREV----
RPOC2_PROM1      --------------------------------------------VRYETIIQPREV----
RPOC2_PROMT      --------------------------------------------VRYETIIQPREV----
RPOC2_PROM3      --------------------------------------------VRYEQVIQPREV----
RPOC2_PROMM      --------------------------------------------VRYEQVIQPREV----
RPOC2_SYNS3      --------------------------------------------VSYDPTIQPREV----
RPOC2_SYNPW      --------------------------------------------VSYDPSIQPREV----
RPOC2_SYNSC      --------------------------------------------VRYEEAIQPREV----
RPOC2_SYNPX      --------------------------------------------VRYEEAIQPREV----
RPOC2_SYNS9      --------------------------------------------VHYEDKIQPREV----
RPOC2_PROMS      --------------------------------------------VRYDKVIQPKEV----
RPOC2_PROM0      --------------------------------------------VRYDKVIQPKEV----
RPOC2_PROM2      --------------------------------------------VRYDKVIQPKEV----
RPOC2_PROM9      --------------------------------------------VKYDKVIQPKEV----
RPOC2_PROM5      --------------------------------------------VRYDKVLQPKEV----
RPOC2_PROMP      --------------------------------------------VRYDKVIQPKEV----
RPOC2_SYNR3      --------------------------------------------VRYEDVIQPKEV----
RPOC2_PAUCH      --------------------------------------------VRYDEALQPKEV----
RPOC2_GUITH      --------------------------------------------VIYTNLNI-ENK----
RPOC2_RHDSA      --------------------------------------------VCFSNLYI-EEK----
RPOC2_PORPU      --------------------------------------------ICFSNLTV-EET----
RPOC2_PYRYE      --------------------------------------------ICFSNLTV-EET----
RPOC2_GRATL      --------------------------------------------IYLMDLSV-SNI----
RPOC2_CYAPA      --------------------------------------------VYFQNLEI--------
RPOC2_CYACA      --------------------------------------------IYFSDITI-EER----
RPOC2_EMIHU      --------------------------------------------VFFNALDV-KVQ----
RPOC2_PHATC      --------------------------------------------IFMPVLKK--------
RPOC2_THAPS      --------------------------------------------IFIPRLKT--------
RPOC2_TRICV      --------------------------------------------VFIPRIIN--------
RPOC2_CHLVU      QIPVRGHLKKLGSSVVLAQTVFKFCFSKIYYFSKFYFLVENQNLIASTTTLNFTSL----
RPOC2_OSTTA      -----------------------------------IFLPQRQNALINEDNAGTTTF----
RPOC2_BIGNA      FQFFYPIQNKIKEVEKSLRINNKVIKDNRIKIPFNSIAKSKLLNLLNKRLEQNTFF----
RPOC2_CHLAT      --------------------------------------------VYFDNLVLQERK----
RPOC2_MESVI      --------------------------------------------IHFENLLLQEKK----
RPOC2_NEPOL      --------------------------------------------VRFDELELLKQRPRSD
                                                             :               

RPOC2_STAPU      --LKQRHFLHFLCSASRMNLWIEFAS----------------------IRSYLSPLVEKT
RPOC2_ZYGCR      --AFSGTILLIHHNPN-------------------------------------------T
RPOC2_CHAVU      --NLHDLQKNNFFVKNNHNFRNCPTSDSQNENDSNRSNHFLTINSIKYSQEKTNWPISNT
RPOC2_ANEMR      --YMHSCIHPTLRTCHVWILSGKSDN----------KKDKLPVSFYDNQDRINSNTFLAE
RPOC2_MARPO      --YIHSNIHLILKTCHIWILSGNFHK----------KNNDLSVLFYKNQDKIDFPISLTK
RPOC2_PHYPA      --YIHSNVHLLRKTGHIWILAGNFD-----------KDNKFSFIFYQNQDKLDNKLPIAK
RPOC2_ANTAG      --YLHSNVHLIFNTGHLWILSGSSH------------EDKTSSMFFKNQDQINTKFFISP
RPOC2_ANGEV      --HIHNNIHRVVKSGHIWILSGKLH-----------NLSKTSLFFYQNQDKIHVQSPSIT
RPOC2_PSINU      --HRQSNVYPVLKTGHIWILSGSLC-----------NVIETSSSFYKEQDRFNIQS-VFT
RPOC2_PINKO      --YVHGNVHSILRTGYLWILSGGI-----------YGSGVVPFPFHKYQDQVDV-QPFVA
RPOC2_PINTH      --YVQGNVHPILRTGYLWILSGGI-----------YGSRVVPFPFHKYQDQVYV-QPFVA
RPOC2_CYCTA      --YVQGNVHLILRTSHLWVLSGGI-----------HGSSAVSFPFHKDQDQVNV-QLPLA
RPOC2_CRYJA      ---------LILETTHLWVLSGSI-----------YESVVVPFSSD--QDQVDIPELLLD
RPOC2_AGRST      --YQYGNLRRLPKTSHLWILSGNI-----------CRSSIASFSLHKDQDQMNTY-----
RPOC2_LOLPR      --YQYGNLRRLPKTSHLWILSVSR-----------CRSSIASFSLHKDQDQMNTY-----
RPOC2_HORVU      --YQYGNLRRLPKTSHLWILSVSM-----------CRSSIASFSLHKDQDQMNTY-----
RPOC2_WHEAT      --YQYGNLRRLPKTSHLWILSVSM-----------CRSSIASFSLHKDQDQMNTY-----
RPOC2_SACHY      --YQYGNLRRLPKTSHLWILSVSM-----------CRSSIASFSLHKDQDQMNTYSFSVD
RPOC2_SACOF      --YQYGNLRRLPKTSHLWILSVSM-----------CRSSIASFSLHKDQDQMNTYSFSVD
RPOC2_SORBI      --YQYGNLRRLPKTSHLWILSVSM-----------CRSSIASFSLHKDQDQMNTYSFSVD
RPOC2_MAIZE      --YQYGNLRRLPKTSHLWILSVSM-----------CRSSIASFSLHKDQDQMNTYSFSVD
RPOC2_ORYNI      --YQYGNLRRLPKTSHLWILSVSM-----------CRSSIASFSLHKDQDQMNTYSFSVD
RPOC2_ORYSI      --YQYGNLRRLPKTSHLWILSVSM-----------CRSSIASFSLHKDQDQMNTYSFSVD
RPOC2_ORYSA      --YQYGNLRRLPKTSHLWILSVSM-----------CRSSIASFSLHKDQDQMNTYSFSVD
RPOC2_ORYSJ      --YQYGNLRRLPKTSHLWILSVSM-----------CRSSIASFSLHKDQDQMNTYSFSVD
RPOC2_DIOEL      --YPYGNIHLLLKTSHLWILAGASR---------RSS--IVSFSLHKDQDQMNVHSFSVE
RPOC2_PHAAO      --YPYSNVHLLPKTSHLWILAGGLC---------RSNSNIVSFSLHKDQDQMNANSFSLK
RPOC2_LEMMI      --YTYGNVHLLPKTSHLWILAVGTC---------RYS--IVSFSLHKDQDQINAHSLSLE
RPOC2_ACOCL      --YTYGNVHLLPKTSHLWILSGGPY---------RSS--IVSSSLHKDQDQTNAHSFSVE
RPOC2_AMBTC      --YTHGNVHLLPKTSHLWVLSGSP-----------CRSSIVPFPLHKDQDQMNVQSLYVE
RPOC2_NYMAL      --YTHGNVHFLPKTSHLWILSGGP-----------CKSSLVPFSLHKDQDQMNVQSLSVQ
RPOC2_ILLOL      --YTHGNVHLLPKTTHLWILSGGPG---------PCRRSIVPFSLHKDQDQMNLQSLSVE
RPOC2_CALFG      --YTYGNVHLLPKTSHLWILSGGL-----------CRSSIVPFSLHKDQDQMNVHSLSVE
RPOC2_LIRTU      --YRYGNVHLLPKTSHLWILSGGP-----------CRSSIVPFSLHKDQDQMNVHSLSVE
RPOC2_DRIGR      --YTYGNVHLLPKTSHLWILSGGP-----------RRSSLVPFSLHKDQDQMNIHSLSVE
RPOC2_CHLSC      --YTYGNVHLLPKTSHLWILSGSP-----------YRSSIVPFSLHKDQDQMNVHSLSVE
RPOC2_CERDE      --YTYGNVHLLPKTSHLWILSGGP-----------CRSSIVPFSIQKDQDQINVNSLFVE
RPOC2_PIPCE      --YTYGNVHLLPKTSHLWILSGNP-----------CKSNGALFSLHKDQDQMNLYSLSLS
RPOC2_BUXMI      --YTYGNVHLLPKTSHLWVLSGGP-----------CRSRIVPFSLHKDQDQMNVHSLSAE
RPOC2_PLAOC      --YTYSHVHLLPKTSHLWILSGGS-----------YRSSIVPLSLHKDQDQMNVHSLSVE
RPOC2_NANDO      --YTYGNVHLLPKTSHLWILSGGP-----------YRSSIVSFSLHKDQDQMNVHSLSAE
RPOC2_RANMC      --YTYGNVHLLPKTSHLWILSGVP-----------QRSSIVPFSLHKDQDQINIHSLSAK
RPOC2_SOLBU      --FTYGNVHLLPKTSHLWILLGGP-----------CRSSLVYLSIHKDQDQMNAHSLSGK
RPOC2_SOLTU      --FTYGNVHLLPKTSHLWILLGGP-----------CRSSLVYLSIHKDQDQMNAHSLSGK
RPOC2_SOLLC      --FTYGNVHLLPKTSHLWILLGGP-----------CRSSLVYLSIHKDQDQMNAHSLSGK
RPOC2_ATRBE      --FTYGNVHLLPKTSHLWILLGGP-----------CKSSLVYLSIHKDQDQMNAHSLSGK
RPOC2_NICSY      --FTYGNVHLLPKTSHLWILLGRP-----------CRSSLVYLSIHKDQDQMNAHFLSGK
RPOC2_TOBAC      --FTYGNVHLLPKTSHLWILLGRP-----------CRSSLVYLSIHKDQDQMNAHFLSGK
RPOC2_NICTO      --FTYGNVHLLPKTSHLWILLGGP-----------CRSSLVYLSIHKDQDQMNAHFLSGK
RPOC2_COFAR      --FTYGNVHLLPKTSHLWILLGGP-----------CRSSLVSLSLHKDQDQMNTHSLSVK
RPOC2_JASNU      --FTYGNVHLLPKTSHLWILLGGP-----------CRSSRVSLSFHKDQDQMNAHSPSIK
RPOC2_CUSEX      --FTYGNVHLLSKTSHLWILLGEP-----------CHSSLVSTSIHRDQDQMSVQSLSVK
RPOC2_CUSRE      --FTYGNVHLLSKTSHLWILLGEP-----------CHSSLVSTSIHRDQDQMSAQSLSVK
RPOC2_IPOPU      --FTYGNVHLLSKTSHLWILLGEP-----------CRSSLVSLSIHRDQDQKSAHSLFVK
RPOC2_DAUCA      --FTYGNVHLLPKTSHLWILLGEP-----------RRSDLISLSIHKDQDQMNARSFSVK
RPOC2_PANGI      --FTYGNVHLLPKTSHLWILLGEP-----------CRSDLVALSIHKDQDQMNAHSLSVK
RPOC2_GUIAB      --FTYGNIHLLPKTSHLWILLGEP-----------WRSSLGPCSIHKDQDQMNAYSLSVK
RPOC2_HELAN      --FTYGNIHLLPKTSHLWILLGEP-----------WRSSLGPCSIHKDQDQMNAYSLSVK
RPOC2_LACSA      --FTYGNIHLLPKTSHLWILLGEP-----------WRYSLGPCSIHKDQDQMNAYSLSVK
RPOC2_SILLA      --FTYGNVHLLPKASRLWILSGRP-----------YRSSVVSFSLHKDQDQTTGNSLSFE
RPOC2_SPIOL      --FTYGNVHLLPKTSHLWVLSGKP-----------YRSSVVPFSLSKDQDQMNTHSLSFE
RPOC2_FAGEA      --FTYGNVHLLPKTSHLWILAGRP-----------HKSRVATRSLHKDQDQTNAHFLSVE
RPOC2_SOYBN      --FRYSNVHILPKTSHLWILSGKS-----------YRSGSVSFSIRKDQDQMNIHYLSTG
RPOC2_PHAVU      --FKYSNVHILPKTSHLWILSGKS-----------DRSGSVSFSTRKDQDQLNIHSLSTG
RPOC2_LOTJA      --FAYSNVHILPKTSHLWILSGNS-----------HKSDTVSLSLLKDQDQMSTHSLPTA
RPOC2_PELHO      --FPFSNVHILPKTSHLWILLGDL-----------CGSGPVLFSMYKDQDQMSIHSLSVQ
RPOC2_OENAR      --FTYSNVHLLPKTSHLWILSGGS-----------CRSRGAPFSLHKDQDQMNPRSTERE
RPOC2_OENPA      --FTYSNVHLLPKTSHLWILSGGS-----------CRSRGAPFSLHKDQDQMNPRSTERE
RPOC2_OENEH      --FTYSNVHLLPKTSHLWILSGGS-----------CRSRGAPFSLHKDQDQMNPRSTERE
RPOC2_OENGL      --FTYSNVHLLPKTSHLWILSGGS-----------CRSRGAPFSLHKDQDQMNPRSTERE
RPOC2_OENBI      --FTYSNVHLLPKTSHLWILSGGS-----------CRSRGAPFSLHKDQDQMNPRSTERE
RPOC2_EUCGG      --FTYSNVHLLPKTSHLWILSGGS-----------CRSSRVPFSLYKDQDQMNLRSTERE
RPOC2_AETCO      --FTYSNVHLVPKTSHLWILSGGS-----------CGASLILFSIHKDQDQMNIPFLSVK
RPOC2_AETGR      --FTYSNVHLVPKTSHLWILSGGS-----------CGSSLISFSIHKDQDQMNIPFLSVK
RPOC2_ARATH      --FTYSNVHLLPKTSHLWILSGGS-----------CGSSLIRFSIHKDQDQMNIPFLSAE
RPOC2_CAPBU      --FTYSNVHLLPKTSHLWILSGGS-----------CGSSLILFSIHKDQDQMNIPFLSAE
RPOC2_CRUWA      --FTYSNVHLLPKTSHLWILSGSS-----------CGSSLILFSIHKDQDQMNIPFLSVE
RPOC2_OLIPU      --FTYSNVHLLPKTSHLWILSGGS-----------CGSSLIFFSIHKDQDQMNIPFLSVE
RPOC2_BARVE      --FTYSNVHLLPKTSHLWILSGGS-----------CGSSLILFSIHKDQDQMNIPFLSVE
RPOC2_NASOF      --FTYSNVHLLPKTSHLWILSGGS-----------CGSSLILFSIHKDQDQMNIPFLSVE
RPOC2_LEPVR      --FTYSNVHLLPKTSHLWVLSGNS-----------CGSSLILFSIHKDQDQMNIPFLSVE
RPOC2_LOBMA      --FTYSNVHLLPKTSHLWILSGSS-----------CESSLIRFSIHKDQDQMNIPFFFVK
RPOC2_ARAHI      --FTYSNVHLLPKTSHLWILSGGS-----------CGSSLILFSIHKDQDQMNIPFLSAE
RPOC2_DRANE      --FTYSNVHLLPKTSHLWILSGGS-----------CGSSLIRFSIHKDQDQMNIPFLSAQ
RPOC2_SINAL      --FTYSNVHLLPKTSHLWILSGGS-----------CGSSLILFSIHKDQDQMNIPFLSVE
RPOC2_CARPA      --FTYSNVHLLPKTSHLWILSGGS-----------SRSSLVPFSLHKDQDQMNIHSLSVE
RPOC2_GOSBA      --YTYSNVHLLPKTSHLWILSGGS-----------YKFSVVPFSLHKDQDQINIHYLSAE
RPOC2_GOSHI      --FTYSNVHLLPKTSHLWILSGGS-----------YKFSVVPFSLHKDQDQISIHYLSAE
RPOC2_CITSI      --FTYSNVHLLPKTSHLWILSGGS-----------RRSSVVSFSLHKDQDQMNIHSLSVE
RPOC2_CUCSA      --FTYSNVHLLPKTSHLWILSGGS-----------CGCSLVPFSLYKDQDQINVHSLCVE
RPOC2_MORIN      --FTYSNVHLLPKTSHLWILSGGS-----------YKSSVVPFSIHKDQDQTNVYFLSAA
RPOC2_POPAL      --FTYSNVHLLPKTSHLWILSGGS-----------CRSSIVPFSLHKDQDQINVHSLSVE
RPOC2_POPTR      --FTYSNVHLLPKTSHLWILSGGS-----------CRSSIVPFSLHKDQDQINVHSLSVE
RPOC2_MANES      --FTYSNVHLLPKTSHLWILSGSS-----------CRSSIVPFSLHKDQDQMNVHSLSVK
RPOC2_VITVI      --FTYGNVHLLPKTSHLWILSGGS-----------CRFSIVPFSIHKDQDQMSVRSLSVE
RPOC2_WELMI      --HTQGNAHFTFGAVHLWILSGGIY----------NPKVVLSFPFPKDQDQVTIAFLSTK
RPOC2_ADICA      --SICNIARLVREASHIWILSGSP------------SKFDGNSFFHKDQDRVRIKPHPIK
RPOC2_CHAGL      --YIYSNLHTVQNTGHIWVVSGNIK-----------NSNKNLLLFYKKGDYILKDFLNKK
RPOC2_ACAM1      HDRQGNTTRIAPRGGLIWVLSGEV-----------YNLPPGAEPTVKNDDYIEGEDVLAE
RPOC2_THEEB      RDRQGTTTRIAPKGGLIWVLSGEV-----------YNLPPGAEPVVKNGDRIEAGAVLAE
RPOC2_NOSS1      TDRQGNTTTTAARGGLIWILSGEV-----------YNLPPGAELVVKNGDRVETNGVLAE
RPOC2_TRIV2      TDRQGNTTTTAARGGLIWILSGEV-----------YNLPPGAELVVKNGDRVETNGVLAE
RPOC2_NOSP7      TDRQGNTTTTAARGGLIWILSGEV-----------YNLPPGAELVVKNGDAIAANGVLAE
RPOC2_SYNE7      TDRQGNTTRIAQRGGLLWVLAGDV-----------YNLLPGAEPTVKNGDRVEVGDVLAE
RPOC2_SYNP6      TDRQGNTTRIAQRGGLLWVLAGDV-----------YNLLPGAEPTVKNGDRVEVGDVLAE
RPOC2_TRIEI      VDKQGTTTRIAQRGGLIWILEGEV-----------YNLPPGAEAMVKNGTRININSVLAE
RPOC2_CROS5      TDRQGNTTHIAQRGGLVWVLSGEV-----------YNLPPGAEPVVSNGDEVAEGTVLAE
RPOC2_SYNY3      TDRQGNTTRIAQRGGLVWILSGEV-----------YNLPPGAEPVVKNDEQVEVGSIMAE
RPOC2_MICAN      TDRQGNTTRIAQRGGLLWILSGEV-----------YNLPPGAEPVVSNGDQVQVGDVLAE
RPOC2_SYNP2      TDRQGNTTRSAQRSGLMWVLAGDV-----------YNLPAGAEPVVENGTHVNVGDILAE
RPOC2_SYNJB      TDRQGNTTYTAQRQGLIWVMSGQV-----------YNLPPGAEPVVKNGDRVQAGDVIAE
RPOC2_SYNJA      TDRQGNTTCTAQRQGLIWVMSGQV-----------YNLPPGAEPVVKNGDRVQAGDVIAE
RPOC2_GLOVI      TDRQGNETQYASRLGLLWVLSGEV-----------YNLPPGAETSLERGGKVEQGGVIAE
RPOC2_PROMA      TDRQGNITLKAQRLGRLWVLAGDV-----------YNLPPNAKPVIASNANVQAGKVLAE
RPOC2_PROM4      TDRQGNITLKAQRLGRLWVLAGDV-----------YNLPPNARPVVKANSKVSKGMVLAE
RPOC2_PROM1      TDRQGNITLKAQRLGRLWVLAGDV-----------YNLPPNALPVVSGNVSVKEGQVLAE
RPOC2_PROMT      TDRQGNITLKAQRLGRLWVLAGDV-----------YNLPPNALPVVSGNVSVKEGQVLAE
RPOC2_PROM3      KDRQGNITLKAQRLGRLWVLAGDV-----------YNLPPNAEPVVQGNVKVERGQVLAE
RPOC2_PROMM      KDRQGNITLKAQRLGRLWVLAGDV-----------YNLPPNAEPVVQGNVKVERGQVLAE
RPOC2_SYNS3      TDRQGNITHKAQRLGRMWVLAGDV-----------YNLPPNARPVVSSGGSVIESQVLAE
RPOC2_SYNPW      TDRQGNITHKAQRLGRMWVLAGDV-----------YNLPPNARPVVTAGATVTEGQVLAE
RPOC2_SYNSC      TDRQGNITLKAQRLGRMWVLSGDV-----------YNLPPNAQPVVGSETQVTEGQVLAE
RPOC2_SYNPX      TDRQGNITLKAQRLGRMWVLAGDV-----------YNLPPNAQPVVQGDTEVTEGQVLAE
RPOC2_SYNS9      TDRQGNITLKAQRLGRMWVLAGDV-----------YNLPPNALPVVDGKSTVTEGQVLAE
RPOC2_PROMS      TDRQGNITLKAQRLGRLWVLAGDV-----------YNLPPNARPVISSGKSVDEGTVLAE
RPOC2_PROM0      TDRQGNITLKAQRLGRLWVLAGDV-----------YNLPPNARPVISSGKSVDEGTVLAE
RPOC2_PROM2      TDRQGNITLKAQRLGRLWVLAGDV-----------YNLPPNARPVISSGKNVDEGTVLAE
RPOC2_PROM9      TDRQGNITLKAQRLGRLWVLAGDV-----------YNLPPNARPVVSSGKSVVEGTVLAE
RPOC2_PROM5      TDRQGNITLKAQRLGRLWVLAGDV-----------YNLPPNAKPVISTEKNVEQGTVLAE
RPOC2_PROMP      TDRQGNITLKAQRLGRLWVLAGDV-----------YNLPPNAKPVVSTETKVEQGTVLAE
RPOC2_SYNR3      PDRQGNITLKAQRLGRLWVFSGDV-----------YNLPPNAMPVVQGGANVKTGEVLAE
RPOC2_PAUCH      IDRQGSATHKATRLGRVWVLSGDV-----------YNLPPNAKPVIQGNSKVEEGEVLAE
RPOC2_GUITH      IDRQGNSTLITNKGGLLWILKGDV-----------YNIPYNTDIQLKIGDKIAKDTIIST
RPOC2_RHDSA      IDRQGNSITNTPKGGCLWILSGEV-----------YNLPSYADIKIKEKQFVEEDEVLAT
RPOC2_PORPU      DNNQ-YTTRITKTGGLIWVLSGEV-----------YNIPDSANIPVNKADQVNPGTILAQ
RPOC2_PYRYE      DNNQ-YTTRITKTGGLIWVLSGEV-----------YSISDSANVIVHKEDKTKAGTILAQ
RPOC2_GRATL      QSEQ-QTFKNVIKGGVIWILAGHV-----------FSIPYNTQLIISENDFIDENHLIGK
RPOC2_CYAPA      -DEAGGQVDTA--GGSIWILGGNV-----------YNLSSNFDVILKNGDFILNGSILAR
RPOC2_CYACA      VDRHGNLTKISKQHGLIWILSGEV-----------YNFPMGANLVVQNSFEVNKGCLLAK
RPOC2_EMIHU      ADKQGNTYKTNNKAGLIWILQGSF-----------YELPAFSETLLKPGLNLSKNTLLSR
RPOC2_PHATC      ------KINLLNNNKLLWILSGQL-----------YNGPINSFVNFYSDYKLNCRSYIFR
RPOC2_THAPS      ------RMNLITQNRLLWILSGQV-----------YQAPSNSFLNFYTDHKINKNSYIFR
RPOC2_TRICV      ------KLDNINKTKLLWILSGNV-----------YQAPQHSFLNFYNDYKINKNSYIFR
RPOC2_CHLVU      TWYPFFNQFETSGYYVDLSFSSDS-----------EVLKTTELTKVKSETYDFTKNGGFF
RPOC2_OSTTA      NYSEMWLLAGKILDSKTLVPGD----------------------QIKNALYPIRSKINCE
RPOC2_BIGNA      SKNTFSNYYENTDERTTWFTQNSI-----------LKYNAIYFYKSSKSVEAKTSRKIPI
RPOC2_CHLAT      GGYGNRMNRVGQHGGLLWVLSGRI-----------YELGIELPIMFQAGDLVLFGCILAE
RPOC2_MESVI      SAYGHKMNRAGQYGGLLWILSGQV-----------YKFSLDVPLMFDTADYIHNGSCMAE
RPOC2_NEPOL      RTSPVRLDPRVCNKAHLWILQGHV-----------NTFEMPIQLVANIGDKVEKDSIVST
                                                                             

RPOC2_STAPU      SYIWIFSGRLNKFFNAT-----------------LNLSFFYQTQDYIQRDLPIGIQNHVF
RPOC2_ZYGCR      GHLWIWSGKLYQLSGQ-------------------QASSIYTSEDFIQTNITVANKRYLK
RPOC2_CHAVU      GHIWILSGQVYKFHNI--------------------QSIFYKQQDKVRIKNILAQKELLV
RPOC2_ANEMR      DQS----FPSTPRNKNR-----------------SNICIFNPYVSKKNRVFTRWELTHIA
RPOC2_MARPO      EKN----EFSFVKNKTQ-----------------LNLFLFHFYLYKKNKIFIKSQLTNNI
RPOC2_PHYPA      ------------------------------------------------QTLNYFQLKEHF
RPOC2_ANTAG      RK------ILFMKKTNQ-----------------VNSKNLDPYLEKEMETLNYSNLYLGI
RPOC2_ANGEV      NYK----SLPNSSEKDT------------------KRDLDFIDSNIAKKESQTSNFGFSF
RPOC2_PSINU      KPE----FLPYSFGRNK------------------GEKNQLTNLHKKGQELNHLKFDSSA
RPOC2_PINKO      KH----TDSYVDQ---------------------VEHRSGDSNCYGKEEQ----IFSYSE
RPOC2_PINTH      KHQ-SLSDSYVDQ---------------------VEHRSGDSNCYEKEEQ----IFSYSE
RPOC2_CYCTA      KHE-LLPDYSVNQDR-------------------MKHKSVDSNFYGKEEQ----ISSYSE
RPOC2_CRYJA      KHK-SLSNYSVDQ---------------------VKHESVDSNCFEKGKK----ILNYFE
RPOC2_AGRST      -------------------------------------------GKKDRE-----IFDYSR
RPOC2_LOLPR      -------------------------------------------GKKDRE-----IFDYST
RPOC2_HORVU      -------------------------------------------GKKDRE-----ILDYST
RPOC2_WHEAT      -------------------------------------------GKKDRE-----ILDYST
RPOC2_SACHY      GRY--IFDFSMANDQ-------------------VSHRLLDTFGKKDRE-----ILDYLT
RPOC2_SACOF      GRY--IFDFSMANDQ-------------------VSHRLLDTFGKKDRE-----ILDYLT
RPOC2_SORBI      GRY--IFDFSMANDQ-------------------VSHRLLDTFGKKDRE-----ILDYLT
RPOC2_MAIZE      GRY--IFDFSMANDQ-------------------VSHRLLDTFGKKDRE-----ILDYLT
RPOC2_ORYNI      GRY--IFGLSMADDE-------------------VRHRLLDTFGKKDRE-----ILDYST
RPOC2_ORYSI      GRY--IFGLSMADDE-------------------VRHRLLDTFGKKDRE-----ILDYST
RPOC2_ORYSA      GRY--IFGLSMADDE-------------------VRHRLLDTFGKKDRE-----ILDYST
RPOC2_ORYSJ      GRY--IFGLSMADDE-------------------VRHRLLDTFGKKDRE-----ILDYST
RPOC2_DIOEL      ERYIYIFDLSMTNHR-------------------VKHKLL--DTSGKKDRE---ILEYSI
RPOC2_PHAAO      D----LFDLSLTNDQ-------------------VRHKLL--DTFGKKDRE---SLDYSK
RPOC2_LEMMI      ERY--ISDLSVTKDL-------------------ARHQLFSSDSSSKKRGG---TFDYAR
RPOC2_ACOCL      RRY--ISDLSMTNGR-------------------VRHKLFSSDLSGKRGDR---ILDYSR
RPOC2_AMBTC      --ERYISDLSMNNDR-------------------VRHKLFGWD--QKRGR----VSYYSG
RPOC2_NYMAL      --ERSISDFSVNNNR-------------------VKHKLFGSDPLARKGRRI--SDYAAG
RPOC2_ILLOL      --QRYISNLSVNNDR-------------------VRHKLFDLDPFWKKKG----GVGYSG
RPOC2_CALFG      --QRYISDLSVTNVR-------------------VRHKLFSSDSSGKKGGR---APDYSG
RPOC2_LIRTU      --RRYISDLSVTNDR-------------------VRHKLFSSDPSGKKKER---ILDYSG
RPOC2_DRIGR      --QRESSDLSVTNDR-------------------ARHKLFSSDPSGKKEGK---ILDYSG
RPOC2_CHLSC      --RGSISDLSVTNDR-------------------VRHKLFSSDLSGKKRGG---ILDYSG
RPOC2_CERDE      --QRYISDLSVTNDR-------------------VRHKIFSSDPSGQKGGRI--FDYDSG
RPOC2_PIPCE      LEQRSISDFSVTNDR-------------------VRRKSFSLDPSREGRGGR--FFDYSV
RPOC2_BUXMI      RRY--ISNLSA--TNDQ-----------------VRHKLFSSDPSGKRGG---SILDYSG
RPOC2_PLAOC      RRY--ISNFSV--TNDQ-----------------VRHKLFNSYPSSKKGE---RILDYSG
RPOC2_NANDO      QKS--ISNLLV--TNNQ-----------------VRHKFLSSEPSGKKGE---RILDYSG
RPOC2_RANMC      QKF--ISNLSLSMTNDQ-----------------VIKKLFRSDSSVKKGG---WVLDYSG
RPOC2_SOLBU      PRY--TSNLSVTNDQ-------------------ARQKLFSSDFYGQKE---DRIPDYSD
RPOC2_SOLTU      RRY--TSNLSVTNDQ-------------------ARQKLFSSDFYGQKE---DRIPDYSD
RPOC2_SOLLC      RRY--TSNLSVTNDQ-------------------ARQKLFSSDFYGQKE---DRIPDYSD
RPOC2_ATRBE      QRY--TSNLSVTNDQ-------------------ARQKLFSSGFSGKKE---DRIPDYSD
RPOC2_NICSY      RRY--TSNLSVTNDQ-------------------ARQKLFSSDFSGKKE---DRIPDYSD
RPOC2_TOBAC      RRY--TSNLSVTNDQ-------------------ARQKLFSSDFSGKKE---DRIPDYSD
RPOC2_NICTO      RRY--TSNLSVTNDQ-------------------ARQKLFSSDFSVKKE---DRIPDYSD
RPOC2_COFAR      RRY--TYKLSVTNDR-------------------VRYKFFSSDFYGKKK---NRIPDYLD
RPOC2_JASNU      RRY--TSNLSETNDP-------------------ERQKLFSSYFYGKKKK-KNRISDYSN
RPOC2_CUSEX      RRS--TSKLSETNDE-------------------ANQEIASADFSGKKE---DRIADFSD
RPOC2_CUSRE      RRY--TSKLSETNDE-------------------AKQKIASEDL----------IADYSD
RPOC2_IPOPU      RRS--ISNLSETNDR-------------------ARQKIFSAHFSGQKE---DRIADYSD
RPOC2_DAUCA      KRS--ISNLSVTNDQ-------------------VRHKFFSSDFFGK--K-EEEHPDYSE
RPOC2_PANGI      RRY--ISNLSVTNDQ-------------------ARHKFFSSDFSGK--K-EDRITDYSE
RPOC2_GUIAB      RRY--ISNPSVTNNQ-------------------VRHKFFSSYFSGKNQK-GDRIPDYSE
RPOC2_HELAN      RRY--ISNPSVTNNQ-------------------VRHKFFSSYFSGKNKK-GDRIPDYSE
RPOC2_LACSA      PRY--IANPSVTNNQ-------------------VRHKFFSSYFSGKNQK-GDRIPDCSE
RPOC2_SILLA      QK---IYNLSMTNDQ-------------------VQNKFLDPYIKKS-SKKEDRSPNYSE
RPOC2_SPIOL      QIY--ISNPSVTNDQ-------------------VKDKLSDSFSKK-----EDRITDYSE
RPOC2_FAGEA      QRY--ISNSSVINAY-------------------MRHTFFSSDLSSTNSNKGDSISDYSE
RPOC2_SOYBN      ER--DFCNLLASKKK-------------------VRHKLFRFNPSDKKERR---ISDYSI
RPOC2_PHAVU      ER--DICNHLASNNK-------------------IRHKLFHFNPSEKKERR---ISDYSI
RPOC2_LOTJA      KR--NTSNFLVSNNQ-------------------VR------------------------
RPOC2_PELHO      GR--NTPSLSVNNDQ-------------------LKHRRLSLYDKNGTGGGSIPILNYSE
RPOC2_OENAR      RR--YLSSLSANNDQ-------------------IRYKFFSSSFSGKKKDDR--SPGYSE
RPOC2_OENPA      RR--YLSSLSANNDQ-------------------IRYKFFSSSFSGKKKDDR--SPGYSE
RPOC2_OENEH      RR--YLSSLSANNDQ-------------------IRYKFFSSSFSGKKKDDR--SPGYSE
RPOC2_OENGL      RR--YLSSLSANNDQ-------------------IRYKFFSSSFSGKKKDDR--SPGYSE
RPOC2_OENBI      RR--YLSSLSANNDQ-------------------IRYKFFSSSFSGKKKDDR--SPGYSE
RPOC2_EUCGG      RR--YISSLSVNNDQ-------------------MRYELCSSDFSGKIKEDR--IPDYSE
RPOC2_AETCO      RK--SICSLSVNNDQ-------------------VSQKFFSSDFSDKKKSGI---PDYSE
RPOC2_AETGR      RK--SICSLSVNNDQ-------------------VSQKFLSSDFSDKKKSGI---PDYSE
RPOC2_ARATH      RK--SISSLSVNNDQ-------------------VSQKFFSSDFADPKKLGI---YDYSE
RPOC2_CAPBU      RK--SISSLSVNNDQ-------------------TSQKFFSSDFADKKKLGI---SYYSE
RPOC2_CRUWA      RK--SISSLSVNNDQ-------------------VSQKFLSSDFADQKKSGI---PDYSE
RPOC2_OLIPU      RK--SISSLSVNNDQ-------------------VSQKVLSSDFADQTKFGI---PDYSE
RPOC2_BARVE      RK--SISSLSVNNDQ-------------------VSQNFLSSDFADKKKSGI---PHYSE
RPOC2_NASOF      RK--SISSFSVNNDQ-------------------VSKKFVSSDFDDKKKSEI---PHYSD
RPOC2_LEPVR      RK--SISSLSVNNDQ-------------------VSQKFLSSDFADKKKSGT---PYYSE
RPOC2_LOBMA      SK--AISSLSVNNDQ-------------------VSQKFFSSDFSDKKKSGI---PNYSE
RPOC2_ARAHI      RK--SISSLSVNNDQ-------------------ASQKFLSSDFYDKKKSGS---PNYSE
RPOC2_DRANE      IK--SISSLSVNNDQ-------------------VSQKFCSSDFYDKKKSGI---TDYSE
RPOC2_SINAL      RK--SISSLSVNNDQ-------------------VSQKFFSSDFSD-KKILI---PNYSE
RPOC2_CARPA      QE--SISSLAVNNDQ-------------------GRHKFFSSNFSDKKKCGI---PDYSE
RPOC2_GOSBA      RR--YISRFSVNNDQ-------------------VRHNLFSSDFSDEKEERI---YDYSE
RPOC2_GOSHI      RR--YISRFSVNNDQ-------------------VRHNLFSSDFSDKKEERI---YDYSE
RPOC2_CITSI      RREISSLSLSVNNDQ-------------------TGHKFFSSDFSAKKKGRILEMSDYSG
RPOC2_CUCSA      R--RYISSLSVNNDK-------------------VGQKFYGPDLSG--KNENG-IPDYSE
RPOC2_MORIN      KG-KARNSFSVNNDQDQ-----------------GKHKFFTSGLSG--KKESG-IPDYSE
RPOC2_POPAL      R--GYISNPSENNDK-------------------VKHKFFSSYLSSKSKKKSR-ILDYSD
RPOC2_POPTR      R--GYISNPSVNNDK-------------------VKHKFFSSYLSSKSKKKSR-ILDYSD
RPOC2_MANES      R--RYISSPSVNNDQ-------------------VKHKFFSSDFSG--KKESG-IPDYSE
RPOC2_VITVI      R--RYISNPSVTNDQ-------------------VIHEFFSSDLSG--KKEGR-IPAYSE
RPOC2_WELMI      QKN--CFDPSVNLLQ-------------------------SNSVSFQNPK-----LEEEK
RPOC2_ADICA      RIR--------SHSEGI-----------------FEAQASASNCVDRRKG----IQEFGT
RPOC2_CHAGL      LNI----NFQVYNKK---------------------LNFYQKSIRNSKKN----------
RPOC2_ACAM1      TKLVTEHGGVVRLP------------------------------------------VQEE
RPOC2_THEEB      TTVKTEHGGVVRLP------------------------------------------EQQD
RPOC2_NOSS1      TKLTTIHGGVVRLP------------------------------------------EATP
RPOC2_TRIV2      TKLTTIHGGVVRLP------------------------------------------EATP
RPOC2_NOSP7      TKLASLHGGVVRLP------------------------------------------EATP
RPOC2_SYNE7      TKLTTERGGTVRMG------------------------------------------EDNG
RPOC2_SYNP6      TKLTTERGGTVRMG------------------------------------------EDNG
RPOC2_TRIEI      TKLVTEHGGVIRISSSPLYSPEKQNETNVLAQATQESTIDELEASMTGTSAQLPINTEMP
RPOC2_CROS5      TKLISVNGGVVRYQ----------------------------------------------
RPOC2_SYNY3      TKLVTNDGGVVRLV----------------------------------------------
RPOC2_MICAN      TKLVSTNGGLVRLA----------------------------------------------
RPOC2_SYNP2      TKLVSLSGGVVRLI----------------------------------------------
RPOC2_SYNJB      TSLVTEHGGIVRLP------------------------------------------ERSD
RPOC2_SYNJA      TSLVTEHGGIVRLP------------------------------------------ERSD
RPOC2_GLOVI      TRLVTEHGGGVRLK------------------------------------------EQ-D
RPOC2_PROMA      ASQSSEFGGEVRLR--------------------------------------------DS
RPOC2_PROM4      ASQASEFGGEVRLR--------------------------------------------DS
RPOC2_PROM1      ASQASEFGGEVRLR--------------------------------------------DS
RPOC2_PROMT      ASQASEFGGEVRLR--------------------------------------------DS
RPOC2_PROM3      ASQASEFGGEVRLR--------------------------------------------DS
RPOC2_PROMM      ASQASEFGGEVRLR--------------------------------------------DS
RPOC2_SYNS3      ASQASEYGGAIRLR--------------------------------------------EA
RPOC2_SYNPW      ASQASEYGGAIRLR--------------------------------------------EA
RPOC2_SYNSC      ASQRSEYGGEVRLR--------------------------------------------DS
RPOC2_SYNPX      ASQRSEYGGDVRLR--------------------------------------------DS
RPOC2_SYNS9      ASQRSEFGGDVRLR--------------------------------------------DS
RPOC2_PROMS      ASQSSEFGGQVRLR--------------------------------------------ES
RPOC2_PROM0      ASQSSEFGGQVRLR--------------------------------------------ES
RPOC2_PROM2      ASQSSEFGGQVRLR--------------------------------------------ES
RPOC2_PROM9      ASQSSEFGGQVRLR--------------------------------------------ES
RPOC2_PROM5      ASQYSEFGGEVRLR--------------------------------------------ES
RPOC2_PROMP      ASQSSEFGGEVRLR--------------------------------------------ES
RPOC2_SYNR3      SRQVSEFGGAVRLR--------------------------------------------ES
RPOC2_PAUCH      SRLSSEHGGVVRLR--------------------------------------------ES
RPOC2_GUITH      FKTISEYNGIVRLN------------------------------------------EKN-
RPOC2_RHDSA      SKVISDYGGLVRLN------------------------------------------QSNQ
RPOC2_PORPU      TELINQYSGKVRIY------------------------------------------QNTS
RPOC2_PYRYE      TELINHYAGEVRIH------------------------------------------QNTN
RPOC2_GRATL      TEFVSRYEGRVRIL------------------------------------------KKKQ
RPOC2_CYAPA      TQFISQYGGYVRLT----------------------------------------------
RPOC2_CYACA      ALIKSRHSGISRIR---------------------------------------------C
RPOC2_EMIHU      TPLYNKYPGWVQID---------------------------------------------K
RPOC2_PHATC      TKIINHYSGSVEFIN-------------------------------------------TK
RPOC2_THAPS      TKLINQYSGYTKVLN-------------------------------------------QN
RPOC2_TRICV      TKLINDFSGFTVFTN-------------------------------------------SK
RPOC2_CHLVU      TSHQSFVGSTTRVFLLK------------------------------------------T
RPOC2_OSTTA      PSRLTTTLPLGYVFPID------------------------------------------S
RPOC2_BIGNA      TFNSKNFLIKEKLFFIKNNSVLL-------------------------PIFSSDFFTKFT
RPOC2_CHLAT      QDIATTFGGILKIDFFEKDS---FARENIDSKRIHLTDSISSYNKKPINATTRAAENSSL
RPOC2_MESVI      HNIISQYGGILQTS----------------------------------------ENNLTI
RPOC2_NEPOL      TKQVVSEEGRIIYRYDEK-------RGKEQTIITHAFGSVQFDGVDAWLPTKSQGIKQSI
                                                                             

RPOC2_STAPU      NYSKVFLLSIYNRQRSVTFSVSRRDIRLGRK--KKFTDYIPLSRISTDKIFSKHTGSIHT
RPOC2_ZYGCR      FDTHKISNKKVLKSVLIGKFTRFKQVKSIQT--GTVRSVLIQKPDTLRMVVLSSVDQLEI
RPOC2_CHAVU      NNGGRYHNFHSQRLSYFQENLMNNSYTHSKKKTKSLSSNFVNNAICGLTILKEKKGKFSF
RPOC2_ANEMR      FN------SSN---QSVNSNIILYDYDVV-------RKHR-------------TFFLREM
RPOC2_MARPO      LN------KIN---NSKNYNFILQEYNIK-------KKKN-------------FYFLKNK
RPOC2_PHYPA      LN------NFW---NSIYSSIILYNYRFL-------EKKN-------------NKYEKK-
RPOC2_ANTAG      LN------KSR---NFVYPSIILHDYEVK-------RIYDE-KKGENFLLLEERHGEKKT
RPOC2_ANGEV      SK------ITP---NPSDSTNILSNIELK-------RNRRKNRVILLLGRVKSR---YRK
RPOC2_PSINU      TI------KTY---KFPYLTSLF-YCKIR-------KDKTENKVILSIKPIQRRNKYYRK
RPOC2_PINKO      TETDRTISNEH--RDSIYVTFSPKNYN-------MKGKKQMNRFIVSLQCDKEWG--KRI
RPOC2_PINTH      TETDRTISNKH--RDSIYVFY-PNNYN-------IKGKKQMNRFIVSLQCDKEWE--KKI
RPOC2_CYCTA      I--DRVISNEH--WDSIYSTISSDNFN-------ISGKKQRNRFFVPLRYDKERG--NKG
RPOC2_CRYJA      T--DRTIPNEH--KDSIYSAILFENTH-------MSVKKEKNKLIVPLWCDKQWG--KRR
RPOC2_AGRST      S--DRIMANGH--WNLIYPSIFQDNSD-------LLAKKRRNRFVIPLQYHQEQE--KEL
RPOC2_LOLPR      L--VRIMPNGH--WNLIYPSIFKENSD-------LLAKKRRNRFVIPLQYHQEQE--KEL
RPOC2_HORVU      S--DRIMSNGH--WNLIYPSIFQDNSD-------LLAKKRRNRFVIPLQYHQEQE--KEL
RPOC2_WHEAT      S--DRIMSNGH--WNFIYPSIFQDNSD-------LLAKKRRNRFVIPLQYHQEQE--KEL
RPOC2_SACHY      P--DRIVSNGH--WNCFYPSILQDNSD-------LLAKKRRNRFVVPLQYHQEQE--KER
RPOC2_SACOF      P--DRIVSNGH--WNCFYPSILQDNSD-------LLAKKRRNRFVVPLQYHQEQE--KER
RPOC2_SORBI      P--DRIVSNGH--WNCFYPSILQDNSD-------LLAKKRRNRFAVPLQYHQEQE--KER
RPOC2_MAIZE      P--DRIVFNGH--WNCFYPSILQDNSD-------LLAKKRRNRLVVPLQYHQEQE--KER
RPOC2_ORYNI      P--DRIMSNGH--WNFVYPSILQNNFD-------LLAKKRRNRFAIPLQYHQEQE--KEP
RPOC2_ORYSI      P--DRIMSNGH--WNFVYPSILQNNFD-------LLAKKRRNRFAIPLQYHQEQE--KEP
RPOC2_ORYSA      P--DRIMSNGH--WNFVYPSILQNNFD-------LLAKKRRNRFAIPLQYHQEQE--KEP
RPOC2_ORYSJ      P--DRIMSNGH--WNFVYPSILQNNFD-------LLAKKRRNRFAIPLQYHQEQE--KEP
RPOC2_DIOEL      S--DRIISNGH--WNLISPSILQDNLD-------FLAKRRRNRFIIPLQYDQERE--KEL
RPOC2_PHAAO      P--YRIISKGH--WNLIEPSTYIRQEN-------SLAKKRRNRFVIPLQYDQEQE--NKL
RPOC2_LEMMI      P--DGSISNGH--WNLQYPFILHENSD-------FLAKRRRNKFIIPLQYDQERD--KEL
RPOC2_ACOCL      P--DQIISKGH--WNFIYPSILHENSD-------FLAKRRKNRFIIPFQYDQEGE--KEL
RPOC2_AMBTC      P--DRIISNRN--WDSIYPLILHENSD-------LLAKRRRNRFIIPFQYDQEQE--KEL
RPOC2_NYMAL      S--ERVISNGD--GDFIYPAILRENSY-------LLAKRRRNRFIIPFQYDPEWE--KEL
RPOC2_ILLOL      P--DRILSNGH--WDFIYPAILHENSN-------LLAKRRRNRFIISFQHDQERE--KKL
RPOC2_CALFG      P--DRIISNGH--WNFIYPAILHENSD-------LLAKRRRNRFIIPFQSDQERE--KEL
RPOC2_LIRTU      P--DRIVSNGH--WNFLYPAILHENSD-------LLAKRRRNRFIIPFQYDQERE--KEL
RPOC2_DRIGR      P--ARIISNGH--WNFIYPAILHENSY-------LLAKRRRNRFIIPFQYDQERE--KEL
RPOC2_CHLSC      P--DRIISNGHGHWNFIYPAILHENSD-------LLAKRRRNRFIIPFQYDQERE--KEL
RPOC2_CERDE      P--DRIVSNSQ----FLYPAIPHENSD-------LLAKRRRNRFLIPFQYDQEQE--KEL
RPOC2_PIPCE      P--DKSIPNDC--WNFIYSAILHENSY-------FLAKRRRNRFIIPFQYSQEGE--KEP
RPOC2_BUXMI      P--NRIICNGH--LNFIYPTILHENSD-------LLAKRRRNRFILPLQ--SNQEREKEL
RPOC2_PLAOC      T--DRIICNGH--CNFIYPSILHENSD-------LLAKRRRNRFIIPFQ--SNQEREKEL
RPOC2_NANDO      P--NRIICNGH--CNFIYPAILHENSY-------LLAKRRRNRFIIPFQ--YNQEQEKEL
RPOC2_RANMC      P--AEVLCNGH--CNLIYSAILDENSD-------LLAKRRRNRFTIPLQ--SNQ--EKEQ
RPOC2_SOLBU      L--NRIICTGQ--YNLVYSPILHGN-------SDLLSKRRRNKFIIPLH--SIQELENEL
RPOC2_SOLTU      L--NRIICTGQ--YNLVYSPILHGN-------SDLLSKRRRNKFIIPLH--SIQELENEL
RPOC2_SOLLC      L--NRIICTGQ--YNLVYSPILHGN-------SALLSKRRRNKFIIPLH--SIQELENEL
RPOC2_ATRBE      L--NRIICTGQ--YNLVYSPILHEN-------SDLLSKRRRNKFIIPLH--SIQELENEL
RPOC2_NICSY      L--NRIICAGQ--YNLVYSPILHEN-------SDLLSKRRRNKFIIPLH--SIQELENEL
RPOC2_TOBAC      L--NRIICAGQ--YNLVYSPILHEN-------SDLLSKRRRNKFIIPLH--SIQELENEL
RPOC2_NICTO      L--NRIICAGQ--YNLVYSPILHEN-------SDLLSKRRRNKFIIPLH--SIQELENEL
RPOC2_COFAR      L--NRIICTGY--CNRIYPAILHEN-------SDLLSKRRRNRFIMPLQ--SIQERENE-
RPOC2_JASNU      L--NQILCTGH--CNFISPTTLHQN-------SDLFSKRRKNKFLIPLQ--SIQEPENKL
RPOC2_CUSEX      V--NRSICTDH--YNLVYPAILPILDENSSFFSNCLSKRRRNQFIIPLQ--SIQEHKNEL
RPOC2_CUSRE      V--NPSRCTDH--YNLVYPAILPILDENSYFFSNCLSKRRRNQFIIPLQ--SIQEHKNQL
RPOC2_IPOPU      L--NRIICTDH--SNLVYPAILPILAENSDFLSNLLSKRRRNQFIIPLQ--SIQERKKEL
RPOC2_DAUCA      L--NRI---VR--CNLRYPTIPYAD-------YDLLAKRRRKRFIIPLQ--SIQERENEL
RPOC2_PANGI      L--NRI---GH--CNLPYLAILHAN-------SDLLAKRRRNRFIIPLQ--SIQEHENEL
RPOC2_GUIAB      L--NRMTCTGR--CNLRYPGILDGN-------SDLLAKRRRNRVIIPLD--SIQEGENQL
RPOC2_HELAN      L--NRMTCTGR--CNLRYPGILDGN-------SDLLAKRRRNRVIIPLD--SIQEGENQL
RPOC2_LACSA      L--NRMTCTDH--SNLRYPAILDGN-------SDLLAKRRRNRFIIPLE--SIQEGENQL
RPOC2_SILLA      -----LNGMSH--CNHIYPAK---N-------SDLLAKRRKNRLIIPFQFQLSQEREKEL
RPOC2_SPIOL      -----LNRIGH--CNLIYPAK---N-------LDLLAKKRRNRFIIPFQ--GSQERKKEL
RPOC2_FAGEA      R--KRIVRTRH--SNLIYPAK---N-------SYLLGKRRRNRFMTTFQ--SIQELEKEL
RPOC2_SOYBN      F--NQIISIDH--CHFTHPTIFHDTTD-------LLAKRRRNRLIIPFQFQSIQERDKEL
RPOC2_PHAVU      I--NQIICIDH--CHFTHPAIFHDTTD-------LLAKRRRNRFIIPFQFQSIQERDKAL
RPOC2_LOTJA      ------LCPDH--CHFMHPTISPDTSN-------LLAKKRRNRFIIPFLFRSIRERNNEL
RPOC2_PELHO      M--TRSLSTAR--CNLLYPAILHENFS-------LLAKKRRTRFLIPFQSIQEHRRKNER
RPOC2_OENAR      M--NRIICTLP--CNLIYPSILRENSD-------LLAKRRRNRLVIPVQSSQERE--KEL
RPOC2_OENPA      M--NRIICTLP--CNLIYPSILRENSD-------LLAKRRRNRLVIPVQSSQERE--KEL
RPOC2_OENEH      M--NRIICTLH--CNLIYPSILRENSD-------LLAKRRRNRLVIPVQSSQERE--KEL
RPOC2_OENGL      M--NRIICTLH--CNLIYPSILRENSD-------LLAKRRRNRLVIPVQSSQERE--KEL
RPOC2_OENBI      M--NRIICTLH--CNLIYPSILRENSD-------LLAKRRRNRLVIPVQSSQERE--KEL
RPOC2_EUCGG      L--NRIISIVH--CNLKYPTTFDENSD-------LLAKRRRNRFLIPLQSIQERK--KEL
RPOC2_AETCO      L--NGIVGTSH--YNLIYSAIFHENSD-------LLAKRRRNRFLIPFESIQEQEQEKEF
RPOC2_AETGR      L--NGIVGNSH--YNLIYSAIFHENSD-------LLAKRRRNRFLIPFQSIQEQE--KEF
RPOC2_ARATH      L--NGNLGTSH--YNLIYSAIFHENSD-------LLAKRRRNRFLIPFQSIQEQE--KEF
RPOC2_CAPBU      L--NGNLGTSH--YNFIYSAIFQENSD-------LLAKRRRNRFLIPFQSIQEQE--KEF
RPOC2_CRUWA      L--NGNLGTSH--YNFIYSAIFHKNSD-------LLAKRRRNRFLIPFQSIQEQE--KEF
RPOC2_OLIPU      F--KGNLGTSH--YNFIYSAIFHENSD-------LLAKRRRNRFLIPFQSIQEQE--KEF
RPOC2_BARVE      L--NGNLGTSH--YNFIYSAIFHENSD-------LLAKRRRNRFLIPFQSIQEQE--KEF
RPOC2_NASOF      L--NGNLGTSH--YNFIYSAIFHENSD-------LLAKRRRNRFIIPFQSIQEQE--KKF
RPOC2_LEPVR      L--NGILGTSH--YNFIYSAIFHENSD-------LLAKRRRNRFLIPFQPIQEQE--KEF
RPOC2_LOBMA      L--NEIVGTSH--YNFIYSAIFHENSD-------LLAKRRRNRFLIPFQSIQEQE--KEF
RPOC2_ARAHI      L--NGIIGTSH--YNFIYSTIFHENSD-------LLAKRRRNRFLIPFQLIQEQE--KEF
RPOC2_DRANE      L--NGIVGTSH--YNFIYSTIFHENSD-------LLAKRRRNRFLIPFQSIQEQE--KEF
RPOC2_SINAL      L--NGIVGTSH--YNFIYSAIFHENSD-------LLAKRRRNRFLIPFQSIQEQEQEKEF
RPOC2_CARPA      F--HRILDTGH--CNLIYFASLHENSD-------LLAKRRRNRFIIPFQSIQEQE--KEL
RPOC2_GOSBA      L--NRIIGTGH--CDFIYSAILHENAD-------LLAKRRRNRFIIPFQLIQDQEKELML
RPOC2_GOSHI      L--NRIIGTGH--CDFIYSAILHENAD-------LLAKRRRNRFIIPFQLIQDQEKELML
RPOC2_CITSI      F--NRIISTGH--CNLIHPAILHANSD-------LLAKRQRNGFLIPFHSIQEQE--KEL
RPOC2_CUCSA      L--NPILCTGQ--SNLTYPAIFHGNSD-------LLAKRRRNGFIIQFESLQERE--KEL
RPOC2_MORIN      F--NRILDTDH--SNLIFPSILHKDSDL-----FLLAKRRRNRFIIPFQWIQERE--KEL
RPOC2_POPAL      L--NRIICTG-----FIYPTILHENSD-------LLAKRRKNRFIIPFQSIQE----KEL
RPOC2_POPTR      L--NRMICTG-----FIYPTILHENSD-------LLAKRRKNRFIIPFQSIQE----KEL
RPOC2_MANES      L--NRSICTGH--CNLIYSTILYKNSD-------LLAKRRRNKFIIPFQSIQERE--KEL
RPOC2_VITVI      L--NRIIYTGR--YNLIDPAILHENSD-------LLAKRRRNRFIIPFQSIQEGE--KEL
RPOC2_WELMI      LEEEKLEEEPD--QSSISVPIFLENFN-------IQGKKQINRVLVPFFYAPKRK--TKR
RPOC2_ADICA      D--SKYFSNWS---KRPRSNYILSNVW---------LERAELENSVSLLMERCQKNIKKL
RPOC2_CHAGL      ---INNLINSTEFLNINSSAIFATYRY-------KNTKMNENNPNIFSETNLNKYSLKKF
RPOC2_ACAM1      GKGGREVEIITASVLLDQAKVWLESLQGRDQ---YVIEAQKKQRFLLKAAPGTK------
RPOC2_THEEB      SKGGREVEIITASVMLDKAKVLKETQQGREH---YIIETATGQRFSLKAAPGTK------
RPOC2_NOSS1      GKSTREIEIITASVVLDQATVTVQSSQGRNN---YLITTGNNQVFNLRATPGTK------
RPOC2_TRIV2      GKSTREIEIITASVVLDQATVTVQSSQGRNN---YLITTGNNQVFNLRATPGTK------
RPOC2_NOSP7      GKSTREIEIITASVVLDQATVTVQSSQGRNN---YLVSTGNNQVFNLRATPGTK------
RPOC2_SYNE7      SSTHREVEIITASVVLDTATVKAEASQGREH---YVIETKGGQRFNLLAAPGTK------
RPOC2_SYNP6      SSTHREVEIITASVVLDTATVKAEASQGREH---YVIETKGGQRFNLLAAPGTK------
RPOC2_TRIEI      DNLPREIEVITASVRLDQAKVRLESISNREQ---YIIETQNDQRFALKVTPGSK------
RPOC2_CROS5      -PQSREIDIITASVLLDQAEVRKESTGGHEQ---YVIYTADGQRFLLKATPETK------
RPOC2_SYNY3      -S-NREIEIITASVLLDQAQVKLESSGGREQ---YVIYTADKQRFLLKAAPGTK------
RPOC2_MICAN      -PNSREIDIVTASVSLDQAEVKVESSAGREQ---FIIHTGDGQSFLLKTTPGTK------
RPOC2_SYNP2      -PNSREIEIVTASVLLDEAKVLHETGGGSEQ---YIIETSKGDQFLLKTAPGTK------
RPOC2_SYNJB      TRSGREVEIINASVVLREARVRVESHQGREQ---FLLDTSSGQTFVLKATPGTK------
RPOC2_SYNJA      TKSGREVEIINAAVVLHEARVRVESHQGREQ---FLLDTASGQTFVLKATPGTK------
RPOC2_GLOVI      AKGGREVEIITASVMLDKAIVHEEKSQGREH---YSLETDNGQVFALKVSPGTK------
RPOC2_PROMA      IGDSREVQIVTTSMTLKDYNLLEESNHSGEI---WNLEANDGTRYRINSIPGSK------
RPOC2_PROM4      IGDSREVQIVTTSMTLKDFKLLEESTHTGEI---WNLEAKDGTRYRLNSIPGSK------
RPOC2_PROM1      IGDSREVQIVTTSMILNDFKLLEESTHSGEI---WHLEAQDNTRYRLNTIPGSK------
RPOC2_PROMT      IGDSREVQIVTTSMTLDDFKLLEESTHSGEI---WHLEAQDNTRYRLNTIPGSK------
RPOC2_PROM3      IGDSREVQIVTTSMTMKDFKLLGESTHSGEL---WHLEAKEGTRYRLNTIPGSK------
RPOC2_PROMM      IGDSREVQIVTTSMTMKDFKLLGESTHSGEL---WHLEAKDGTRYRLNTIPGSK------
RPOC2_SYNS3      LGDSREVQIVTTSMTLRDFKLLGESTHAGEI---WNLEAKDGTRYRLNTIPGSK------
RPOC2_SYNPW      LGDSREVQIVTTAMTLRDFKLQGESTHAGEI---WNLEAKDGTRYRLNTIPGSK------
RPOC2_SYNSC      IGDSREVQIVTTAMTLKDFKLLEESTHSGEI---WNLEAKDGTRYRLNTIPGSK------
RPOC2_SYNPX      IGDSREVQIVTTAMTLKDFKLLEESTHSGEI---WNLEAKDGTRYRLNTIPGSK------
RPOC2_SYNS9      IGDSREVQIVTTAMTLKDFKLLEESNHSGEL---WNLEAKDGTRYRLNTIPGSK------
RPOC2_PROMS      IGDSREVQIVTTSMSLTNFKLIEESTHSGQI---YNLESIDGISYRLNISPGSK------
RPOC2_PROM0      VGDSREVQIVTTSMSLTNFKLIEESTHSGQI---YNLESSDGISYRLNISPGSK------
RPOC2_PROM2      IGDSREVQIVTTSMSLTNFKLIEESTHSGQI---YNLESSDGTSYRLNISPGSK------
RPOC2_PROM9      VGDSREVQIVTTSMSLNNFKLIEESTHSGQI---YNLESSDGTLYRLNTAPGSK------
RPOC2_PROM5      VGDSREVQIVTTSMLLSNFNLIEESTHSGEI---FHLESNDGTIYRLNTSPGSK------
RPOC2_PROMP      VGDSREVQIVTTSMLLSNFKLIEESTHSGEL---FHLESNDGTIYRLNTSPGSK------
RPOC2_SYNR3      QGDSREVEIVTSSLTLKDCKLVATTTHSGQI---WHLESKDNTRYRLNTEPGTK------
RPOC2_PAUCH      TGDSREVQIVTTSMTLKDFKLLGESTHSGEI---WHLEAKDTTRYLLKTQPGSK------
RPOC2_GUITH      ----EEIQILTDFISLENAEIEYNEL-DVNIECPINLRFEDGKILNLLCVPGNK------
RPOC2_RHDSA      TSNITELQIVTSSVSLDNATIVTDDQKSTNSDPSYTLEMECGIKFHMLCSPGNK------
RPOC2_PORPU      -SSITNIQIITESVTVPACYIRTDVINKKES---YILETDKKQRFLFKSFPDQK------
RPOC2_PYRYE      -SSITNIQVITESIVIPGCYIYTDVIHKKES---YILETEKKQKFLFKAIPNQK------
RPOC2_GRATL      -DFIQDIVIITSSKTYINIDVLTKFYNGYTN---HFLITNQQDKFILKTLPNQT------
RPOC2_CYAPA      -DDNLTVEVIPASLKIQNAKIFIDETDQPCL------HFKNNETFELKIQNETQ------
RPOC2_CYACA      AANYYAIDIILGTVTIRNANLYKDSKLFNNN---YLLKTSNKKNFVVKALVGQK------
RPOC2_EMIHU      SDNGTGICVQNFSVTLTNAFINEKVENSSRL---QIKTDNQDFQFQLTTEPNSV------
RPOC2_PHATC      SNLYQRLIRIKNNK-YAFFNSKLEKLRYSIQHKNYLLNLQGDKYLVKIQKKDLRLYLQ--
RPOC2_THAPS      KNLLEQKIQITNET-YFLENSYVQKILKPITNKNYLLNFNNLTYLITLKDSNSKNWKR--
RPOC2_TRICV      YNLFQRILQLVSNSCWILPNSKIQKLQSSLNKKPYFLNIKKLKYLIDLKLLNSKYFIE--
RPOC2_CHLVU      FEFFSAASKQTQKTALERLPFVDSMSFSLEKIQLKKQNQKRKENPLFSLEVGKVKRNT--
RPOC2_OSTTA      NQTSLSKLQSTDAETLKQLPLLQFSKLSADNLKFARSYALELNKTLFHCDSLSKYRFI--
RPOC2_BIGNA      LKNEYFKPKHNIQRKLGFLSPTSYFKYISNNYFLKYLNFYQKHISVEMNDIIKVKLYY--
RPOC2_CHLAT      NDKNVDIKIFNSLFTLQDVKVYHFDSFRIKEDFIKEKVKDYYLLKSLNPAISKKKRFENT
RPOC2_MESVI      DNSNSYLYVLNSSMTIINAYLSHIKNARSEAYILTDDLNQKFFMQVESNNVIKN------
RPOC2_NEPOL      RTTGGKLSISSQGMTLSATKIKQEGIGSFDWPALAEPSIEEDEELEEAYKKTKDPIIQPT
                                                                             

RPOC2_STAPU      IS----------------------------------------------------------
RPOC2_ZYGCR      TM----------------------------------------------------------
RPOC2_CHAVU      LKNSSFCKKTRT-------------------------------NLQFILEVKNYSRIKHN
RPOC2_ANEMR      YTNLYF---------------------------------------LLEVK--NNGVLRNN
RPOC2_MARPO      NLTCPL---------------------------------------FLKIK--KNGVLKNN
RPOC2_PHYPA      -LLFQF---------------------------------------MLKLP--KNGILKQN
RPOC2_ANTAG      QIFRRF---------------------------------------VLNIP--KSGILENK
RPOC2_ANGEV      KSYSSF---------------------------------------VLDIP--NNGILNQG
RPOC2_PSINU      TPYRDF---------------------------------------VFQTP--TNGILNRG
RPOC2_PINKO      IPCP---------------------------------------DAILRIPKSG--ILQIN
RPOC2_PINTH      IPCP---------------------------------------DAILRIPKSG--ILQRN
RPOC2_CYCTA      ISRP---------------------------------------NLIIKISRNG--ISQRN
RPOC2_CRYJA      IPCP---------------------------------------DFIFRIPRGQGILLNKK
RPOC2_AGRST      ISCL---------------------------------------GISIEIP--FMGVLRRN
RPOC2_LOLPR      ISCL---------------------------------------GISIEIP--FMGVLHRN
RPOC2_HORVU      ISCF---------------------------------------GISIEIP--FMGVLRRN
RPOC2_WHEAT      ISCF---------------------------------------GISIEIP--LMGVLRRN
RPOC2_SACHY      ISCL---------------------------------------GISMEIP--FMGVLRRN
RPOC2_SACOF      ISCL---------------------------------------GISMEIP--FMGVLRRN
RPOC2_SORBI      ISCL---------------------------------------GISMEIP--FMGVLRRN
RPOC2_MAIZE      ISCL---------------------------------------GISMEIP--FMGVLRRN
RPOC2_ORYNI      ISCF---------------------------------------GISIEIP--FMGVLRRN
RPOC2_ORYSI      ISCF---------------------------------------GISIEIP--FMGVLRRN
RPOC2_ORYSA      ISCF---------------------------------------GISIEIP--FMGVLRRN
RPOC2_ORYSJ      ISCF---------------------------------------GISIEIP--FMGVLRRN
RPOC2_DIOEL      IPC--F-------------------------------------DISIEIP--INGILRGN
RPOC2_PHAAO      IPC--F-------------------------------------GISIKIP--INGILRRN
RPOC2_LEMMI      IPH--F-------------------------------------GVSIEIP--INGILRRN
RPOC2_ACOCL      IPH--S-------------------------------------GISIEIP--INGMLRRN
RPOC2_AMBTC      RP---P-------------------------------------GIVIKIP--IKGILRRN
RPOC2_NYMAL      TPHSST-------------------------------------SITVEIP--ANGILRRN
RPOC2_ILLOL      PPR--S-------------------------------------GIKIEIP--INGILRRN
RPOC2_CALFG      MPR--S-------------------------------------GISIEIP--INGILRRN
RPOC2_LIRTU      MPR--S-------------------------------------GISIEIP--INGILRRD
RPOC2_DRIGR      MPR--S-------------------------------------GISIEIP--INGILRRN
RPOC2_CHLSC      MPR--S-------------------------------------GISIEIP--INGIFRRK
RPOC2_CERDE      MCP--Y-------------------------------------GISTEIP--INGILRRN
RPOC2_PIPCE      MPC--S-------------------------------------GISIEIP--KTGILRRN
RPOC2_BUXMI      MPCS---------------------------------------GISIEIP--INGIFRRN
RPOC2_PLAOC      MSRS---------------------------------------DISIEIP--INGIFRRN
RPOC2_NANDO      ITRS---------------------------------------GISIEIP--INGIFRRN
RPOC2_RANMC      KPRS---------------------------------------GISIEIP--INGLFRIN
RPOC2_SOLBU      MPCS---------------------------------------GISIEIP--VNGIFRRN
RPOC2_SOLTU      MPCS---------------------------------------GISIEIP--VNGIFRRN
RPOC2_SOLLC      MPCS---------------------------------------GISIEIP--VNGIFRRN
RPOC2_ATRBE      MPCS---------------------------------------GISIEIP--VNGIFRRN
RPOC2_NICSY      MPCS---------------------------------------GISIEIP--VNGIFRRN
RPOC2_TOBAC      MPCS---------------------------------------GISIEIP--VNGIFRRN
RPOC2_NICTO      MPCS---------------------------------------GISIEIP--VNGIFRRN
RPOC2_COFAR      --SP---------------------------------------GISIEIP--INGIFRRN
RPOC2_JASNU      MPRS---------------------------------------SISIEIP--QNGTFRGN
RPOC2_CUSEX      MPCS---------------------------------------SISMKTPPNANGIFWAN
RPOC2_CUSRE      MPCS---------------------------------------SISMKIPPNANGIFCAN
RPOC2_IPOPU      MPCS---------------------------------------GISMKIP--TNGIFCGN
RPOC2_DAUCA      MPPS---------------------------------------GISIEIP--INGIFRIN
RPOC2_PANGI      MPSS---------------------------------------GISIEIP--IHGIFRKK
RPOC2_GUIAB      IPSS---------------------------------------GISIEIP--RNGILRRN
RPOC2_HELAN      IPSS---------------------------------------GISIEIP--RNGILRRN
RPOC2_LACSA      IPSS---------------------------------------GISMEIP--RNGILRRN
RPOC2_SILLA      MSLS--N------------------------------------GISIEIP--INGIFRRN
RPOC2_SPIOL      MSLS---------------------------------------GISIEIP--INGIFRKN
RPOC2_FAGEA      RAPS---------------------------------------GISIDIP--LNGSFRRN
RPOC2_SOYBN      MLAS---------------------------------------SISIEIP--INGIFRRN
RPOC2_PHAVU      MLAS---------------------------------------SISIEIP--INGLFRRN
RPOC2_LOTJA      M--P---------------------------------------DISVEIP--IDGIIHKN
RPOC2_PELHO      ILCS---------------------------------------DISIKIP--RNGLFRGN
RPOC2_OENAR      IPHS---------------------------------------GISIELP--INGIFRKK
RPOC2_OENPA      IPHS---------------------------------------GISIELP--INGIFRKK
RPOC2_OENEH      IPHS---------------------------------------GISIELP--INGIFRKK
RPOC2_OENGL      IPHS---------------------------------------GISIELP--INGIFRKK
RPOC2_OENBI      IPHS---------------------------------------GISIELP--INGIFRKK
RPOC2_EUCGG      MPHS---------------------------------------GISIELP--INGILRRN
RPOC2_AETCO      MPHS---------------------------------------GISIAIP--INGIFRKN
RPOC2_AETGR      MPHS---------------------------------------GISIAIP--INGIFRKN
RPOC2_ARATH      IPQS---------------------------------------GISVEIP--INGIFRRN
RPOC2_CAPBU      IPHS---------------------------------------GISVEIP--INGIFRRN
RPOC2_CRUWA      IPHS---------------------------------------GISIEIP--INGIFRRN
RPOC2_OLIPU      IPHS---------------------------------------GISIEIP--INGIFRRN
RPOC2_BARVE      IPHS---------------------------------------GISIEIP--INGIFRRN
RPOC2_NASOF      IPHS---------------------------------------GISIEIP--INGIFRRN
RPOC2_LEPVR      IPHS---------------------------------------GISIEIP--INGIFRRN
RPOC2_LOBMA      IPHS---------------------------------------GISIEIP--INGIFRRN
RPOC2_ARAHI      IPHL---------------------------------------GISIEIP--ITGIFRRN
RPOC2_DRANE      IRHS---------------------------------------GISIEIP--INGIFRRN
RPOC2_SINAL      IPHS---------------------------------------GISVEIP--INGIFRRN
RPOC2_CARPA      MPRS---------------------------------------GISIEIP--INGIFRRN
RPOC2_GOSBA      HSHS---------------------------------------GISMEIP--INGIFRRK
RPOC2_GOSHI      HSHS---------------------------------------GISMEIP--INGIFRRK
RPOC2_CITSI      MPHS---------------------------------------GISIEIP--VRGIFRRN
RPOC2_CUCSA      RPPS---------------------------------------GISIEIP--INGIFRRN
RPOC2_MORIN      WPRS---------------------------------------SISIEIP--INGIFRKN
RPOC2_POPAL      MSHS---------------------------------------DILIEIP--INGIFRRN
RPOC2_POPTR      MSHS---------------------------------------DILIEIP--INGIFRRN
RPOC2_MANES      MTQS---------------------------------------AISIEIP--INGIFRRN
RPOC2_VITVI      MPPS---------------------------------------GISIEIP--INGIFRRN
RPOC2_WELMI      KKRKNYP------------------------------------NCILKIP--RSGFLHRN
RPOC2_ADICA      DFVS----------------------------------------INVQLN----NGSDQD
RPOC2_CHAGL      YNFV------------------------------------------LEKN---QKFISNN
RPOC2_ACAM1      --------------------------------------------------------VING
RPOC2_THEEB      --------------------------------------------------------VANG
RPOC2_NOSS1      --------------------------------------------------------VQNG
RPOC2_TRIV2      --------------------------------------------------------VQNG
RPOC2_NOSP7      --------------------------------------------------------VQNG
RPOC2_SYNE7      --------------------------------------------------------VTTG
RPOC2_SYNP6      --------------------------------------------------------VTTG
RPOC2_TRIEI      --------------------------------------------------------VGNH
RPOC2_CROS5      --------------------------------------------------------VQNH
RPOC2_SYNY3      --------------------------------------------------------VQNH
RPOC2_MICAN      --------------------------------------------------------VQNH
RPOC2_SYNP2      --------------------------------------------------------VQNN
RPOC2_SYNJB      --------------------------------------------------------VGND
RPOC2_SYNJA      --------------------------------------------------------VGND
RPOC2_GLOVI      --------------------------------------------------------VNNG
RPOC2_PROMA      --------------------------------------------------------IGNN
RPOC2_PROM4      --------------------------------------------------------ISSG
RPOC2_PROM1      --------------------------------------------------------IGNN
RPOC2_PROMT      --------------------------------------------------------IGNN
RPOC2_PROM3      --------------------------------------------------------IGNG
RPOC2_PROMM      --------------------------------------------------------IGNG
RPOC2_SYNS3      --------------------------------------------------------IGNA
RPOC2_SYNPW      --------------------------------------------------------IGSG
RPOC2_SYNSC      --------------------------------------------------------IGSG
RPOC2_SYNPX      --------------------------------------------------------IGSG
RPOC2_SYNS9      --------------------------------------------------------IGNG
RPOC2_PROMS      --------------------------------------------------------ISNG
RPOC2_PROM0      --------------------------------------------------------ISNG
RPOC2_PROM2      --------------------------------------------------------INSG
RPOC2_PROM9      --------------------------------------------------------VSNG
RPOC2_PROM5      --------------------------------------------------------ISSG
RPOC2_PROMP      --------------------------------------------------------ISSG
RPOC2_SYNR3      --------------------------------------------------------IANG
RPOC2_PAUCH      --------------------------------------------------------IGNG
RPOC2_GUITH      --------------------------------------------------------ITNS
RPOC2_RHDSA      --------------------------------------------------------IVNS
RPOC2_PORPU      --------------------------------------------------------ISDG
RPOC2_PYRYE      --------------------------------------------------------IQDG
RPOC2_GRATL      --------------------------------------------------------IVDQ
RPOC2_CYAPA      --------------------------------------------------------LKHG
RPOC2_CYACA      --------------------------------------------------------LSHS
RPOC2_EMIHU      --------------------------------------------------------LKQG
RPOC2_PHATC      --------------------------------------------------------ATRN
RPOC2_THAPS      --------------------------------------------------------CKKY
RPOC2_TRICV      --------------------------------------------------------ISSN
RPOC2_CHLVU      --------------------------------------------------------QQRL
RPOC2_OSTTA      --------------------------------------------------------TSDL
RPOC2_BIGNA      --------------------------------------------------------KQEF
RPOC2_CHLAT      SEKKKTHIDSTLKRETNDQGVSYNGHAAVATTNEIKDYLFSNSCNPWNLELSSDLKVKRD
RPOC2_MESVI      -----------------------------------------------------------N
RPOC2_NEPOL      PYPLQYCVLPEQK-------------------------YVIQAQEGWIISVLGGQSVGAS
                                                                             

RPOC2_STAPU      ------------------------------------------------------------
RPOC2_ZYGCR      ------------------------------------------------------------
RPOC2_CHAVU      DLLATLHNPAHRTSTAGM------------------------------------------
RPOC2_ANEMR      DFFAITDHPKYELKESGV------------------------------------------
RPOC2_MARPO      EIFAILDDPSYKVKNSGI------------------------------------------
RPOC2_PHYPA      DIFAIFNDPKYRIKNSGI------------------------------------------
RPOC2_ANTAG      DIFAISNDPGYGIQSPGI------------------------------------------
RPOC2_ANGEV      DILAISESPQYQTEISGI------------------------------------------
RPOC2_PSINU      DILAIHENPEYRIHISGV------------------------------------------
RPOC2_PINKO      SIFGYSN-----------------------------------------------------
RPOC2_PINTH      SIFGYSN-----------------------------------------------------
RPOC2_CYCTA      DIFAVLDDPRYRINSSGI------------------------------------------
RPOC2_CRYJA      HIFAFLND----------------------------------------------------
RPOC2_AGRST      TIFAYFDDPRYRKDKKGSGIVKFRYRTLEEEYRTREE---------------------DL
RPOC2_LOLPR      TIFAYFDDPRYRKDKKGSGIVKFRYRTLEEEYRTREE---------------------DS
RPOC2_HORVU      TIFAYFDDPRYRKDKKGSGIVKFRYRTLEEEYRTRAE---------------------DS
RPOC2_WHEAT      TIFAYFDDPRYRKDKKGSGIVKFRYRTLEEEYRTRAE---------------------DS
RPOC2_SACHY      TIFAYFDDPRYRKDKRGSGIVKFRYRTLEEEYRTQEEEYRTREEEYRTREEEYRTREEDS
RPOC2_SACOF      TIFAYFDDPRYRKDKRGSGIVKFRYRTLEEEYRTQEEEYRTREEEYRTREEEYRTREEDS
RPOC2_SORBI      TIFAYFDDPRYRKDKRGSGIVKFRYRTLEEEYRTREEEYRTREE--------------DS
RPOC2_MAIZE      TIFAYFDDPRYRKDKRGSGIVKFRYRTLEEEYRTQEEEYRTREEEYRTREE-------DS
RPOC2_ORYNI      TIVAYFDDPRYKKDKKGSGIVKFRYRTLEDEYRTREK---------------------DS
RPOC2_ORYSI      TIVAYFDDPRYKKDKKGSGIVKFRYRTLEDEYRTREK---------------------DS
RPOC2_ORYSA      TIVAYFDDPRYKKDKKGSGIVKFRYRTLEDEYRTREK---------------------DS
RPOC2_ORYSJ      TIVAYFDDPRYKKDKKGSGIVKFRYRTLEDEYRTREK---------------------DS
RPOC2_DIOEL      SILAYFDDPVYRRSSSGI------------------------------------------
RPOC2_PHAAO      SIIAYFDDPRYRRSSSGI------------------------------------------
RPOC2_LEMMI      SILAYFDDPRYRRNSSGI------------------------------------------
RPOC2_ACOCL      SILAYFDDTRYRRSSSGI------------------------------------------
RPOC2_AMBTC      SILAYFDDPRYRRSSSGI------------------------------------------
RPOC2_NYMAL      SILAYFDDPRYRRSSSGI------------------------------------------
RPOC2_ILLOL      SILAYFDDPRYRRSSSGI------------------------------------------
RPOC2_CALFG      SILAYFDDPRYRRSSSGI------------------------------------------
RPOC2_LIRTU      TILAYFDDPRYRRSSSGI------------------------------------------
RPOC2_DRIGR      SILAYFDDPRYRRSSSGI------------------------------------------
RPOC2_CHLSC      SILAYFDDPRYRKSSSGI------------------------------------------
RPOC2_CERDE      SILAYFDDPRYRRSSSGI------------------------------------------
RPOC2_PIPCE      TILAYFDDPRYRRSGSGI------------------------------------------
RPOC2_BUXMI      SILAYFDDPLYRRKSSGI------------------------------------------
RPOC2_PLAOC      SILAYFDDPRYRRNNSGI------------------------------------------
RPOC2_NANDO      SILAYFDDPRYRRNSSGI------------------------------------------
RPOC2_RANMC      SILAYFEDPRYRRKSSGI------------------------------------------
RPOC2_SOLBU      SILAYFDDPRYRRKSSGI------------------------------------------
RPOC2_SOLTU      SILAYFDDPRYRRKSSGI------------------------------------------
RPOC2_SOLLC      SILAYFDDPRYRRKSSGI------------------------------------------
RPOC2_ATRBE      SILAYFDDPRYRRKSSGI------------------------------------------
RPOC2_NICSY      SILAYFDDPRYRRKSSGI------------------------------------------
RPOC2_TOBAC      SILAYFDDPRYRRKSSGI------------------------------------------
RPOC2_NICTO      SILAYFDDPRYRRKSSGI------------------------------------------
RPOC2_COFAR      SILSYFDDPRYRRKSSGI------------------------------------------
RPOC2_JASNU      SILAYFDDPRYRRKGSGI------------------------------------------
RPOC2_CUSEX      SILAYFDDPRYRRNNSGS------------------------------------------
RPOC2_CUSRE      SILAYFDDPRYRRNNSGS------------------------------------------
RPOC2_IPOPU      SIIAYFDDPRYRRMSSGS------------------------------------------
RPOC2_DAUCA      SILAFFDDPRYRRKSSGI------------------------------------------
RPOC2_PANGI      SIIAYFDDPRYRRKSSGI------------------------------------------
RPOC2_GUIAB      SILAYFDDPRYIRKSSGL------------------------------------------
RPOC2_HELAN      SILAYFDDPRYIRKSSGL------------------------------------------
RPOC2_LACSA      SILAYFDDPRYIRKSSGL------------------------------------------
RPOC2_SILLA      SIFAYFNDPRYRTKSSGI------------------------------------------
RPOC2_SPIOL      SIFAYFDDPRYRRKSSGI------------------------------------------
RPOC2_FAGEA      SILAYFDDPRYRRESAGI------------------------------------------
RPOC2_SOYBN      SILAYFDDPQYRTQSSGI------------------------------------------
RPOC2_PHAVU      SIFAYFDDPQYRTQSSGI------------------------------------------
RPOC2_LOTJA      SILAYFDDPQYRTQSSGI------------------------------------------
RPOC2_PELHO      SILAYFDDPRYKIGVSGI------------------------------------------
RPOC2_OENAR      SILAFFDDPRYRTKSSGI------------------------------------------
RPOC2_OENPA      SILAFFDDPRYRTKSSGI------------------------------------------
RPOC2_OENEH      SILAFFDDPRYRTKSSGI------------------------------------------
RPOC2_OENGL      SILAFFDDPRYRTKSSGI------------------------------------------
RPOC2_OENBI      SILAFFDDPRYRTKSSGI------------------------------------------
RPOC2_EUCGG      SILAYFDDPRYRRKSSGI------------------------------------------
RPOC2_AETCO      TIFSFFDDPRYRRKSSGI------------------------------------------
RPOC2_AETGR      SIFSFFDDPRYRRKSSGI------------------------------------------
RPOC2_ARATH      SIFAFFDDPRYRRKSSGI------------------------------------------
RPOC2_CAPBU      SIFAFFDDPRYRRKSSGI------------------------------------------
RPOC2_CRUWA      SIFAFFDDPRYRRKSSGI------------------------------------------
RPOC2_OLIPU      SIFAFFDDPRYRRKSSGI------------------------------------------
RPOC2_BARVE      SIFAFFDDPRYRRKSSGI------------------------------------------
RPOC2_NASOF      SIFAFFDDPRYRRKSSGI------------------------------------------
RPOC2_LEPVR      SIFAFFDDPRYRRKSSGI------------------------------------------
RPOC2_LOBMA      SIFAFFDDPRYRRKSCGI------------------------------------------
RPOC2_ARAHI      SIFAFFDDPRYRRKSSGI------------------------------------------
RPOC2_DRANE      SIFAFFDDPRYRRKSSGI------------------------------------------
RPOC2_SINAL      SIFAFFDDPRYRRKSSGI------------------------------------------
RPOC2_CARPA      SILAFFDDPRYRRKSSGI------------------------------------------
RPOC2_GOSBA      GILAFFDDPRYRRKSSGI------------------------------------------
RPOC2_GOSHI      SILAFFDDPRYRRKSSGI------------------------------------------
RPOC2_CITSI      SILAYFDDPRYRRKSSGI------------------------------------------
RPOC2_CUCSA      SILAFFDDPQYRRNSSGI------------------------------------------
RPOC2_MORIN      SILAYFDDLQYRRKGSGI------------------------------------------
RPOC2_POPAL      SIFAYFDDPQYRRKSSGI------------------------------------------
RPOC2_POPTR      SIFAYFDDPQYRRKSSGI------------------------------------------
RPOC2_MANES      SVFAYFDDPQYRKKSSGI------------------------------------------
RPOC2_VITVI      SILAYFDDPRYRRNSSGI------------------------------------------
RPOC2_WELMI      TTFCIWNDSQYKSPSPGF------------------------------------------
RPOC2_ADICA      HIFATYENFEYQTIVSGI------------------------------------------
RPOC2_CHAGL      TKIASSSIYKHHIENCGI------------------------------------------
RPOC2_ACAM1      QVVAELIDDHYRTKTGGI------------------------------------------
RPOC2_THEEB      QVVAELIDDRYHTTTGGI------------------------------------------
RPOC2_NOSS1      QVVAELIDDRYRTTTGGF------------------------------------------
RPOC2_TRIV2      QVVAELIDDRYRTTTGGF------------------------------------------
RPOC2_NOSP7      QVVAELIDDRYRTTTGGF------------------------------------------
RPOC2_SYNE7      HVVAELIDSRYRTQTGGL------------------------------------------
RPOC2_SYNP6      HVVAELIDSRYRTQTGGL------------------------------------------
RPOC2_TRIEI      EVIAELLDENYQTSTGGI------------------------------------------
RPOC2_CROS5      AIIAELIDDRYQTTTGGM------------------------------------------
RPOC2_SYNY3      SIVAELIDDRYRTTTGGM------------------------------------------
RPOC2_MICAN      AIVAELIDDRYQTHTGGM------------------------------------------
RPOC2_SYNP2      ANIAELIDDRYRTTTGGI------------------------------------------
RPOC2_SYNJB      EVVAELIDNHFRSQTGGL------------------------------------------
RPOC2_SYNJA      EVVAELIENNFRTQTGGL------------------------------------------
RPOC2_GLOVI      QVVAERVDDRYMTKSGGL------------------------------------------
RPOC2_PROMA      EVIAELSDDRFRTKTGGL------------------------------------------
RPOC2_PROM4      EIVAELADDRFRTKTGGL------------------------------------------
RPOC2_PROM1      EVIAELSDDRFKTETGGL------------------------------------------
RPOC2_PROMT      EVIAELSDDRFKTETGGL------------------------------------------
RPOC2_PROM3      EVVAELADDRFRTQTGGL------------------------------------------
RPOC2_PROMM      EVVAELADDRFRTQTGGL------------------------------------------
RPOC2_SYNS3      EVIAELADDRFRTQTGGL------------------------------------------
RPOC2_SYNPW      EVVAELNDDRFRTQTGGL------------------------------------------
RPOC2_SYNSC      EVIAELADDRFRTGTGGL------------------------------------------
RPOC2_SYNPX      EVVAELADDRFRTGTGGL------------------------------------------
RPOC2_SYNS9      EVIAELADDRFRTGTGGL------------------------------------------
RPOC2_PROMS      EVIADLTDERFRTKTGGL------------------------------------------
RPOC2_PROM0      EVIADLTDERFRTKTGGL------------------------------------------
RPOC2_PROM2      EVIADLTDERFRTKTGGL------------------------------------------
RPOC2_PROM9      QVIADLTDERFRTKTGGL------------------------------------------
RPOC2_PROM5      EVIADLADERFRTKTGGL------------------------------------------
RPOC2_PROMP      EVIADLADERFRTKTGGL------------------------------------------
RPOC2_SYNR3      EVIAELADDRFRTQTGGL------------------------------------------
RPOC2_PAUCH      EVIAELADERFRTKTGGL------------------------------------------
RPOC2_GUITH      QVIGEYIEDNYKTTTGGI------------------------------------------
RPOC2_RHDSA      QIIAELIDTKYQTSTGGI------------------------------------------
RPOC2_PORPU      HIVAELISDTYKTTSGGI------------------------------------------
RPOC2_PYRYE      YTVAELISDTYKTTSGGI------------------------------------------
RPOC2_GRATL      QLIAELITNIYRTNTGGI------------------------------------------
RPOC2_CYAPA      QVVAER---YLTTEMGGI------------------------------------------
RPOC2_CYACA      DIIAELIDDQYLTNTGGI------------------------------------------
RPOC2_EMIHU      DTIAVLDDNTYRTTTGGI------------------------------------------
RPOC2_PHATC      YQVATLITNRFKTLVGGT------------------------------------------
RPOC2_THAPS      KPFATSFNNNFKTLTGGI------------------------------------------
RPOC2_TRICV      KHFGTLVTNNYQTLTGGI------------------------------------------
RPOC2_CHLVU      PQFGFMVTCEENSLSRKG------------------------------------------
RPOC2_OSTTA      EHLPFKSKN---------------------------------------------------
RPOC2_BIGNA      EEKTNFKKQNLHKIDSKI------------------------------------------
RPOC2_CHLAT      QVIGKLVTEAYLTSTGGI------------------------------------------
RPOC2_MESVI      QIIAKFVTKTYLTNTGGI------------------------------------------
RPOC2_NEPOL      QSLATYVDSQWEVEQGQL------------------------------------------
                                                                             

RPOC2_STAPU      ------------------------------------------------------------
RPOC2_ZYGCR      ------------------------------------------------------------
RPOC2_CHAVU      ------------------------------------------------------------
RPOC2_ANEMR      ------------------------------------------------------------
RPOC2_MARPO      ------------------------------------------------------------
RPOC2_PHYPA      ------------------------------------------------------------
RPOC2_ANTAG      ------------------------------------------------------------
RPOC2_ANGEV      ------------------------------------------------------------
RPOC2_PSINU      ------------------------------------------------------------
RPOC2_PINKO      ------------------------------------------------------------
RPOC2_PINTH      ------------------------------------------------------------
RPOC2_CYCTA      ------------------------------------------------------------
RPOC2_CRYJA      ------------------------------------------------------------
RPOC2_AGRST      EDEYETLEDEYRTRED-----------------EYEYETLEDEYGSPEN-------EYRT
RPOC2_LOLPR      EDEYETLEEEYRTRED-----------------EYEYETLEDEYGSPENEYGNPENEYRT
RPOC2_HORVU      EEEYETLEHEYRTRED--EYETLEESKYGILEDEYEYETLENEYGSPENKYGNPENEYRT
RPOC2_WHEAT      EEEYETLEDEYRTREDEYEYETLEESKYGILEDEYEYETLEDEYGSPENEYGNPENEYRT
RPOC2_SACHY      EDEYESPENKYRTREG----------EGEYEILEDEYRTLEDEYETLEDEYGILEDEYRT
RPOC2_SACOF      EDEYESPENKYRTREG----------EGEYEILEDEYRTLEDEYETLEDEYGILEDEYRT
RPOC2_SORBI      EDEYESPENKYRTREG----------EGEYEILEDEYRTLEDEYETLEDEYGILEDEYRT
RPOC2_MAIZE      EDEYESPENKYRTREG----------EGEYKILEDEYRTLEDEYETLEDEYGILEDEYRT
RPOC2_ORYNI      ENEYGSPENEYRTREE------------ECKTLEDEYRTREEEYETLEDEYGIPENEYET
RPOC2_ORYSI      ENEYGSPENEYRTREE------------ECKTLEDEYRTREEEYETLEDEYGIPENEYET
RPOC2_ORYSA      ENEYGSPENEYRTREE------------ECKTLEDEYRTREEEYETLEDEYGIPENEYET
RPOC2_ORYSJ      ENEYGSPENEYRTREE------------ECKTLEDEYRTREEEYETLEDEYGIPENEYET
RPOC2_DIOEL      ------------------------------------------------------------
RPOC2_PHAAO      ------------------------------------------------------------
RPOC2_LEMMI      ------------------------------------------------------------
RPOC2_ACOCL      ------------------------------------------------------------
RPOC2_AMBTC      ------------------------------------------------------------
RPOC2_NYMAL      ------------------------------------------------------------
RPOC2_ILLOL      ------------------------------------------------------------
RPOC2_CALFG      ------------------------------------------------------------
RPOC2_LIRTU      ------------------------------------------------------------
RPOC2_DRIGR      ------------------------------------------------------------
RPOC2_CHLSC      ------------------------------------------------------------
RPOC2_CERDE      ------------------------------------------------------------
RPOC2_PIPCE      ------------------------------------------------------------
RPOC2_BUXMI      ------------------------------------------------------------
RPOC2_PLAOC      ------------------------------------------------------------
RPOC2_NANDO      ------------------------------------------------------------
RPOC2_RANMC      ------------------------------------------------------------
RPOC2_SOLBU      ------------------------------------------------------------
RPOC2_SOLTU      ------------------------------------------------------------
RPOC2_SOLLC      ------------------------------------------------------------
RPOC2_ATRBE      ------------------------------------------------------------
RPOC2_NICSY      ------------------------------------------------------------
RPOC2_TOBAC      ------------------------------------------------------------
RPOC2_NICTO      ------------------------------------------------------------
RPOC2_COFAR      ------------------------------------------------------------
RPOC2_JASNU      ------------------------------------------------------------
RPOC2_CUSEX      ------------------------------------------------------------
RPOC2_CUSRE      ------------------------------------------------------------
RPOC2_IPOPU      ------------------------------------------------------------
RPOC2_DAUCA      ------------------------------------------------------------
RPOC2_PANGI      ------------------------------------------------------------
RPOC2_GUIAB      ------------------------------------------------------------
RPOC2_HELAN      ------------------------------------------------------------
RPOC2_LACSA      ------------------------------------------------------------
RPOC2_SILLA      ------------------------------------------------------------
RPOC2_SPIOL      ------------------------------------------------------------
RPOC2_FAGEA      ------------------------------------------------------------
RPOC2_SOYBN      ------------------------------------------------------------
RPOC2_PHAVU      ------------------------------------------------------------
RPOC2_LOTJA      ------------------------------------------------------------
RPOC2_PELHO      ------------------------------------------------------------
RPOC2_OENAR      ------------------------------------------------------------
RPOC2_OENPA      ------------------------------------------------------------
RPOC2_OENEH      ------------------------------------------------------------
RPOC2_OENGL      ------------------------------------------------------------
RPOC2_OENBI      ------------------------------------------------------------
RPOC2_EUCGG      ------------------------------------------------------------
RPOC2_AETCO      ------------------------------------------------------------
RPOC2_AETGR      ------------------------------------------------------------
RPOC2_ARATH      ------------------------------------------------------------
RPOC2_CAPBU      ------------------------------------------------------------
RPOC2_CRUWA      ------------------------------------------------------------
RPOC2_OLIPU      ------------------------------------------------------------
RPOC2_BARVE      ------------------------------------------------------------
RPOC2_NASOF      ------------------------------------------------------------
RPOC2_LEPVR      ------------------------------------------------------------
RPOC2_LOBMA      ------------------------------------------------------------
RPOC2_ARAHI      ------------------------------------------------------------
RPOC2_DRANE      ------------------------------------------------------------
RPOC2_SINAL      ------------------------------------------------------------
RPOC2_CARPA      ------------------------------------------------------------
RPOC2_GOSBA      ------------------------------------------------------------
RPOC2_GOSHI      ------------------------------------------------------------
RPOC2_CITSI      ------------------------------------------------------------
RPOC2_CUCSA      ------------------------------------------------------------
RPOC2_MORIN      ------------------------------------------------------------
RPOC2_POPAL      ------------------------------------------------------------
RPOC2_POPTR      ------------------------------------------------------------
RPOC2_MANES      ------------------------------------------------------------
RPOC2_VITVI      ------------------------------------------------------------
RPOC2_WELMI      ------------------------------------------------------------
RPOC2_ADICA      ------------------------------------------------------------
RPOC2_CHAGL      ------------------------------------------------------------
RPOC2_ACAM1      ------------------------------------------------------------
RPOC2_THEEB      ------------------------------------------------------------
RPOC2_NOSS1      ------------------------------------------------------------
RPOC2_TRIV2      ------------------------------------------------------------
RPOC2_NOSP7      ------------------------------------------------------------
RPOC2_SYNE7      ------------------------------------------------------------
RPOC2_SYNP6      ------------------------------------------------------------
RPOC2_TRIEI      ------------------------------------------------------------
RPOC2_CROS5      ------------------------------------------------------------
RPOC2_SYNY3      ------------------------------------------------------------
RPOC2_MICAN      ------------------------------------------------------------
RPOC2_SYNP2      ------------------------------------------------------------
RPOC2_SYNJB      ------------------------------------------------------------
RPOC2_SYNJA      ------------------------------------------------------------
RPOC2_GLOVI      ------------------------------------------------------------
RPOC2_PROMA      ------------------------------------------------------------
RPOC2_PROM4      ------------------------------------------------------------
RPOC2_PROM1      ------------------------------------------------------------
RPOC2_PROMT      ------------------------------------------------------------
RPOC2_PROM3      ------------------------------------------------------------
RPOC2_PROMM      ------------------------------------------------------------
RPOC2_SYNS3      ------------------------------------------------------------
RPOC2_SYNPW      ------------------------------------------------------------
RPOC2_SYNSC      ------------------------------------------------------------
RPOC2_SYNPX      ------------------------------------------------------------
RPOC2_SYNS9      ------------------------------------------------------------
RPOC2_PROMS      ------------------------------------------------------------
RPOC2_PROM0      ------------------------------------------------------------
RPOC2_PROM2      ------------------------------------------------------------
RPOC2_PROM9      ------------------------------------------------------------
RPOC2_PROM5      ------------------------------------------------------------
RPOC2_PROMP      ------------------------------------------------------------
RPOC2_SYNR3      ------------------------------------------------------------
RPOC2_PAUCH      ------------------------------------------------------------
RPOC2_GUITH      ------------------------------------------------------------
RPOC2_RHDSA      ------------------------------------------------------------
RPOC2_PORPU      ------------------------------------------------------------
RPOC2_PYRYE      ------------------------------------------------------------
RPOC2_GRATL      ------------------------------------------------------------
RPOC2_CYAPA      ------------------------------------------------------------
RPOC2_CYACA      ------------------------------------------------------------
RPOC2_EMIHU      ------------------------------------------------------------
RPOC2_PHATC      ------------------------------------------------------------
RPOC2_THAPS      ------------------------------------------------------------
RPOC2_TRICV      ------------------------------------------------------------
RPOC2_CHLVU      ------------------------------------------------------------
RPOC2_OSTTA      ------------------------------------------------------------
RPOC2_BIGNA      ------------------------------------------------------------
RPOC2_CHLAT      ------------------------------------------------------------
RPOC2_MESVI      ------------------------------------------------------------
RPOC2_NEPOL      ------------------------------------------------------------
                                                                             

RPOC2_STAPU      ------------------------------------------------------------
RPOC2_ZYGCR      ------------------------------------------------------------
RPOC2_CHAVU      ------------------------------------------------------------
RPOC2_ANEMR      ------------------------------------------------------------
RPOC2_MARPO      ------------------------------------------------------------
RPOC2_PHYPA      ------------------------------------------------------------
RPOC2_ANTAG      ------------------------------------------------------------
RPOC2_ANGEV      ------------------------------------------------------------
RPOC2_PSINU      ------------------------------------------------------------
RPOC2_PINKO      ------------------------------------------------------------
RPOC2_PINTH      ------------------------------------------------------------
RPOC2_CYCTA      ------------------------------------------------------------
RPOC2_CRYJA      ------------------------------------------------------------
RPOC2_AGRST      LEKDSEDEYGSPESKYRTREG----EYGTLEEDS---EDGYGNPGESSEDKYGTLEEDLE
RPOC2_LOLPR      LEKDSEDEYGSPES-----------KYGTLEEDS---EDDYGSPGESSEDKYGTLEEDLE
RPOC2_HORVU      LEKDSEEEYGNPESKYRTQED----EYGTLEEDS---EDEYGSPGESGEEKYGTLEEDSE
RPOC2_WHEAT      LEKDSEEEYGSPESKYRTQED----EYGTIEEDS---EDEYGSPGESAEEKYGTLEEDSE
RPOC2_SACHY      LEKDSEEEYGSLENKYRTREGEG--EYEILEEDS---EEEYGSSEDGSEKEYGTLEEDSE
RPOC2_SACOF      LEKDSEEEYGSLENKYRTREGEG--EYEILEEDS---EEEYGSSEDGSEKEYGTLEEDSE
RPOC2_SORBI      LEKDSEEEYGSLENKYRTREGEG--EYEILEEDS---EEEYGSSEDGSEKEYGTLEEDSE
RPOC2_MAIZE      LEKDSEEEYGSLENKYRTREGEG--EYEILEEES---EEEYGSSEDGSEKEYGTLEEDSE
RPOC2_ORYNI      LE----DEYGILEDEYRTREEESEDEYGSPENKYRPREDKYGTLEEDSEDEHGTLEEDSE
RPOC2_ORYSI      LE----DEYGILEDEYRTREEESEDEYGSPENKYRPREDKYGTLEEDSEDEHGTLEEDSE
RPOC2_ORYSA      LE----DEYGILEDEYRTREEESEDEYGSPENKYRPREDKYGTLEEDSEDEHGTLEEDSE
RPOC2_ORYSJ      LE----DEYGILEDEYRTREEESEDEYGSPENKYRPREDKYGTLEEDSEDEHGTLEEDSE
RPOC2_DIOEL      ------------------------------------------------------------
RPOC2_PHAAO      ------------------------------------------------------------
RPOC2_LEMMI      ------------------------------------------------------------
RPOC2_ACOCL      ------------------------------------------------------------
RPOC2_AMBTC      ------------------------------------------------------------
RPOC2_NYMAL      ------------------------------------------------------------
RPOC2_ILLOL      ------------------------------------------------------------
RPOC2_CALFG      ------------------------------------------------------------
RPOC2_LIRTU      ------------------------------------------------------------
RPOC2_DRIGR      ------------------------------------------------------------
RPOC2_CHLSC      ------------------------------------------------------------
RPOC2_CERDE      ------------------------------------------------------------
RPOC2_PIPCE      ------------------------------------------------------------
RPOC2_BUXMI      ------------------------------------------------------------
RPOC2_PLAOC      ------------------------------------------------------------
RPOC2_NANDO      ------------------------------------------------------------
RPOC2_RANMC      ------------------------------------------------------------
RPOC2_SOLBU      ------------------------------------------------------------
RPOC2_SOLTU      ------------------------------------------------------------
RPOC2_SOLLC      ------------------------------------------------------------
RPOC2_ATRBE      ------------------------------------------------------------
RPOC2_NICSY      ------------------------------------------------------------
RPOC2_TOBAC      ------------------------------------------------------------
RPOC2_NICTO      ------------------------------------------------------------
RPOC2_COFAR      ------------------------------------------------------------
RPOC2_JASNU      ------------------------------------------------------------
RPOC2_CUSEX      ------------------------------------------------------------
RPOC2_CUSRE      ------------------------------------------------------------
RPOC2_IPOPU      ------------------------------------------------------------
RPOC2_DAUCA      ------------------------------------------------------------
RPOC2_PANGI      ------------------------------------------------------------
RPOC2_GUIAB      ------------------------------------------------------------
RPOC2_HELAN      ------------------------------------------------------------
RPOC2_LACSA      ------------------------------------------------------------
RPOC2_SILLA      ------------------------------------------------------------
RPOC2_SPIOL      ------------------------------------------------------------
RPOC2_FAGEA      ------------------------------------------------------------
RPOC2_SOYBN      ------------------------------------------------------------
RPOC2_PHAVU      ------------------------------------------------------------
RPOC2_LOTJA      ------------------------------------------------------------
RPOC2_PELHO      ------------------------------------------------------------
RPOC2_OENAR      ------------------------------------------------------------
RPOC2_OENPA      ------------------------------------------------------------
RPOC2_OENEH      ------------------------------------------------------------
RPOC2_OENGL      ------------------------------------------------------------
RPOC2_OENBI      ------------------------------------------------------------
RPOC2_EUCGG      ------------------------------------------------------------
RPOC2_AETCO      ------------------------------------------------------------
RPOC2_AETGR      ------------------------------------------------------------
RPOC2_ARATH      ------------------------------------------------------------
RPOC2_CAPBU      ------------------------------------------------------------
RPOC2_CRUWA      ------------------------------------------------------------
RPOC2_OLIPU      ------------------------------------------------------------
RPOC2_BARVE      ------------------------------------------------------------
RPOC2_NASOF      ------------------------------------------------------------
RPOC2_LEPVR      ------------------------------------------------------------
RPOC2_LOBMA      ------------------------------------------------------------
RPOC2_ARAHI      ------------------------------------------------------------
RPOC2_DRANE      ------------------------------------------------------------
RPOC2_SINAL      ------------------------------------------------------------
RPOC2_CARPA      ------------------------------------------------------------
RPOC2_GOSBA      ------------------------------------------------------------
RPOC2_GOSHI      ------------------------------------------------------------
RPOC2_CITSI      ------------------------------------------------------------
RPOC2_CUCSA      ------------------------------------------------------------
RPOC2_MORIN      ------------------------------------------------------------
RPOC2_POPAL      ------------------------------------------------------------
RPOC2_POPTR      ------------------------------------------------------------
RPOC2_MANES      ------------------------------------------------------------
RPOC2_VITVI      ------------------------------------------------------------
RPOC2_WELMI      ------------------------------------------------------------
RPOC2_ADICA      ------------------------------------------------------------
RPOC2_CHAGL      ------------------------------------------------------------
RPOC2_ACAM1      ------------------------------------------------------------
RPOC2_THEEB      ------------------------------------------------------------
RPOC2_NOSS1      ------------------------------------------------------------
RPOC2_TRIV2      ------------------------------------------------------------
RPOC2_NOSP7      ------------------------------------------------------------
RPOC2_SYNE7      ------------------------------------------------------------
RPOC2_SYNP6      ------------------------------------------------------------
RPOC2_TRIEI      ------------------------------------------------------------
RPOC2_CROS5      ------------------------------------------------------------
RPOC2_SYNY3      ------------------------------------------------------------
RPOC2_MICAN      ------------------------------------------------------------
RPOC2_SYNP2      ------------------------------------------------------------
RPOC2_SYNJB      ------------------------------------------------------------
RPOC2_SYNJA      ------------------------------------------------------------
RPOC2_GLOVI      ------------------------------------------------------------
RPOC2_PROMA      ------------------------------------------------------------
RPOC2_PROM4      ------------------------------------------------------------
RPOC2_PROM1      ------------------------------------------------------------
RPOC2_PROMT      ------------------------------------------------------------
RPOC2_PROM3      ------------------------------------------------------------
RPOC2_PROMM      ------------------------------------------------------------
RPOC2_SYNS3      ------------------------------------------------------------
RPOC2_SYNPW      ------------------------------------------------------------
RPOC2_SYNSC      ------------------------------------------------------------
RPOC2_SYNPX      ------------------------------------------------------------
RPOC2_SYNS9      ------------------------------------------------------------
RPOC2_PROMS      ------------------------------------------------------------
RPOC2_PROM0      ------------------------------------------------------------
RPOC2_PROM2      ------------------------------------------------------------
RPOC2_PROM9      ------------------------------------------------------------
RPOC2_PROM5      ------------------------------------------------------------
RPOC2_PROMP      ------------------------------------------------------------
RPOC2_SYNR3      ------------------------------------------------------------
RPOC2_PAUCH      ------------------------------------------------------------
RPOC2_GUITH      ------------------------------------------------------------
RPOC2_RHDSA      ------------------------------------------------------------
RPOC2_PORPU      ------------------------------------------------------------
RPOC2_PYRYE      ------------------------------------------------------------
RPOC2_GRATL      ------------------------------------------------------------
RPOC2_CYAPA      ------------------------------------------------------------
RPOC2_CYACA      ------------------------------------------------------------
RPOC2_EMIHU      ------------------------------------------------------------
RPOC2_PHATC      ------------------------------------------------------------
RPOC2_THAPS      ------------------------------------------------------------
RPOC2_TRICV      ------------------------------------------------------------
RPOC2_CHLVU      ------------------------------------------------------------
RPOC2_OSTTA      ------------------------------------------------------------
RPOC2_BIGNA      ------------------------------------------------------------
RPOC2_CHLAT      ------------------------------------------------------------
RPOC2_MESVI      ------------------------------------------------------------
RPOC2_NEPOL      ------------------------------------------------------------
                                                                             

RPOC2_STAPU      ------------------------------------------------------------
RPOC2_ZYGCR      ------------------------------------------------------------
RPOC2_CHAVU      --------VKYGFLLINSQLDKNLKS----------------------------------
RPOC2_ANEMR      --------LKYGTIKIGSADR-NNE-----------------------------------
RPOC2_MARPO      --------LKYGNIKVDLINQ-NTN-----------------------------------
RPOC2_PHYPA      --------IKYGNIKVDLINKKNDI-----------------------------------
RPOC2_ANTAG      --------IKYGTIKVNPIKGKGET-----------------------------------
RPOC2_ANGEV      --------IKYGTIKVDSVGKREYI-----------------------------------
RPOC2_PSINU      --------IKYGTLKIDSIVENERI-----------------------------------
RPOC2_PINKO      ------------------------------------------------------------
RPOC2_PINTH      ------------------------------------------------------------
RPOC2_CYCTA      --------IKYGTIKVDSIGNKEN------------------------------------
RPOC2_CRYJA      ------------------------------------------------------------
RPOC2_AGRST      EDSE----DEYDSSEEDSILKKEG------------------------------------
RPOC2_LOLPR      EESE----DEYESPEEDSIFKKEG------------------------------------
RPOC2_HORVU      EDSE----DEYESPEEDSILKKEG------------------------------------
RPOC2_WHEAT      EDSE----DEYESPEEDSILKKEG------------------------------------
RPOC2_SACHY      EDSEEDSEDEYGSPEENSILKKEG------------------------------------
RPOC2_SACOF      EDSEEDSEDEYGSPEENSILKKEG------------------------------------
RPOC2_SORBI      EDSEEDSEDEYGSPEEDSILKKEG------------------------------------
RPOC2_MAIZE      EDSEEDSEDEYGSPEEDSILKKEG------------------------------------
RPOC2_ORYNI      EDSE----DEYGNPEEDSVLKKGV------------------------------------
RPOC2_ORYSI      EDSE----DEYGNPEEDSVLKKGV------------------------------------
RPOC2_ORYSA      EDSE----DEYGNPEEDSVLKKGV------------------------------------
RPOC2_ORYSJ      EDSE----DEYGNPEEDSVLKKGV------------------------------------
RPOC2_DIOEL      --------TKYGTLEVDSIVKKED------------------------------------
RPOC2_PHAAO      --------TKYGIVEVDSIVKKED------------------------------------
RPOC2_LEMMI      --------TKYGAVEVDSILKKED------------------------------------
RPOC2_ACOCL      --------TKYGTVEIDSIVKKED------------------------------------
RPOC2_AMBTC      --------AKYGTIEVDSIIKKED------------------------------------
RPOC2_NYMAL      --------TKYGIIEVDSIVKKEG------------------------------------
RPOC2_ILLOL      --------TKYGTIEVDSIVKKDD------------------------------------
RPOC2_CALFG      --------TKYGTIGVDSIVKKED------------------------------------
RPOC2_LIRTU      --------TKYGTIEVDSIVKKED------------------------------------
RPOC2_DRIGR      --------TKYGTVEVDSIVKKED------------------------------------
RPOC2_CHLSC      --------TKYGTIEVDSIVKKED------------------------------------
RPOC2_CERDE      --------TKYATIEVDSIVKKED------------------------------------
RPOC2_PIPCE      --------TKYGTVEVDSLVKKED------------------------------------
RPOC2_BUXMI      --------TKYGTIEVHSIVKKED------------------------------------
RPOC2_PLAOC      --------TKYGTIEVHAIVKKED------------------------------------
RPOC2_NANDO      --------TKYGTIEAHSIVKKED------------------------------------
RPOC2_RANMC      --------TKYGTIEVDSIVKKED------------------------------------
RPOC2_SOLBU      --------IKYGTIETHSVIKKED------------------------------------
RPOC2_SOLTU      --------IKYGTIETHSVIKKED------------------------------------
RPOC2_SOLLC      --------IKYGTIETHSVIKKED------------------------------------
RPOC2_ATRBE      --------IKYGTIETHSVIKKED------------------------------------
RPOC2_NICSY      --------IKYGTVETHSVIKKED------------------------------------
RPOC2_TOBAC      --------IKYGTVETHSVIKKED------------------------------------
RPOC2_NICTO      --------IKYGTVETHSVIKKED------------------------------------
RPOC2_COFAR      --------TKYGTIEMHSLVKKED------------------------------------
RPOC2_JASNU      --------PQYGTIEMHSIVKKED------------------------------------
RPOC2_CUSEX      --------TKYGTLEMHSTVKKED------------------------------------
RPOC2_CUSRE      --------TKYGTLEMYSTIKKED------------------------------------
RPOC2_IPOPU      --------TKYGTLEMHSIVKKED------------------------------------
RPOC2_DAUCA      --------TKYGTIEVDPIAKKED------------------------------------
RPOC2_PANGI      --------TKYGTIEVHSIVKKED------------------------------------
RPOC2_GUIAB      --------TKYETRELNSIVNEED------------------------------------
RPOC2_HELAN      --------TKYETRELNSIVNEEN------------------------------------
RPOC2_LACSA      --------TKYETRELNSIVNEEN------------------------------------
RPOC2_SILLA      --------TKYETIETHSSVKKED------------------------------------
RPOC2_SPIOL      --------TKYGTIEMHSIVKKED------------------------------------
RPOC2_FAGEA      --------TKYGTIEAHSIKKKEG------------------------------------
RPOC2_SOYBN      --------TKYRTIGINSIFKKEDF-----------------------------------
RPOC2_PHAVU      --------TKYRTIDINYILKKEDF-----------------------------------
RPOC2_LOTJA      --------AKYKTIGIHSIFQKED------------------------------------
RPOC2_PELHO      --------TKYGTIEVDSIVTKES------------------------------------
RPOC2_OENAR      --------TQYETMGMHSIVKKEG------------------------------------
RPOC2_OENPA      --------TQYETMGMHSIVKKEG------------------------------------
RPOC2_OENEH      --------TQYETMGMHSIVKKEG------------------------------------
RPOC2_OENGL      --------TQYETMGMHSIVKKEG------------------------------------
RPOC2_OENBI      --------TQYETMGMHSIVKKEG------------------------------------
RPOC2_EUCGG      --------IKYGTLGVHSVVKKED------------------------------------
RPOC2_AETCO      --------LKYGTIEADSIIQKED------------------------------------
RPOC2_AETGR      --------LKYGTIEADSIIQKED------------------------------------
RPOC2_ARATH      --------LKYGTLKADSIIQKED------------------------------------
RPOC2_CAPBU      --------LKYGALKADSIIQKED------------------------------------
RPOC2_CRUWA      --------LKYGTLKADSIIQKED------------------------------------
RPOC2_OLIPU      --------LKYGTPKADSIIQKAD------------------------------------
RPOC2_BARVE      --------LKYGTLKADSIIQKED------------------------------------
RPOC2_NASOF      --------LKYGTLKADSIIQKED------------------------------------
RPOC2_LEPVR      --------LKYGTLKADSIIQKED------------------------------------
RPOC2_LOBMA      --------LKYGTLKADSIIQKED------------------------------------
RPOC2_ARAHI      --------LKYGTLRADSIIQKED------------------------------------
RPOC2_DRANE      --------LKYGTLRADSIIQKED------------------------------------
RPOC2_SINAL      --------LKYGTLKADSIIQKED------------------------------------
RPOC2_CARPA      --------LKYGTIGAHSIVKKED------------------------------------
RPOC2_GOSBA      --------TKYGTLGAHSIVKRED------------------------------------
RPOC2_GOSHI      --------TKYGTLGAHSIVKRED------------------------------------
RPOC2_CITSI      --------TKWGTLGAHSIVKKED------------------------------------
RPOC2_CUCSA      --------TKYGTIGVHSILKKED------------------------------------
RPOC2_MORIN      --------TKYGAIGLHSILKKED------------------------------------
RPOC2_POPAL      --------TKYVAIGVHSIVKKED------------------------------------
RPOC2_POPTR      --------TKYVAIGVHSIVKKED------------------------------------
RPOC2_MANES      --------TKYGAIGVHSIVKKED------------------------------------
RPOC2_VITVI      --------TKYGTIEAHSIVKKED------------------------------------
RPOC2_WELMI      ------------------------------------------------------------
RPOC2_ADICA      --------IKYGTVEIKPVNPKRL------------------------------------
RPOC2_CHAGL      --------IKYGSIQIKPFPSNFDQD----------------------------------
RPOC2_ACAM1      --------LKYAGVEVTKKG----------------------------------------
RPOC2_THEEB      --------LKYADIEVAKKG----------------------------------------
RPOC2_NOSS1      --------LKFAGVEVQKKG----------------------------------------
RPOC2_TRIV2      --------LKFAGVEVQKKG----------------------------------------
RPOC2_NOSP7      --------LKFAGVEVQKKG----------------------------------------
RPOC2_SYNE7      --------LKYSGVEISKKGRA--------------------------------------
RPOC2_SYNP6      --------LKYSGVEISKKGRA--------------------------------------
RPOC2_TRIEI      --------IKYAGVEVLKRG----------------------------------------
RPOC2_CROS5      --------LRYGGIEVAKGS----------------------------------------
RPOC2_SYNY3      --------IRYAGVEVAKGG----------------------------------------
RPOC2_MICAN      --------IKYVDIEVAKGS----------------------------------------
RPOC2_SYNP2      --------IKYSGVEVAKGT----------------------------------------
RPOC2_SYNJB      --------VKFAGIEVARRG----------------------------------------
RPOC2_SYNJA      --------VKFAGVEVARRG----------------------------------------
RPOC2_GLOVI      --------IKYSEGVEVAKA----------------------------------------
RPOC2_PROMA      --------VKYAPG-LAIKKAR--------------------------------------
RPOC2_PROM4      --------VKYAPG-LAIKKAR--------------------------------------
RPOC2_PROM1      --------IKYAPG-LTIKKAR--------------------------------------
RPOC2_PROMT      --------IKYAPG-LTIKKAR--------------------------------------
RPOC2_PROM3      --------VRFAPG-LAIKKAR--------------------------------------
RPOC2_PROMM      --------VRFAPG-LAIKKAR--------------------------------------
RPOC2_SYNS3      --------VKFAPG-LAIKKAR--------------------------------------
RPOC2_SYNPW      --------VRFAPG-LAIKKAR--------------------------------------
RPOC2_SYNSC      --------VKFAPG-LAIKKAR--------------------------------------
RPOC2_SYNPX      --------VKFAPG-LAIKKAR--------------------------------------
RPOC2_SYNS9      --------VKFAPG-LAIKKAR--------------------------------------
RPOC2_PROMS      --------VKYAPG-LSVKKAR--------------------------------------
RPOC2_PROM0      --------VKYAPG-LSVKKAR--------------------------------------
RPOC2_PROM2      --------IKYAPG-LSVKKAR--------------------------------------
RPOC2_PROM9      --------VKYSPG-LSVKKAR--------------------------------------
RPOC2_PROM5      --------VKYAPG-LSVKKAR--------------------------------------
RPOC2_PROMP      --------VKYAPG-LSVKKAR--------------------------------------
RPOC2_SYNR3      --------VKFAPG-LAIKKAR--------------------------------------
RPOC2_PAUCH      --------VKYAPGGLSIKKAR--------------------------------------
RPOC2_GUITH      --------IKYKNYAELKKEKN--------------------------------------
RPOC2_RHDSA      --------VKYDGFEVNKKNKN--------------------------------------
RPOC2_PORPU      --------IKYLDLNVSKKKTG--------------------------------------
RPOC2_PYRYE      --------IKYLDLNVSKKKTG--------------------------------------
RPOC2_GRATL      --------IKYLDLSVSDKKVD--------------------------------------
RPOC2_CYAPA      --------IRYADLDAKTTN----------------------------------------
RPOC2_CYACA      --------VKYVNLKLAKTHKD--------------------------------------
RPOC2_EMIHU      --------VTYSLENPQASKKR--------------------------------------
RPOC2_PHATC      --------VYYDHQNVYKNYKPNSTINY--------------------------------
RPOC2_THAPS      --------MYYDQRIKQKFDSFNTLISYNIAYEISKE----------------------D
RPOC2_TRICV      --------GYYDFRCRDRIISDNKTISYFLPWEPKKKSISLEFLTLLESQFLKSFDILSL
RPOC2_CHLVU      --------IFQIKKAQEKNWSHKKTFQLSFLLNPKKRKKPLKKHFMCSSLFLEKAVKRAQ
RPOC2_OSTTA      ------------------------------------------------------------
RPOC2_BIGNA      --------NLFMNKLILVIEHLILTKLFSTKINNINYLLFYFNYLKYLKESNKFTIFYCN
RPOC2_CHLAT      --------VKYSG-ILVERYDP--------------------------------------
RPOC2_MESVI      --------LKYSSEIEVDEYDI--------------------------------------
RPOC2_NEPOL      --------SIRSIEYRVHDQSW--------------------------------------
                                                                             

RPOC2_STAPU      ------------------------------------------------------------
RPOC2_ZYGCR      ------------------------------------------------------------
RPOC2_CHAVU      -------------------------------YNKNSRKKKISLYQNNQIQPGQSLFWIPE
RPOC2_ANEMR      -------------------------------SR--DERMKKFRSTFRI-VKGGNFFLIPE
RPOC2_MARPO      -------------------------------FE--DPQTKLFRPRYSI-IKEGNFFFIPE
RPOC2_PHYPA      -------------------------------FE--DQKTKTVRPRYKI-LKEGNFFLLPE
RPOC2_ANTAG      -------------------------------FKNRETKILRLRPRYQV-IEPGNFFPIPE
RPOC2_ANGEV      -------------------------------GD--NEKTTTFRSRYKI-LKGGNFFLIPE
RPOC2_PSINU      -------------------------------PN--DREKTTFGSRYKV-LRGGNFFFLPG
RPOC2_PINKO      ------------------------------------------------------------
RPOC2_PINTH      ------------------------------------------------------------
RPOC2_CYCTA      -------------------------------YLG-DQRARGFRSKDKM--KGGRFLFIPE
RPOC2_CRYJA      ------------------------------------------------------------
RPOC2_AGRST      -------------------------------LIE-HRGTKEFSLKYQK--EVDRFFFILQ
RPOC2_LOLPR      -------------------------------LIE-HRGTKEFSLKYQK--EVDRFFFILQ
RPOC2_HORVU      -------------------------------LIE-HRGTKEFSLKYQK--EVDRFFFILQ
RPOC2_WHEAT      -------------------------------LIE-HRGTKEFSLKYQK--EVDRFFFILQ
RPOC2_SACHY      -------------------------------FIE-HRGTKEFSLKYQK--EVDRFFFILQ
RPOC2_SACOF      -------------------------------FIE-HRGTKEFSLKYQK--EVDRFFFILQ
RPOC2_SORBI      -------------------------------FIE-HRGTKEFSLKYQK--EVDRFFFILQ
RPOC2_MAIZE      -------------------------------FIE-HRGTKEFSLKYQK--EVDRFFFILQ
RPOC2_ORYNI      -------------------------------LIE-HRGTKEFSLKYQK--EVDRFFFILQ
RPOC2_ORYSI      -------------------------------LIE-HRGTKEFSLKYQK--EVDRFFFILQ
RPOC2_ORYSA      -------------------------------LIE-HRGTKEFSLKYQK--EVDRFFFILQ
RPOC2_ORYSJ      -------------------------------LIE-HRGTKEFSLKYQK--EVDRFFFILQ
RPOC2_DIOEL      -------------------------------LIE-YRGTKEFN---QIQIKVDRFFFIPE
RPOC2_PHAAO      -------------------------------LIE-YRGAKDFSPKYQTQMKVDQFFFIPE
RPOC2_LEMMI      -------------------------------LIE-YRGTKELSP--KYQTKVDRFFFIPE
RPOC2_ACOCL      -------------------------------FIE-YRGTKEFSS--KYQMKVDRFFFIPE
RPOC2_AMBTC      -------------------------------LIE-YRKTREFGPKYQIQIKVNRFFFIPE
RPOC2_NYMAL      -------------------------------LVE-YRRPKESRPKYQ--MKVDRFFVIPE
RPOC2_ILLOL      -------------------------------LIE-YRGAKELRPKYQ--MKVDPFFFIPE
RPOC2_CALFG      -------------------------------LIE-YRRAKEFRPKYQ--MKVDRFFFIPE
RPOC2_LIRTU      -------------------------------LIE-YRGAKEFRPKYQ--MKVDRFFFIPE
RPOC2_DRIGR      -------------------------------LIE-YRGAKEFSPKYQ--MKVDRFFFIPE
RPOC2_CHLSC      -------------------------------LIE-YRGAKEFRPKYQ--MKVDRFFFIPE
RPOC2_CERDE      -------------------------------LIE-YRGSKEFRPKYQ--TKVDRFFFIPE
RPOC2_PIPCE      -------------------------------LVE-YRGEKELRTKYQ--TKVDRFFFIPE
RPOC2_BUXMI      -------------------------------LIE-YRGAKEFRSKYQM--KVDRFFFIPE
RPOC2_PLAOC      -------------------------------LIE-YRRAKEFRPKYQM--KVDRFFFIPE
RPOC2_NANDO      -------------------------------LIE-YRK----RPKYQT--KIDRFFFIPE
RPOC2_RANMC      -------------------------------LIE-YRRTKEFRPKYQM--KIDRFFFIPE
RPOC2_SOLBU      -------------------------------LIE-YRGVKEFRPKYQ--MKVDRFFFIPE
RPOC2_SOLTU      -------------------------------LIE-YRGVKEFRPKYQ--MKVDRFFFIPE
RPOC2_SOLLC      -------------------------------LIE-YRGVKEFRPKYQ--MKVDRFFFIPE
RPOC2_ATRBE      -------------------------------LIE-YRGVKEFRPKYQ--MKVDRFFFIPE
RPOC2_NICSY      -------------------------------LLE-YRGVKEFRPKYQ--MKVDRFFFIPE
RPOC2_TOBAC      -------------------------------LLE-YRGVKEFRPKYQ--MKVDRFFFIPE
RPOC2_NICTO      -------------------------------LLE-YRGVKEFSPKYQ--MKVDLFFFIPE
RPOC2_COFAR      -------------------------------LIE-YRGVKEFRPKYQ--MKVDRFFFIPE
RPOC2_JASNU      -------------------------------LVE-YRGVKAFRPKYQ--MKVDRLFFIPE
RPOC2_CUSEX      -------------------------------FIK-YRGVNEFRQK----MKVERFFFIPE
RPOC2_CUSRE      -------------------------------FIQ-YRGVNEFRLK----SKVERFFFIPE
RPOC2_IPOPU      -------------------------------LIQ-YRGVREFRPKHQ--KKVDRFFFIPE
RPOC2_DAUCA      -------------------------------LIE-YRGVKEFKPKYQ--IKVDRFFFIPE
RPOC2_PANGI      -------------------------------LIE-YRGVKEFRPKYQ--MKVDRFFFIPE
RPOC2_GUIAB      -------------------------------LIE-YRGVKVFWPKYQ--KEVNPFFFIPV
RPOC2_HELAN      -------------------------------LVE-YRGVKVFWPKYQ--KEVNPFFFIPV
RPOC2_LACSA      -------------------------------LIE-YRGVKVFWPKYQ--KEVNPFFFIPV
RPOC2_SILLA      -------------------------------LIE-YRGVKEFRPKYQ--MKVDRFFFISQ
RPOC2_SPIOL      -------------------------------LIE-YRGVKEFRPKYQ--MKVDRFFFIPE
RPOC2_FAGEA      -------------------------------LIE-YRGVNEFRAKYQ--MQVDRFFFIPE
RPOC2_SOYBN      -------------------------------LIE-YQGVKEFKTKYQI--KVDQFFFIPE
RPOC2_PHAVU      -------------------------------VIE-YPGVKEFKTKYQM--KVDQFFFIPE
RPOC2_LOTJA      -------------------------------LIE-YRGIREFKPKYQI--KVDRFFFIPQ
RPOC2_PELHO      -------------------------------FIN-YGGVQ---PKDEG--KVDPLFFIPE
RPOC2_OENAR      -------------------------------LVD-YRGINEFKPKYQM--TIDRFFFIPE
RPOC2_OENPA      -------------------------------LVD-YRGINEFKPKYQM--TIDRFFFIPE
RPOC2_OENEH      -------------------------------LVD-YRGINEFKPKYQM--TIDRFFFIPE
RPOC2_OENGL      -------------------------------LVD-YRGINEFKPKYQM--TIDRFFFIPE
RPOC2_OENBI      -------------------------------LVD-YRGINEFKPKYQM--TIDRFFFIPE
RPOC2_EUCGG      -------------------------------LIE-YRGIKEFKQKCQM--KLDPFFFIPE
RPOC2_AETCO      -------------------------------MIE-YRGVHKFKKNYKM--KVDRFFFIPE
RPOC2_AETGR      -------------------------------MIE-YRGVHKFKKKYKM--KVDRFFFIPE
RPOC2_ARATH      -------------------------------MIE-YRGVQKIKTKYEM--KVDRFFFIPE
RPOC2_CAPBU      -------------------------------MIE-YRGVQKFKTKYEM--KVDRFFFIPE
RPOC2_CRUWA      -------------------------------MIE-YRGVQKFKTKYEM--KVDRFFFIPE
RPOC2_OLIPU      -------------------------------MIE-YRGVQKFKTKYEM--KVDRFFFIPE
RPOC2_BARVE      -------------------------------MIE-YRGVQKFKTKYEM--KVDRFFFIPE
RPOC2_NASOF      -------------------------------MIE-YRGVQKFKTKYEM--KVDRFFFIPE
RPOC2_LEPVR      -------------------------------MIE-YRGVQKFKTKYEM--KVDRFFFIPE
RPOC2_LOBMA      -------------------------------MIE-YRGVQKFKTKYEM--KVDRFFFIPE
RPOC2_ARAHI      -------------------------------MIE-YRGVQKFKTKYEM--KVDRFFFIPE
RPOC2_DRANE      -------------------------------MIE-YRGGQKFKTKYEM--KVDRFFFIPE
RPOC2_SINAL      -------------------------------MIE-YRGVQKFKTKYEM--KVDRFFFIPE
RPOC2_CARPA      -------------------------------VIE-YRGVKKFKTKYQM--KVDRFFFIPE
RPOC2_GOSBA      -------------------------------VIE-YRGVKKVKPKYQM--KVDRFFFIPE
RPOC2_GOSHI      -------------------------------VIE-YRGVKKVKPKYQM--KVDRFFFIPE
RPOC2_CITSI      -------------------------------LIE-YRGLKKIKPKYQM--KIDRLFFIPE
RPOC2_CUCSA      -------------------------------LIE-YRGVKDFKPKYQMQMKVDRFFFIPE
RPOC2_MORIN      -------------------------------LIE-YGGVKEFKPKYQT--KVDQFFFIPE
RPOC2_POPAL      -------------------------------LVE-YRGVKEFQPKYQM--KVDRFFFIPE
RPOC2_POPTR      -------------------------------LVE-YRGVKEFQPKYQM--KVDRFFFIPE
RPOC2_MANES      -------------------------------LIE-YRGVKEFKPKYQT--KVDRFFFIPE
RPOC2_VITVI      -------------------------------LIE-YRGVKEFKPKYQM--KVDRFFFIPE
RPOC2_WELMI      --------------------------------LE-YSD------------SPEKFVLIPE
RPOC2_ADICA      -------------------------------QLDGGTGNKSSRPWCRV-VRKGNFFLIPE
RPOC2_CHAGL      -------------------------------LNTIKEKIKPLKLKYEL-INSGTIFWIPE
RPOC2_ACAM1      ---------------------------------------KA--KQGYEVTQGGTLLWIAE
RPOC2_THEEB      ---------------------------------------KA--KQGYEVLKGGTLLWIPE
RPOC2_NOSS1      ---------------------------------------KA--KLGYEVVQGGTLLWIPE
RPOC2_TRIV2      ---------------------------------------KA--KLGYEVVQGGTLLWIPE
RPOC2_NOSP7      ---------------------------------------KA--KLGYEVVQGGTLLWIPE
RPOC2_SYNE7      ---------------------------------------KA--KQGYEVTKGGTLLWIPE
RPOC2_SYNP6      ---------------------------------------KA--KQGYEVTKGGTLLWIPE
RPOC2_TRIEI      ---------------------------------------KA--KQGYEVVKGGTLLWIPE
RPOC2_CROS5      ----------------------------------------R--KTGYEVVQGGTLLWVPE
RPOC2_SYNY3      ----------------------------------------R--KQGYEVTKGGTLLWIPE
RPOC2_MICAN      ----------------------------------------R--KQGYEITKGGTILWIPE
RPOC2_SYNP2      ----------------------------------------K--KQGYEVLKGGTLLWIPE
RPOC2_SYNJB      ---------------------------------------KA--KQGYEVIQGGTLLWIPE
RPOC2_SYNJA      ---------------------------------------KA--KQGYEVIRGGTLLWIPE
RPOC2_GLOVI      ---------------------------------------RG--KQGYEVLKGGTLLWIPE
RPOC2_PROMA      ---------------------------------------SA--KNGFEVSNGGSLLWIPQ
RPOC2_PROM4      ---------------------------------------SA--KNGFEVSNGGTLIWVPQ
RPOC2_PROM1      ---------------------------------------SA--KNGYEVSKGGTLLWIPQ
RPOC2_PROMT      ---------------------------------------SA--KNGYEVSKGGTLLWIPQ
RPOC2_PROM3      ---------------------------------------SA--KNGFEVNKGGTLLWIPQ
RPOC2_PROMM      ---------------------------------------SA--KNGFEVNKGGTLLWIPQ
RPOC2_SYNS3      ---------------------------------------SA--KNGYEVNKGGTLLWIPQ
RPOC2_SYNPW      ---------------------------------------SA--KNGYEVNKGGTLLWIPQ
RPOC2_SYNSC      ---------------------------------------SA--KNGYEVNKGGTLLWIPQ
RPOC2_SYNPX      ---------------------------------------SA--KNGYEVNKGGTLLWIPQ
RPOC2_SYNS9      ---------------------------------------SA--KNGYEVNKGGTLLWVPQ
RPOC2_PROMS      ---------------------------------------SS--KNGFEVSQGGTLLWIPQ
RPOC2_PROM0      ---------------------------------------SS--KNGFEVSQGGTLLWIPQ
RPOC2_PROM2      ---------------------------------------SS--KNGFEVSQGGTLLWIPQ
RPOC2_PROM9      ---------------------------------------SS--KNGFEVSQGGTLLWIPQ
RPOC2_PROM5      ---------------------------------------SS--KNGFEVSQGGTLLWIPQ
RPOC2_PROMP      ---------------------------------------SS--KNGFEVSQGGTLLWIPQ
RPOC2_SYNR3      ---------------------------------------SA--KNGFEVSKGGTLLWIPQ
RPOC2_PAUCH      ---------------------------------------SA--KNGYEVNKGGTLLWIPQ
RPOC2_GUITH      ---------------------------------------KK----GYEINDNEVIYWIPE
RPOC2_RHDSA      ---------------------------------------KK----GYEILGEGALLWIPE
RPOC2_PORPU      ---------------------------------------PE--KDAYDILSPGYILWISE
RPOC2_PYRYE      ---------------------------------------LD--KDAYEILSPGYILWISE
RPOC2_GRATL      ---------------------------------------LNSKKDYYDIVDGGYVLWIGE
RPOC2_CYAPA      -------------------------------------------KNGYEITKSGSLLWIPE
RPOC2_CYACA      ---------------------------------------DS----EYTLSGIGYIFFIPQ
RPOC2_EMIHU      ---------------------------------------KS-----VKNLFKGYFYWIPE
RPOC2_PHATC      ------------------------------------LSRVNFLNNYKPVVSHKTIIWLGE
RPOC2_THAPS      YDKVSKDHYENYLKKLENKIDKNGFIFYQNFLNYQEMESIFLKFKLKKKIVHNSLIWLSE
RPOC2_TRICV      ILKKNPDLEDCRLAFFPNNFNLHSKVETFSHYSKQTNSLNLAWFSIVKQFPYRSVIWMSE
RPOC2_CHLVU      TTFGIQTETKLIEKKCSWFSVSKNFTDFSSQLTGIVLEPGKHMESFSFQHSYVSVNLISR
RPOC2_OSTTA      ------------------------------------------------------------
RPOC2_BIGNA      KKKETIFDLLFLLKTLNTTSNLIILAENKISTKLLSEFIYQTIYLIKNNITINSTNSVLE
RPOC2_CHLAT      --------------------------------------IKKGYKVL----KGGILLWIPE
RPOC2_MESVI      --------------------------------------VTQSYPVR----KGGIIMWIPE
RPOC2_NEPOL      --------------------------------------IQVITPSLVEIESGRGSYHLMA
                                                                             

RPOC2_STAPU      ------------------------------------------------------------
RPOC2_ZYGCR      ------------------------------------------------------------
RPOC2_CHAVU      EIHEIYKP-F-SFLHVKNGEIIQKGTYISED--IQCGTSGLVEINKRNRNHYEISIQPGS
RPOC2_ANEMR      RRYISAQV--LSSILERNNKSVRVGTSITSI--VQSDTSGLVRIGRRINNTYEVKILPGI
RPOC2_MARPO      EVYVLTQS--LSSVFIKNNKFIQAGTLITSN--IRSNTNGLVKIQKKGNNNYELKILPGT
RPOC2_PHYPA      EVYILDQS-SFSSILVKNNSFIKAGTKITFN--ISSKITGFVKIKKKFNN-FKIKILPGS
RPOC2_ANTAG      EVHILYES--FPPILVRNDSLIKKNTQITSD--IRSQVGGLVRIRRKMNDSYEVKVLPGR
RPOC2_ANGEV      EVYTIYQP--SSHIFVSNNSIIEPGTQITFN--ITSRGGGLVQI-KKVRKIFEIRILPGN
RPOC2_PSINU      EIYIVHES--SAYILVSNNSIVQAGTQITPT--LTSQLGGLVQI-KNIQKSFEIRILPGT
RPOC2_PINKO      ------------------------------------------------------------
RPOC2_PINTH      ------------------------------------------------------------
RPOC2_CYCTA      EVHILYES-S--SIMVQNNSIIRAGTQITCD--IESQVGGLVRI-VRIKKKIEMRILPGD
RPOC2_CRYJA      ------------------------------------------------------------
RPOC2_AGRST      ELHILPRS-S--SLKVLDNSIIGVNTQLTKN--TRSRLGGLVRV-KRKKSHTELKIFSGD
RPOC2_LOLPR      ELHILPRS-S--SLKVLDNSIIGVDTQLTKN--TRSRLGGLVRV-KRKKSHTELKIFSGD
RPOC2_HORVU      ELHILPRS-S--SLKILDNSIIGVDTQLTKN--TRSGLGGLVRV-KRKKSHTELKIFSGD
RPOC2_WHEAT      ELHILPRS-S--SLKILDNSIIGVDTQLTKN--TRSRLGGLVRV-KRKKSHTELKIFSGD
RPOC2_SACHY      ELHILPRS-S--SLKVLDNSIIGVDTQLTKN--TRSRLGGLVRV-KRKKSHTELKIFSGD
RPOC2_SACOF      ELHILPRS-S--SLKVLDNSIIGVDTQLTKN--TRSRLGGLVRV-KRKKSHTELKIFSGD
RPOC2_SORBI      ELHILPRS-S--SLKVLDNSIIGVDTQLTKN--TRSRLGGLVRV-KRKKSHTELKIFSGD
RPOC2_MAIZE      ELHILPRS-S--SLKVLDNSIIGVDTQLTKN--TRSRLGGLVRV-KRKKSHTELKIFSGD
RPOC2_ORYNI      ELHILPRS-S--SLKVLDNSIIGVDTQLTKN--TRSRLGGLVRV-KRKKSHTELKIFSGD
RPOC2_ORYSI      ELHILPRS-S--SLKVLDNSIIGVDTQLTKN--TRSRLGGLVRV-KRKKSHTELKIFSGD
RPOC2_ORYSA      ELHILPRS-S--SLKVLDNSIIGVDTQLTKN--TRSRLGGLVRV-KRKKSHTELKIFSGD
RPOC2_ORYSJ      ELHILPRS-S--SLKVLDNSIIGVDTQLTKN--TRSRLGGLVRV-KRKKSHTELKIFSGD
RPOC2_DIOEL      EVHILPGS-S--SIMVRNNSLIGVHTRLTLN--TRSKIGGLVRV-ERKKKSIELKIFSGN
RPOC2_PHAAO      EIHILPGS-S--PIMVRNNSIIGVDTRLVLNINTRSRVGGLVRV-ERKKKSLELKIFSGD
RPOC2_LEMMI      EVHVLPGS-S--LIMVRNNSIIGVDTPLTLN--IRSRVGGLVRV-ERKKKSIELKIFSGD
RPOC2_ACOCL      EVHILPGS-S--SIMVRNNSLIGVDTRITLN--IRSRVGGLVRV-ERKKKNIELKIVSGD
RPOC2_AMBTC      EVHILPRS-S--SIMVRNNSIIGVDTRITLN--IRSQVGGLVRV-EKKKKRIELKISSGD
RPOC2_NYMAL      EVHILPGS-S--SIMVRNNSIIGVDTRITFN--TRSQIGGLVRI-EKKKK-IELKIFSGG
RPOC2_ILLOL      EVHILPGS-S--PIMVRNNSIIGVDTRITLN--TRSRIGGLVRV-ERKKKRIELKIFSGD
RPOC2_CALFG      EVHILPAS-S--PVMVRNNSIIGVNTRIALN--TRSRVGGLVRV-ERKKKRIELKIFSGD
RPOC2_LIRTU      EVHILPGS-S--PIMVRNNSIIGVDTRIALN--TRSRVGGLVRV-ERKKKKIELKIFSGD
RPOC2_DRIGR      EVHILPGS-S--SIMVRNNSIIGVDTRITLN--TRSRIGGLVRV-ERKKKRIELKIFSGD
RPOC2_CHLSC      EVHILTGS-S--SIMVRNNSIIGVDTRIALN--TRSRVGGLVRV-EKKKKRIELKIFSGD
RPOC2_CERDE      EVHILPGS-S--SIMVRNNSIIGVDTRITLN--IRSRVGGLVRV-ERKKKRIELKIFSGD
RPOC2_PIPCE      EVHILPGS-S--SIMVRNNSIIGVDTEIALN--TRSRVGGLVRV-ERKKKRTELKIFSGN
RPOC2_BUXMI      EVHILPGS-S--YIMVRNNSIIGVDTRITLN--IRSRVGGLVRV-ERKKKNIELKIFSGD
RPOC2_PLAOC      EVHILPGS-S--SIMVRNNSIIGVDTRITLN--ARSRVGGLVRV-ERKKKRIELKIFSGD
RPOC2_NANDO      EVHILPGS-S--SVMVRNNSIIGVNTRITFK--TRSRVGGLVRV-EKKKKKIELKIFSGD
RPOC2_RANMC      EVHILPGS-S--SIMIRNNSIIGVDTRITFN--IRSQVGGLVRV-EKKKKKIELKIFSGN
RPOC2_SOLBU      EVHILPGS-S--SIMVRNNSIVGVDTQITLN--LRSRVGGLVRV-ERKKKRIELKIFSGD
RPOC2_SOLTU      EVHILPGS-S--SIMVRNNSIVGVDTQITLN--LRSRVGGLVRV-ERKKKRIELKIFSGD
RPOC2_SOLLC      EVHILPGS-S--SLMVRNNSIVGVDTQITLN--LRSRVGGLVRV-ERKKKRIELKIFSGD
RPOC2_ATRBE      EVHILPGS-S--SIMVRNNSIVGVDTQITLN--LRSRVGGLVRV-ERKKKRIELKIFSGD
RPOC2_NICSY      EVHILPGS-S--SIMVRNNSIVGVDTQITLN--LRSRVGGLVRV-ERKKKRIELKIFSGD
RPOC2_TOBAC      EVHILPGS-S--SIMVRNNSIVGVDTQITLN--LRSRVGGLVRV-ERKKKRIELKIFSGD
RPOC2_NICTO      EVHILPGS-S--SIMVRNNSIVGVDTQITLN--LRSRVGGLVRV-ERKKKQIELKIFSGD
RPOC2_COFAR      EVHILPGS-S--SIMVQNNSIIGIDTQITLN--IRSRVGGLVRV-ERKKKGIELKIFSGD
RPOC2_JASNU      EVHILPRS-S--SIMVRNNSLIGVDTQLTLN--IRSRVGGFVRV-ERKKKRIELKIFSGD
RPOC2_CUSEX      EVHILPGS-S--SIMVRNHSLIGVDTQITLN--LRSRVGGLVRV-ERKKKIIELKIFFGD
RPOC2_CUSRE      EVHILPGS-S--SIMVRNQSLIGVDTQITLN--LRSRVGGLVWV-ERKKNRIELKIFFGD
RPOC2_IPOPU      EVHILPGS-SSISIMVRNNSIIGVDTQITLN--IRSRVGGLVRV-EKKKKRIELKIFSGD
RPOC2_DAUCA      EMHILPGS-S--SIMVRNNSIIGIDTQIALT--TRSRVGGLVRV-EIKKKRIELKIFSGD
RPOC2_PANGI      EVHILPGS-S--SIMVRNNSIIGVDTQITLT--TRSRVGGLVRV-ERKKKRIELKIFSGD
RPOC2_GUIAB      EIHILAES-S--SIMVRHNSIIGVDTQITLN--RRSRVGGLVRV-KKKAEKIKLIIFSGD
RPOC2_HELAN      EVHILAES-S--SIMVRHNSIIGVDTQITLN--RRSRVGGLVRV-KKKAEKIKLIIFSGD
RPOC2_LACSA      EVHILSES-S--SIMVRHNSIIGADTQITFN--RRSRVGGLVRV-KKKAEKMKLIIFSGD
RPOC2_SILLA      EVHILPGS-S--SIMVRNNSIIGVDTQITLN--TRSRVGGVVRV-ERKKKKIELKIFSGD
RPOC2_SPIOL      EVHILAGS-S--SIMVRNNSIIGVDTWITLN--TRSRIGGVVRV-ERKKKKIELTIFSGD
RPOC2_FAGEA      EVHILPRS-S--AIMVRNNSIIGVDTQITLT--TRSRVGGLVRV-EKKKKKIGLKIFSGN
RPOC2_SOYBN      EVHILPES-S--SIMVRNNSIVEVDTLITLN--IRSRVRGLVRL-EKKKKKIELKIFSGD
RPOC2_PHAVU      EVYILPEF-S--SIMVRNNSIVEVDTPITVN--IRSQVSGLVRL-EKKKKKIQLKIFSGN
RPOC2_LOTJA      EVHILSES-S--SIMVRNNSIIGVNTPITLN--KKSRVGGLVRV-EKNKKKIELKIFSGD
RPOC2_PELHO      EVHIFPET-S--SIMVRNNSIIGINTKITLN--KRSRVGGLVRV-KKIHRGIKLQIFSGD
RPOC2_OENAR      EVHILPES-S--SIMVRNNSLIGVDTRIALN--TRSRAGGLVRV-ERKKRGIALQIFSGT
RPOC2_OENPA      EVHILPES-S--SIMVRNNSLIGVDTRIALN--TRSRAGGLVRV-ERKKRGIALQIFSGT
RPOC2_OENEH      EVHILPES-S--SIMVRNNSLIGVDTRIALN--TRSRAGGLVRV-ERKKRGIALQIFSGT
RPOC2_OENGL      EVHILPES-S--SIMVRNNSLIGVDTRIALN--TRSRAGGLVRV-ERKKRGIALQIFSGT
RPOC2_OENBI      EVHILPES-S--SIMVRNNSLIGVDTRIALN--TRSRAGGLVRV-ERKKRGIALQIFSGT
RPOC2_EUCGG      EVHIFPES-S--SIMVRNNSLIGVDTRIALN--TRSRVGGLVRV-ERKKKRIELKIFSGD
RPOC2_AETCO      EVHILPES-S--VIMVQNYSIIRVDTRITLN--IRSQVGGLIRV-ERKKKRIELKIFSGD
RPOC2_AETGR      EVHILPES-S--VIMVQNYSIIRVDTRITLN--IRSQVGGLIRV-ERKKKRIELKIFSGD
RPOC2_ARATH      EVHILPES-S--AIMVQNYSIIGVDTRLTLN--IRSQVGGLIRV-EKKKKRIELKIFSGD
RPOC2_CAPBU      EVHILPES-S--AIMVQNYSIIGVDTRLTLN--IRSQVGGLIRV-ERKKKRVELKIFSGD
RPOC2_CRUWA      EVHILPES-S--DIMVQNYSIIGVNTRLTLN--IRSQVGGLIRV-ERKKKRIELKIFSGD
RPOC2_OLIPU      EVHILPES-S--AIMVQNYSIIGVDTRLALN--IRSQVGGLIRV-ERKKKRIELKIFSGD
RPOC2_BARVE      EVHILPES-S--AIMVQNYSIIGVDTRITLN--LRSRVGGLIRV-ERKKKRIELKIFSGD
RPOC2_NASOF      EVHILPES-S--AIMVQNYSIIGVDTRITLN--IRSQVGGLIRV-ERKKKRIELKIFSGD
RPOC2_LEPVR      EVHILPES-S--AIMVQNYSIIGVDTRITLN--IRSQVGGLIRV-ERKKKRIELKIFSGD
RPOC2_LOBMA      EVHILPES-S--AIMVQNYSIIGVDTRITLN--IRSQVGGLIRV-ERKKKRIELKIFSGD
RPOC2_ARAHI      EVHILPES-A--AIMVQNYSIIGVNTRITLN--IRSQVGGLIRV-ERKKKRIELKIFSGA
RPOC2_DRANE      EVHILPES-S--VIMVQNYSIIGVNTRITLN--IRSQVGGLIRV-ERKKKRIELKIFSGD
RPOC2_SINAL      EVHILPES-S--AIMVENYSIIGVDTRITLN--IRSQVGGLIRV-ERKKKRIELKIFSGD
RPOC2_CARPA      EVHILPES-S--SIMVRNNSIIGVDTRITLN--IRSQVGGLVRV-ERKKKSIELQIFSGD
RPOC2_GOSBA      EVHILSES-S--SIMVRNNSIIGVDTPITLN--TRSQVGGLVRV-ERKKKRIELKIFSGN
RPOC2_GOSHI      EVHILSES-S--SIMVRNNSIIGVDTPITLN--TRSQVGGLVRV-ERKKKRIELKIFSGN
RPOC2_CITSI      EVHIFPES-S--YLMVRNNSIIGVDTQITLN--IRSRVGGLVRM-ERKRGGVELKIFSGD
RPOC2_CUCSA      EVHILPES-S--SIMVRNNSIIGVATRLTLS--IRSRVGGLVRV-EKKKKRIELKIFSGD
RPOC2_MORIN      EVHILPES-F--SIMVRNNSIIGVDTRITLN--TRSRVGGLVRV-EKKNKRIELKIFSGD
RPOC2_POPAL      EVYILPES-S--SLMVRNNSIIGVDTQITLN--TKSRVGGLIRI-ERKKKKMELKIFSGD
RPOC2_POPTR      EVYILPES-S--SLMVRNNSIIGVDTQITLN--TKSRVGGLIRI-ERKKKKMELKIFSGD
RPOC2_MANES      EVYILPES-S--SLMVRNNSIIGVDTQIALN--TRSRVGGLVRV-ERKKKKMELKIFSGD
RPOC2_VITVI      EVHILPGS-A--SIMVRNNSIIGVDTRITLN--TRSRVSGLVRV-ERKKKRIELKIFSGD
RPOC2_WELMI      EVHFFEKS-S--PIAIQNKSIIRADTQITAK--KKSQVGGLVQI-HKKKTKLVVKILPGY
RPOC2_ADICA      EVYLTHEP-S-SSILVTNNAIVKKGAQITNN--IITKSGGLIRMRKRSRDATTIRILPGY
RPOC2_CHAGL      YVHTLVCS-R-SSILVQDGMFIEAGTEIFRG--FFMPESGLVQIKSKTNKIHEITIVPGK
RPOC2_ACAM1      ESHEVNK--DISLLLVEDGQYVEAGTEVVKD--IFCQSNGVVEVTQKNDILREVLVKPGD
RPOC2_THEEB      ETHEVNK--DISLLMVEDNQYVEAGTEVVKD--IFCQNSGVVEVIQKNDILREIIIKPGE
RPOC2_NOSS1      ETHEVNK--DISLLLVEDGQYVEAGTEVVKD--IFCQNSGVVEVTQKNDILREVVVKPGE
RPOC2_TRIV2      ETHEVNK--DISLLLVEDGQFVEAGTEVVKD--IFCQNSGVVEVTQKNDILREVVVKPGE
RPOC2_NOSP7      ESHEVNK--DISLLLVEDGQFVEAGTEVVKD--IFCQNSGVVEVTQKNDILREVVVKPGE
RPOC2_SYNE7      ETHEVNK--DISLLNVEDGQLVEAGTEVVKD--IFCQTTGIVSVTQNNDILREIVIKPGD
RPOC2_SYNP6      ETHEVNK--DISLLNVEDGQLVEAGTEVVKD--IFCQTTGIVSVTQNNDILREIVIKPGD
RPOC2_TRIEI      ECHEVNK--DISLLLVEDGQYVEAGTEIVKD--IFCQSNGVTEVHQKNDILREVVIKPGK
RPOC2_CROS5      ETHEVNK--DISLLVVEDGQYVEAGTEVVKD--IFCQCSGAIEVVQKNDILREIIIKPGE
RPOC2_SYNY3      ETHEINK--DISLLIVEDGQYVEAGTEVVKD--IFCQSSGIVEVVQKNDILREIIIKPGD
RPOC2_MICAN      ETHEVNK--DISLLQVEDGQYVEAGEEVVKD--IFCNSSGVVEVIQKNDILREIIVKPGL
RPOC2_SYNP2      ETHEVNK--DSSLRIVEDGQYVEAGTEVVKD--IFSQSAGVAEVIEKNDILREVIIKPGE
RPOC2_SYNJB      ETHEVNK--DISLLNVDDGQYVEAGTEVVKD--IFCQNAGVVEVIQKNDILREIVIKPGS
RPOC2_SYNJA      ETHEVNK--DISLLNVEDGQYVEAGTEVVKD--IFCQNAGVVEVIQKNDILREIVIKPGS
RPOC2_GLOVI      ETHEVNK--DISLLEVEDGQYVEAGVQVVKD--IYCLTSGVVAIAQRNDILREVVIKPGE
RPOC2_PROMA      ETHEINK--DISLLMIQDRQWIEAGTEVVKD--IFSQTAGIVTVTQKNDILREIIVRSGE
RPOC2_PROM4      ETHEINK--DISLLMIKDRQWIEAGTEVVKD--IFSQTAGIVTVTQKNDILREIIVRSGE
RPOC2_PROM1      ETHEINK--DISLLMIKDRQWIEAGTEVVKD--IFSQTAGIVTVTQKNDILREIIVRSGT
RPOC2_PROMT      ETHEINK--DISLLMIKDRQWIEAGTEVVKD--IFSQTAGIVTVTQKNDILREIIVRSGT
RPOC2_PROM3      ETHEINK--DISLLMIEDGQWIEAGTEVVKD--IFSQTAGIVTVTQKNDILREIIVRSGS
RPOC2_PROMM      ETHEINK--DISLLMIEDGQWIEAGTEVVKD--IFSQTAGIVTVTQKNDILREIIVRSGS
RPOC2_SYNS3      ETHEINK--DISLLMITDGQWIEAGTEVVKD--IFSQTAGIVSVTQKNDILREIIVRSGS
RPOC2_SYNPW      ETHEINK--DISLLMITDGQWIEAGTEVVKD--IFSQTAGIVTVTQKNDILREIIVRSGS
RPOC2_SYNSC      ETHEINK--DISLLMITDGQWIEAGTEVVKD--IFSQTAGIVTVTQKNDILREIIVRSGE
RPOC2_SYNPX      ETHEINK--DISLLMITDGQWIEAGTEVVKD--IFSQTAGVVTVTQKNDILREIIVRSGD
RPOC2_SYNS9      ETHEINK--DISLLMITDGQWIEAGTEVVKD--IFSQTAGVVTVTQKNDILREIIVRGGD
RPOC2_PROMS      ETHEINK--DISLLMIEDMKWIEAGTEVVKD--IFSQTSGIVTVTQKNDILREITIRNGT
RPOC2_PROM0      ETHEINK--DISLLMIEDMKWIEAGTEVVKD--IFSQTSGIVTVTQKNDILREITVRNGT
RPOC2_PROM2      ETHEINK--DISLLMIEDMKWIEAGTEVVKD--IFSQTSGIVTVTQKNDILREITVRNGN
RPOC2_PROM9      ETHEINK--DISLLMTEDMKWIEAGTEVVKD--IFSQTSGIVTVTQKNDILREITVRNGT
RPOC2_PROM5      ETHEINK--DISLLMTEDMAWIEAGTEVVKD--IFSQTSGIVTVTQKNDILREITVRNGS
RPOC2_PROMP      ETHEINK--DISLLMTEDMEWIEAGTEVVKD--IFSQTSGIVTVTQKNDILREITVRNGS
RPOC2_SYNR3      ETHEINK--DISLLMIEDGQWIEAGTEVVKD--IFSQTAGIVTVTQKNDILREIIVRSGQ
RPOC2_PAUCH      ETHEINK--DISLLMIEDGQWIEDKTEVVKD--IFSQIAGIVTVTQKNDILREITVRPGT
RPOC2_GUITH      ETHEINK--DLSLLLIKNNTLINSGTEIIKD--VYCLNSGYVEIIQEDEIVKEVIIKPGI
RPOC2_RHDSA      ETHEINK--DISLLLVEEGQCITAGTQIVKE--LYSLTEGYIQIIQENEIVKEVIVKPGK
RPOC2_PORPU      ETHEINK--DSSLLLVNNGDVIESGTELVKN--IFSKSSGIIEIIQKDGIVREIIIKPGF
RPOC2_PYRYE      ETHEINK--DSSLILVHNGDVIESGTELVKN--IFSKSSGIAEIIEKDGIVREIIIKPGS
RPOC2_GRATL      ETHEINK--DISLLLVSHGQLIDEGTEIVKN--IFTNSSGIVDIIQKEGIVREIIIKPGI
RPOC2_CYAPA      ETHEVNT--EAKNVLVKNGQYIPSGTQLIKNKKIRNKHSGVVELVHKKNFVIEIIIKPGI
RPOC2_CYACA      ETHQINK--DASILLANSGDYVNKNTEIAKG--VFCKCSGLLEIIKSNNIIKEIIIKPGV
RPOC2_EMIHU      ETFKFSTLDEVRLSFSKNESIVGVGEEIMPN-----TFSKVGGFFQIKEAEQEVTIKPGE
RPOC2_PHATC      EVYKVNC--ELNILLAEHGDFISEGFELIPG--LFSKTSGVVVIKQKNNLIHTISIKSGL
RPOC2_THAPS      ETYKLNC--DKNILLVENGNFIAKNFEIIPN--IISKTAGIITVSQKNNMIEEIAIKAGF
RPOC2_TRICV      ENYELNC--DKNLLLVEHGNFISKNFEIVPG--IVSKTGGIVMISDKNKLTQEITIKTGS
RPOC2_CHLVU      ENVFLVKSKTKRSQFSYVLKDLLSSSRFCHKVFEKNFSEQKMESVEKISQIFSSQTESFF
RPOC2_OSTTA      ------------------------------------------------------------
RPOC2_BIGNA      NFNYFQQRKEDLFQHRNIFEKVPNFSGKRFSNLSLNINNENYSISKAENKMLIQDLLTLT
RPOC2_CHLAT      ETHKVKR--STVRLFIEDGDYIPKGTKLLPN--VVSKHAGLVNISQTNDLYDEITIKPGE
RPOC2_MESVI      ETHLINK--DASLLMVRDCEYVEAGTQIIKD--LICHSSGLAQVSQTNDILREVVIKPGK
RPOC2_NEPOL      KAGWIIP--ISTKIRCKDYRLISGSILLGKW--SLPISRFAVEQAASYPAILIRPIHTYP
                                                                             

RPOC2_STAPU      ------------------------------------------------------------
RPOC2_ZYGCR      ------------------------------------------------------------
RPOC2_CHAVU      LYFLKDKQI--ALQKDQILIA-------------------PGEKIDNTNISDEWLYLKYL
RPOC2_ANEMR      IYYPDEPNK--LSERVSVLIP--------PGKQLFN------KFRC-----DHWIYFQWI
RPOC2_MARPO      IYYPNETYK--ISKQISILIP--------PGKKLFN------EFEC-----KNWTYLQWI
RPOC2_PHYPA      IYYPKEKQK--NFKQNGILIP--------PGEKIFE------QFRA-----KNWIYLEWI
RPOC2_ANTAG      VYHPEERRN--ISKQNDILVP--------PGEEISN------KFQS-----ENWLYLEWI
RPOC2_ANGEV      IYYPKRLHK--ISKQTDILIP--------PGQKIFD------EFKS-----DNWIYLQWI
RPOC2_PSINU      IHHPKRIPS--ISKQNNMLIP--------PGQSVFD------NLKF-----DHWIYLQWI
RPOC2_PINKO      ------------------------------------------------------------
RPOC2_PINTH      ------------------------------------------------------------
RPOC2_CYCTA      IYFPGEIHG--ISRHNGTLIPPGKILFD--------------EFQS-----ENWIYLQWI
RPOC2_CRYJA      ------------------------------------------------------------
RPOC2_AGRST      IHFPEEADK----VLGGCLIP--------PERKKKD----SKESKK----RKNWVYVQRK
RPOC2_LOLPR      IHFPEEADK----VLGGCLIP--------PERQKKD----SKESKK----SKNWVYVQRK
RPOC2_HORVU      IHFPEEADK----ILGGCLIP--------PERQKKD----SKESKK----KKNWVYVQRK
RPOC2_WHEAT      IHFPEEADK----ILGGCLIP--------PERQKKD----SKESKK----RKNWVYVQRK
RPOC2_SACHY      IHFPEEADK----ILGGSLIP--------PEREKKD----SKESKK----RKNWVYVQRK
RPOC2_SACOF      IHFPEEADK----ILGGSLIP--------PEREKKD----SKESKK----RKNWVYVQRK
RPOC2_SORBI      IHFPEEADK----ILGGSLIP--------PEREKKD----SKESKK----RKNWVYVQRK
RPOC2_MAIZE      IHFPEEADK----ILGGSLIP--------PEREKKD----SKESKK----RKNWVYVQRK
RPOC2_ORYNI      IHFPEEADK----ILGGSLIP--------LEREKKD----SKESKK----RENWVYVQWK
RPOC2_ORYSI      IHFPEEADK----ILGGSLIP--------LEREKKD----SKESKK----RENWVYVQWK
RPOC2_ORYSA      IHFPEEADK----ILGGSLIP--------LEREKKD----SKESKK----RENWVYVQWK
RPOC2_ORYSJ      IHFPEEADK----ILGGSLIP--------LEREKKD----SKESKK----RENWVYVQWK
RPOC2_DIOEL      IHFPGETDK--ISRHSGILIP--------PGTGKKN----FNQSKKE---LKNWIYVQRI
RPOC2_PHAAO      IHFYGEVDK--ISRHSGILIP--------PGIGKKD----SKGSKK----LKNWIYVQRI
RPOC2_LEMMI      IHFPGETDK--ISRHSGILIP--------PGTGKMT----SKESKK----LKNWIYVQRI
RPOC2_ACOCL      IHFPGETDK--ISRHSGILIP--------PGTEKKN----SKESKTK---LKNWIYVQRI
RPOC2_AMBTC      IHFPGETDN--IARYSGILIP--------PGRVKNT----ESKFK-------NWIYVQRI
RPOC2_NYMAL      IHFPGETDK--ISRHIGILIP--------PGARKKM----DKGSKGKNWEGNNWVYVQRI
RPOC2_ILLOL      IHFPGETDK--ISRHSGILIP--------PETRKKN----SKESKSK--QLKNWIYVQRI
RPOC2_CALFG      IHFPGETDK--ISRHSGILIP--------PGTGKKN----VKESK----KWKNWIYVQRI
RPOC2_LIRTU      IHFPGETDK--ISRHSGILIP--------PGTGKKN----SKESK----KWKNWIYVQRI
RPOC2_DRIGR      IHFPGEADK--ISRHSGILIP--------PGTGKKN----SKESK----KLQNWIYVQRI
RPOC2_CHLSC      IHFPGETDK--ISRHSGILIP--------PGTGKKN----PKESK----KWKNWIYVQQI
RPOC2_CERDE      IHFPGETDK--ISRHSGILIP--------PGVVKKN----SKKSKK---KWKNWIYIQRI
RPOC2_PIPCE      IHFPGETDK--ISRHSGILLP--------PGMEKKN----SKESK----KWKNWIYVQRV
RPOC2_BUXMI      IHFPGETDK--ISRHSGILIP--------PGTEKKK----SKESKKK---LKNWIYVQRI
RPOC2_PLAOC      IHFPGETDK--ISRHSGILIP--------PGTGKKN----SKKSKKK---LQNWIYVQRI
RPOC2_NANDO      IHFPGETDK--ISWHSGILIP--------PGTGKKN----SKESKN----FKNWIYVQRI
RPOC2_RANMC      IYFPGETDP--ISWHSGILIP--------PGAGKKN----SKESKK----LKNGIYVQRI
RPOC2_SOLBU      IHFPGETDK--ISRHTGVLIP--------PGTGKRN----SKEYKK----VKNWIYVQRI
RPOC2_SOLTU      IHFPGETDK--ISRHTGVLIP--------PGTGKRN----SKEYKK----VKNWIYVQRI
RPOC2_SOLLC      IHFPGETDK--ISRHTGVLIP--------PGTGKRN----SKEYKK----VQNWIYVQRI
RPOC2_ATRBE      IHFPGETDK--ISRHTGLLIP--------PGTGKIN----SKESKK----VKKWIYVQRI
RPOC2_NICSY      IHFPGETDK--ISRHTGVLIP--------PGTGKRN----SKESKK----VKNWIYVQRI
RPOC2_TOBAC      IHFPGETDK--ISRHTGVLIP--------PGTGKRN----SKESKK----VKNWIYVQRI
RPOC2_NICTO      IHFPGETDK--ISRHTGVLIP--------PGTGKRN----SKESKK----VKNWIYVQRI
RPOC2_COFAR      IHFPGETDK--ISRHSGVLIPL------PPGTGKIN----SKESKK----LKNWIYVQRI
RPOC2_JASNU      IHFPGETNK--ISRHSDVLIP----------PGKPN----SKESKK----WKNGIYVQRI
RPOC2_CUSEX      IYFPGGADN--ISQHSGVLIP-------PGTERKTN----YKESKK----VKSWIDVQRI
RPOC2_CUSRE      IYFPGGADN--LSRHSGVLIP-------PGTEIKTN----YKESKK----VKNWIYVQRI
RPOC2_IPOPU      IYFPGRADK--ISRHSGVLIP-------PGT-RKTN----EKESKK----VKNWIYVQRI
RPOC2_DAUCA      IHFPGETDK--ISRHSGVLIP--------PGTGKTN----SKESKK----GKNWIYVQRI
RPOC2_PANGI      IHFPGETDK--ISRHSGVLIP--------PGTGKTN----SKESKK----WKNWIYVQRI
RPOC2_GUIAB      IHFPEKTNK--AFR----LIP--------PGGGKKN----SKEYKK----LKNWLYIQRM
RPOC2_HELAN      IHFPGKTNK--AFR----LIP--------PGGGKQN----SKEYKK----LKNWLYIQRM
RPOC2_LACSA      IHFPGKTNK--AFR----LIP--------PGGGKPN----SKEYKK----LKNWLYIQRM
RPOC2_SILLA      IYFPGETDK--ISRHSGILIP----------PGKTN----YKESKN----IKNWLYVQRI
RPOC2_SPIOL      IHFPGETDK--ISRHSGILIP----------PSRKN----SKDSKN----LKKWIYVQRI
RPOC2_FAGEA      IHFPGKTDK--ISRHRGILIP----------PGR--------GQTK----LKNWSYVQRI
RPOC2_SOYBN      IYFPGEMDK--ISRHSAVLIP--------PRTVKKN---SK--EKK----MKNWIYVQWI
RPOC2_PHAVU      IYFPGEMDK--ISRHSAMLIP--------PRTVKKN---SKGSKKK----MKNWIYAQWI
RPOC2_LOTJA      IHFPGEIDK--ISQHSAILIP--------PEMVKKK---NSKESKK----KTNWRYIQWI
RPOC2_PELHO      ISFPRKRDKRFIPQNKDILIP--------PQIRKRN---FNK-SKK----AKNWIYVQKM
RPOC2_OENAR      IHFPGETDK--ISWDSGILIP--------PGTGKRN----SKESKK----WKNGIYVQRI
RPOC2_OENPA      IHFPGETDK--ISWDSGILIP--------PGTGKRN----SKESKK----WKNGIYVQRI
RPOC2_OENEH      IHFPGETDK--ISWDSGILIP--------PGTGKRN----SKESKK----WKNGIYVQRI
RPOC2_OENGL      IHFPGETDK--ISWDSGILIP--------PGTGKRN----SKESKK----WKNGIYVQRI
RPOC2_OENBI      IHFPGETDK--ISWDSGILIP--------PGTGKIN----SKESKK----WKNGIYVQRI
RPOC2_EUCGG      IHFPGETDK--ISRHSGILIP--------PGTGKTN----FKESKK----WKNWIYVQRI
RPOC2_AETCO      IHFPDKTDK--ISRHSGILIP--------PGRGKPN----SRESKK----VKNWIYVQRI
RPOC2_AETGR      IHFPDKTDK--IFRHSGILIP--------PGRGKPN----SRESKK----VQNWIYVQRI
RPOC2_ARATH      IHFPDKTDK--ISRHSGILIP--------PGRGKKN----SKESKK----FKNWIYVQRI
RPOC2_CAPBU      IHFPDKTDK--ISRHSGILIP--------PGRGKTN----SKESKK----FKNWIYVQRI
RPOC2_CRUWA      IHFPDKTDK--ISRHSGILLP--------PGKGKTN----SKESKK----FKNWIYVQRI
RPOC2_OLIPU      IHFPDKTDK--ISRHSGILIP--------PGRGKKN----SKESKK----FQNWIYVQRI
RPOC2_BARVE      IHFPDKTDK--ISRHSGILIP--------PGRGKTN----SKESKK----LKNWIYVQRI
RPOC2_NASOF      IHFPDKADK--ISRHSGILIP--------PGRGKTN----SKESKK----LKNWIYVQRI
RPOC2_LEPVR      IHFPDKTDK--ISRHSGILIP--------PGRGKTN----AKESKK----LKNWIYVQRI
RPOC2_LOBMA      IHFPDKTDK--ISRHSGILIP--------PGRGKTN----SKEFKK----LKNWIYVQRI
RPOC2_ARAHI      IHFPDKTDK--ISRHSGILIP--------PGRGKTN----PKESKK----LKNWIYVQRI
RPOC2_DRANE      IHFPDKTDK--ISRHSGILIP--------PGRGKTN----PKESKK----LKNWIYVQRI
RPOC2_SINAL      IHFPDKTDK--ISRHSGILIP--------PGRGKTN----SKESKI----VKNWIYVQRI
RPOC2_CARPA      IHFPGKTDK--ISRHSGILIP--------PGRGKTN----SKESKK----LKNWIYVQRI
RPOC2_GOSBA      IYFPGERDK--ISRHSGILIP--------PGTGKTN----SKESKK----LKNWIYVQRI
RPOC2_GOSHI      IYFPGERDK--ISRHSGILIP--------PGTGKTN----SKESKK----LKNWIYVQRI
RPOC2_CITSI      IHFPGEIDK--ISRHSGILIP--------PESEKTKLKEATKESKK----LKKWIYVQRI
RPOC2_CUCSA      IHFPGEMDK--ISRHNGILIP--------PERVKKN----SKKSKK----SKNWIYVQWI
RPOC2_MORIN      IHFPVEMDK--IFRHSGILIP--------PGRVKKE----FKESKK----WKNWIYVQSI
RPOC2_POPAL      IHFPRATDK--ISRYSGILIP--------PGTVKTN----SKESKK----VKNWIYVQRI
RPOC2_POPTR      IHFPRATDK--ISRYSGILIP--------PGTVKTN----SKESKK----VKNWIYVQRI
RPOC2_MANES      IHFPGETDK--ISRHSDILIP--------PGTVKTN----SKESKK----VKNWIYIQRI
RPOC2_VITVI      IQFPGETNK--ISRHIGILIP--------PGTRKKN----SKESKK----LKNWIYVQGI
RPOC2_WELMI      IDFYRKKNK--KYWYKTFVSP------------RQN---LGEDFLS-----EKNYFQTLN
RPOC2_ADICA      IYNPEKQIN--ISKRGNTLLA--------PGNRISD------DIEV-----KNWIYLQPF
RPOC2_CHAGL      LLDSIDIFDN-LKKQKFFFYP---------GEEIIP------GIKA-----EVLTYLYLF
RPOC2_ACAM1      LHLVDDP---EAVKGKDQSLLN-------PGEE-----------LLPGLSTDELRYIECV
RPOC2_THEEB      LHLVDDP---EAARLKHGTLAR-------PGEE-----------VLPGLVVDTLSQVDYL
RPOC2_NOSS1      LLMVDDP---EAVIGRDNTLLQ-------PGEE------------LLGQVATELRYIQYV
RPOC2_TRIV2      LLMVDDP---EAVIGRDNTLLQ-------PGEE------------LLGQVATELRYIQYV
RPOC2_NOSP7      LLMVDDP---ESVIGRDNTFIQ-------PGEE------------FQGNVATELRYIQYV
RPOC2_SYNE7      VHVLDDPD--TAAKYDEGRLVN-------AGEE-----------VFPGLTAEQLVWAEAV
RPOC2_SYNP6      VHVLDDPD--TAAKYDEGRLVN-------AGEE-----------VFPGLTAEQLVWAEAV
RPOC2_TRIEI      LHSGNYEIDLGDLTLMDGQIAT-------PGEE-----------VIPGLVTSELKYIEYI
RPOC2_CROS5      FHLDVDP---DEVSYKNEDLIP-------PGTE-----------VLPGVVTTDLRQVEWI
RPOC2_SYNY3      FYQDVDP---GSVKIESGQLLQ-------PGQD-----------VFPGVTVSTLSQAEWI
RPOC2_MICAN      LFMDLEP---ESSGIAQEQLIY-------PGTQ-----------LTPEVTIEELRQAEWV
RPOC2_SYNP2      LHLTEEA---IADKY-HEQLIQ-------PGEE-----------VIPGVTIDKLSYGEKV
RPOC2_SYNJB      LHLVDNP---ADLEVKSGTLIQ-------PGQP-----------VLSSIVPDRLVYLEHV
RPOC2_SYNJA      LHLVDDP---ADLEIPTGTLIQ-------PGQK-----------LLSSIVPDRLVYLEQV
RPOC2_GLOVI      LHLLDAP---SDLKVAHESFAY-------PGTE-----------VIPGVVTTDLRYVEQV
RPOC2_PROMA      FHLCTDSNILERFD-NEGQIVN-------PGET-----------IAKGIKPEAMVFVQTI
RPOC2_PROM4      FHLCNESKVLERFE-DEGQMVN-------PGEN-----------IAKGLKADSMVLVQTV
RPOC2_PROM1      FKLCKESKALDRFE-GDGQIVN-------PGET-----------IAKGIKTDSMVMVQSV
RPOC2_PROMT      FKLCKESKALDRFE-GDGQIVN-------PGET-----------IAKGIKTDSMVMVQSV
RPOC2_PROM3      FHLCAETKALERFR-GDGQIVN-------PGET-----------IAKGINSEAMVFVQTE
RPOC2_PROMM      FHLCTETKALERFT-GDGQIVN-------PGET-----------IAKGINSEAMVFVQTV
RPOC2_SYNS3      FHLCTEKKALERFQ-GDGVMVN-------PGEA-----------IAKGISSDAMVFVQAV
RPOC2_SYNPW      FHLCTEKKALERFQ-GDGVMVN-------PGEP-----------IAKGISTETMVYVQTV
RPOC2_SYNSC      FHLCTDAKALERFE-GDGQMVN-------PGED-----------IAKGLSVDTMKYVQTV
RPOC2_SYNPX      FHLSSDSKALERFE-GDGHMVN-------PGEE-----------IAKGLSIQDMKYVQTV
RPOC2_SYNS9      LRLISDNKALERFE-GDGQMVN-------PGDD-----------VAKGVSVDTMKFVQTV
RPOC2_PROMS      FHECDDEEVLNRFT-EEGNLVN-------PGEK-----------ILDGVDNKEILFVQKL
RPOC2_PROM0      FHECDDEEVLNRFT-EEGNLVN-------PGEK-----------ILDGVDNKEILFVQKL
RPOC2_PROM2      FYECDDEEVLNRFT-EEGNLVN-------PGEK-----------ILDGVDNTEILFVQKL
RPOC2_PROM9      FHECDDEEVLNRFT-EEGNLVN-------PGEK-----------ILDGIDNKEILFVQKL
RPOC2_PROM5      FHECEDEEVLNRFT-EEGQLVN-------PGEK-----------IIDGVDNNEILFVQKL
RPOC2_PROMP      FHECEDEEILSRFT-EEGKLVN-------PGEK-----------IIDGVDNDEILFVQKL
RPOC2_SYNR3      LHLVSDSKVLARYTDGGGKMVN-------PGEE-----------IAPGLKAEAMHMVEAV
RPOC2_PAUCH      LYPCNESKVIERFK-GEGLLVD-------EEEI-----------ISKNLKAEKRVFVQSV
RPOC2_GUITH      IYD-------SSELNTKRNIGT-------ICD-------------IKEVISTSTENKQIF
RPOC2_RHDSA      EHVRSTT---SNNLNEYPKIVK-------PNDP-----------DYAEYNAQGTIYIEEL
RPOC2_PORPU      IYKLTDF---YSIHDKSRGFLR-------PGET-----------LHGNISTDKLVYWEYI
RPOC2_PYRYE      IYKLSEV---YSNNDKSRGFLR-------PGER-----------LHNNISTDKLVYWEYI
RPOC2_GRATL      LYPHSKF---YDHKSKSRGFLK-------PGEI-----------ISNDLKTDKLVYWEYF
RPOC2_CYAPA      VLKIKNN---VSFSKKAKRFIQ-------PGEY-----------LFSKFVVEDLRYLDYI
RPOC2_CYACA      VYPVSNN-----LSTFTNKIFY-------PGEK-----------IIDNIVTNKIVYVEHI
RPOC2_EMIHU      LFELTSAE--SQIFDKSDRFVK-------PGNF-----------IVPGKIITQQLVYLEF
RPOC2_PHATC      VYEGK------KFKMTSKKVYY-------PGEI-----------IFSHIPITKISFCEHI
RPOC2_THAPS      VYQGK------QFEQLDKKVYY-------PGEI-----------IFDNIKITQPSLCEHI
RPOC2_TRICV      VYEGS------LFNYFKNKIFY-------PGEI-----------ILDSLKITQPSFCECF
RPOC2_CHLVU      SRNNQLLSFFSQKKRIKNKLFF-------HSQL-----------NFPSKMPRRSDVL---
RPOC2_OSTTA      -------LFFNQDTPTKKVPTF-------KIKF-----------SRFGKADK--------
RPOC2_BIGNA      ILNNNIKYFNSHKSFLDKRFFY-------NESL-----------PIPKILKDFTSILNRI
RPOC2_CHLAT      IYTPKDG---KQALEKHQCFVQ-------VGEE-----------IVDGLIAKELVYLEVI
RPOC2_MESVI      IYRPIDF---SQVLDKHQTLIQ-------AGEE-----------ICDGIIAEELVYLENV
RPOC2_NEPOL      VYPTTIW---DETINWQRGIAS-------IGSNDWHPR-----CIAPTYQAPSYVESFKG
                                                                             

RPOC2_STAPU      ------------------------------------------------------EQNEWI
RPOC2_ZYGCR      ------------------------------------------------------HKTPYI
RPOC2_CHAVU      KTDQG------------------------VSVLFARPAKEYKIDLINH-----LEHASSL
RPOC2_ANEMR      IPLE--------------------------EKPFALPRPATEYVISNR-----STQKKFL
RPOC2_MARPO      MPSK--------------------------EKPFVLIRPAVEYKISKK-----LNKSTLF
RPOC2_PHYPA      VLSK--------------------------DNSFFLIRPAIEYKIIFNDNPLTLPIPFYL
RPOC2_ANTAG      TPPK--------------------------EKPFIFIRPAIEFIVPEETD---LAETFTL
RPOC2_ANGEV      TPYR--------------------------KKTFLPVRPVLEYIISNHS---FIEISSTF
RPOC2_PSINU      TSPR--------------------------KKTFALARPVIEYFVRKGS---YPPILNLL
RPOC2_PINKO      ----------------------------------------VEHGIPDG---PNMTTPFSL
RPOC2_PINTH      ----------------------------------------VEHGIPDG---SNMTTPFSL
RPOC2_CYCTA      IPPK--------------------------EKPFVPVRPVVEYGIPDG---PDITAPLSL
RPOC2_CRYJA      ----------------------------------------PRSKMIKY---GNILGGYSI
RPOC2_AGRST      KILKS------------------------KEKYFVFVRPAVAYEMDEG---RNLATLFPK
RPOC2_LOLPR      KIIKS------------------------KEKYFVSIRPAVAYEMDEG---RNLATLFPQ
RPOC2_HORVU      KILKS------------------------KEKYFVSVRPTVAYEMDEG---RNLATLFPQ
RPOC2_WHEAT      KILKS------------------------KEKYFVSVRPTVAYEMDEG---RNLATLFPQ
RPOC2_SACHY      KILKS------------------------KEKYFVLVRPAVAYEMDEG---RNLATLFPQ
RPOC2_SACOF      KILKS------------------------KEKYFVSVRPAVAYEMDEG---RNLATLFPQ
RPOC2_SORBI      KILKS------------------------KEKYFVSVRPAVSYEMDEG---RNLATLFPQ
RPOC2_MAIZE      KFLKS------------------------KEKYFVSVRPAVAYEMDEG---INLATLFPQ
RPOC2_ORYNI      KILKS------------------------KEKYFVLVRPAVAYEMNEG---RNLATLFPQ
RPOC2_ORYSI      KILKS------------------------KEKYFVLVRPAVAYEMNEG---RNLATLFPQ
RPOC2_ORYSA      KILKS------------------------KEKYFVLVRPAVAYEMNEG---RNLATLFPQ
RPOC2_ORYSJ      KILKS------------------------KEKYFVLVRPAVAYEMNEG---RNLATLFPQ
RPOC2_DIOEL      TPTK--------------------------KKYFVSVRPVVTYEIADG---INLATLFPQ
RPOC2_PHAAO      TPTK--------------------------KKYFVLVRPVVTYEIADG---INLATLFSQ
RPOC2_LEMMI      TPTK--------------------------KKYFVSVRPVVTYEIADG---INLATFFPK
RPOC2_ACOCL      TPTK--------------------------KKYFVLVRPVATYEIADG---INLATLFPQ
RPOC2_AMBTC      TPIK--------------------------KKYFVSVRPVVTYEIADG---INLATFFPQ
RPOC2_NYMAL      TPIK--------------------------KKYFVSVRPVVTYEIADG---INLVTLFPG
RPOC2_ILLOL      TPIK--------------------------KKYFVSVRAVVIYEIADG---IHLATLFPQ
RPOC2_CALFG      TPTK--------------------------KKYFVLVRPVVTYEIADG---INLETLFPQ
RPOC2_LIRTU      TPTK--------------------------KKYFVSVRPVVTYEIADG---INLGTLFPQ
RPOC2_DRIGR      TPTK--------------------------KKYFVSVRPVVTYEIADG---INLATLFPQ
RPOC2_CHLSC      TPTK--------------------------KKYFVSVRSVVTYEIADG---INLATLFPQ
RPOC2_CERDE      TPTK--------------------------KKYFVSVRPVVTYEIADG---INLPTLFPQ
RPOC2_PIPCE      TPIK--------------------------KKYFVSVRPVVTYEIADG---INLATLFPQ
RPOC2_BUXMI      TPTK--------------------------KKYFVLVRPVVTYEIADG---INLVTLFPQ
RPOC2_PLAOC      TPIK--------------------------KKYFVFVRPVVTYEIADG---INLATLFPQ
RPOC2_NANDO      TPTK--------------------------KKYFVLVRPVVTYEIADG---INLATLFPQ
RPOC2_RANMC      TPTK--------------------------KKYFVLVRPVVTYERADG---INLAALFPQ
RPOC2_SOLBU      TPSK--------------------------KRFFVLVRPVVTYEITDG---INLGTLFPP
RPOC2_SOLTU      TPSK--------------------------KRFFVLVRPVVTYEITDG---INLGTLFPP
RPOC2_SOLLC      TPSK--------------------------KRFFVLVRPVVTYEITDG---INLGTLFPP
RPOC2_ATRBE      TPSK--------------------------KKFFVLVRPVVTYEITDG---INFETLFPP
RPOC2_NICSY      TPSK--------------------------KKFFVLVRPVVTYEITDG---INLATLFPP
RPOC2_TOBAC      TPSK--------------------------KKFFVLVRPVVTYEITDG---INLATLFPP
RPOC2_NICTO      TPSK--------------------------KRFFVLVRPVVTYEITDG---INLATLFPP
RPOC2_COFAR      TPSK--------------------------KGYFALVRPVITYEKRDG---LNLATLFPP
RPOC2_JASNU      TPRK--------------------------KKFFVLVRPVITYEITDGIN-INLATLFPP
RPOC2_CUSEX      TPSK--------------------------KKFFVLVRPVVTYEIMDD---ITSATLFPP
RPOC2_CUSRE      TLSK--------------------------KKFFFLVRPLVTYEIMDG---IPLATLFPP
RPOC2_IPOPU      TPSK--------------------------KKFFVLVRPVVTYEIMDG---ITLATLFPP
RPOC2_DAUCA      TPTN--------------------------KKYFVLVRPVVTYEITDG---INLVRLFPP
RPOC2_PANGI      TPTK--------------------------KKYFVLVRPVVTYEITDG---INLATLFFP
RPOC2_GUIAB      KLSRY------------------------EKKYFVLVQPVVPYKKTDG---INLGRLFPA
RPOC2_HELAN      KLSRY------------------------EKKYFVLVQPVVPYKKTDG---INLGRLFPA
RPOC2_LACSA      KLSRY------------------------EKKYFVLVQPVVPYKKTDG---INLGRLFPP
RPOC2_SILLA      TPTK--------------------------KKYFVLVRPVVTYEITDG---INLATLLPQ
RPOC2_SPIOL      TPTK--------------------------KKYFVLVRPVVPYEITDG---INLATLFPQ
RPOC2_FAGEA      TPTK--------------------------KRYFVLIRPAITYEITDG---ISLSTLFPQ
RPOC2_SOYBN      TITK--------------------------KKYFVLVRPVILYEIADR---INLVKLFPQ
RPOC2_PHAVU      TITK--------------------------KKYFVLVRPVILYEIADR---IKLIKFFSQ
RPOC2_LOTJA      TTTK--------------------------KKYFVLVRPVILYDIADS---INLVKLFPQ
RPOC2_PELHO      RPTN--------------------------KNSFFLLQPVVTYEIADG---INLARLFPP
RPOC2_OENAR      TPTK--------------------------KKHFVLFRPVVTYEIADG---LNLARLFPP
RPOC2_OENPA      TPTK--------------------------KKHFVLFRPVVTYEIADG---LNLARLFPP
RPOC2_OENEH      TPTK--------------------------KKHFVLFRPVVTYEIADG---LNLARLFPP
RPOC2_OENGL      TPTK--------------------------KKHFVLFRPVVTYEIADG---LNLARLFPP
RPOC2_OENBI      TPTK--------------------------KKHFVLFRPVVTYEIADG---LNLARLFPP
RPOC2_EUCGG      TPTK--------------------------KKYFVLVRPVVTYEVLDG---INLATLFPP
RPOC2_AETCO      TPTK--------------------------KKFFVLVRPVATYEIADS---INLATLFPQ
RPOC2_AETGR      TPTK--------------------------KKFFVLVRPVATYEIADS---INLATLFPQ
RPOC2_ARATH      TPTK--------------------------KKFFVLVRPVATYEIADS---INLATLFPQ
RPOC2_CAPBU      TPTK--------------------------KKFFVLVRPVATYEIADS---INLATLFPQ
RPOC2_CRUWA      TPTK--------------------------KKFFVLVRPVATYEIADS---INLATLFPQ
RPOC2_OLIPU      TPTK--------------------------KKFFVLVRPVATYEIADS---INLATLFPQ
RPOC2_BARVE      TPTK--------------------------KKFFVLVRPVATYEIADS---INLATLFPQ
RPOC2_NASOF      TPTK--------------------------KKFFVLVRPVATYEIADS---INLATLFPQ
RPOC2_LEPVR      TPTK--------------------------KKFFVLVRPVATYEIADS---INLATLFPQ
RPOC2_LOBMA      TPTK--------------------------KKFFVLVRPVATYEIADS---INLATLFPQ
RPOC2_ARAHI      TPTK--------------------------KKFFVLVRPVGTYEIADR---INLATLFPQ
RPOC2_DRANE      TPTK--------------------------KKFFVLVRPVGTYEIANS---INLATLFPQ
RPOC2_SINAL      TPTK--------------------------KKFFVLVRPVATYEIADS---INLATLFPK
RPOC2_CARPA      TPTK--------------------------KKYFVLVRPVATYEIADG---INLATLFPQ
RPOC2_GOSBA      TPTK--------------------------KKYFVLVRPVTPYEIPDG---LNLATLFPQ
RPOC2_GOSHI      TPTK--------------------------KKYFVLVRPVTPYEIPDG---LNLATLFPQ
RPOC2_CITSI      TPTK--------------------------KKSFVLVRPVVTYEIANG---INLATLFPQ
RPOC2_CUCSA      TPTK--------------------------KKYFVFVRPVIIYELADG---INLVKLFPQ
RPOC2_MORIN      TPTK--------------------------KKYFVLVRPVIIYEIADG---INLETLFPQ
RPOC2_POPAL      TPTK--------------------------KKSFVLVRPVLIYERGDG---INLERLFPP
RPOC2_POPTR      TPTK--------------------------KKSFVLVRPVLIYERGDG---INLERLFPP
RPOC2_MANES      TPTK--------------------------KKYFVLVRPVIIYEIANG---INLETLFPQ
RPOC2_VITVI      TPTK--------------------------KKYFVLVRPVVTYEIADG---INLATLFPQ
RPOC2_WELMI      KPHR--------------------------KKSFVLLRTAVEYKIPNP---KEIKVPFCP
RPOC2_ADICA      TFRR-------------------------KGKTFVLMTPVSEYNLSSD---SLAQVASRF
RPOC2_CHAGL      GVNK--------------------------QKNKLLLRPAKEFFIEKLR----KNPINLI
RPOC2_ACAM1      ---------------------------TTPEGEAVLLRPVTEFPVPDQPSVPSQES-INE
RPOC2_THEEB      E--------------------------DTPEGPAILLRPVQEFSVPDEPSVPSQDS-SDG
RPOC2_NOSS1      ---------------------------ESPEGPALLSRPVVEFAVPSNPDVPSTTSVSQQ
RPOC2_TRIV2      ---------------------------ESPEGPALLSRPVVEFAVPSNPDVPSTTSVSQQ
RPOC2_NOSP7      ---------------------------ETPEGPALLSRPVVEFAVPDNPDVPSTTSVSQQ
RPOC2_SYNE7      ---------------------------DGTDGPLLLLRPVQELVIPDEPPVPSQDSSQES
RPOC2_SYNP6      ---------------------------DGTDGPLLLLRPVQELVIPDEPPVPSQDSSQES
RPOC2_TRIEI      ---------------------------ETPEGPGLLLRPVTEFHVPDEPGVPSQKS----
RPOC2_CROS5      ---------------------------ESTEGLGLLLRPVEEYPVSNEPAAPSQGSINEE
RPOC2_SYNY3      ---------------------------ESPEGNGLLLRPVEEYKVFDEPAAPSQGSQNEE
RPOC2_MICAN      ---------------------------ETNEGLGLLLRPVQEFTVQDQSTSPTQGSANQE
RPOC2_SYNP2      ---------------------------ISTEGVALLVRPVEEFQVEDTPVEPSQGSINEQ
RPOC2_SYNJB      ---------------------------ETPEGPGLLLRPVQEYEIPDRPLVPTQESTSES
RPOC2_SYNJA      ---------------------------ETPEGPGLLLRPVYEYEIPDRPVVPSQESTSES
RPOC2_GLOVI      ---------------------------ETPEGLAVLLRPVEEFPVPDEPDAPSQEASQQA
RPOC2_PROMA      ---------------------------ETTEGKGVLLRPVEEYTIPDKAQLPELSHVTQQ
RPOC2_PROM4      ---------------------------ESRDGKGLLLRPVEEYTIPDQAQLPELSHVKQE
RPOC2_PROM1      ---------------------------ETPEGKGLLLRSVEEFTIPDQAQLPELKHVKQP
RPOC2_PROMT      ---------------------------ETPEGKGLLLRSVEEFNIPDQAQLPELKHVKQP
RPOC2_PROM3      ---------------------------DTPEGTGLLLRPVEEYTIPNEAHLPELTHVKQP
RPOC2_PROMM      ---------------------------DTPEGTGLLLRPMEEYTIPNEAQLPELTHVKQP
RPOC2_SYNS3      ---------------------------ETPEGTGLLLRPVEEYTIPNEAQLPDLGHVKQP
RPOC2_SYNPW      ---------------------------ETPEGSGLLLRPVEEYTIPNEAQLPDLGHVKQP
RPOC2_SYNSC      ---------------------------ETPEGKGLLLRPVEEYTIPNVAQLPELSHVKQA
RPOC2_SYNPX      ---------------------------ETPEGKGLLLRPVEEYTIPNEAQLPELSHVKQA
RPOC2_SYNS9      ---------------------------ETPEGKGLLLRPVEEYTIPNEAQLPELSHLKQA
RPOC2_PROMS      ---------------------------ETPKCRGLLLRTVEEFTIPDQAELPQLAHVKQE
RPOC2_PROM0      ---------------------------ETPKCRGLLLRTVEEFTIPDQAELPQLSHVKQE
RPOC2_PROM2      ---------------------------ETSKCRGLLLRTVEEFTIPDQAELPQLSHVKQE
RPOC2_PROM9      ---------------------------ETSKGRGLLLRTVEEFNIPDQAQLPNLSHVKQE
RPOC2_PROM5      ---------------------------ETSKSKGLLLRTVEEFNIPDEAELPELTHVKQE
RPOC2_PROMP      ---------------------------ETSKGKGLLLRTVEEYTIPNEAELPELSHVKQE
RPOC2_SYNR3      ---------------------------DTPEGGALLLRPVEEYAIPNEAHMPELGSVKQA
RPOC2_PAUCH      ---------------------------ETSEGPQLLIRPVEEYTIPEVAHLPELAIVKQN
RPOC2_GUITH      ---------------------------LDVIGEKLFLRPVESYNIKMSHINLKTKRLTNL
RPOC2_RHDSA      ---------------------------HYKKGNALLIRPVIEFRIDNEKIDLKTNYLTNE
RPOC2_PORPU      ---------------------------ENEQTPYILIRPVIVYSIPEIKSSLIENLTSQK
RPOC2_PYRYE      ---------------------------ENEQMPYILIRPVIVYSIPETKSSLIENLVSQK
RPOC2_GRATL      ---------------------------YVKNQSYTLIRPVIVYSIPSKTIQFKYSADSFN
RPOC2_CYAPA      ---------------------------ITSTGIILLLRPVVEYKVES----PKTIIRDDK
RPOC2_CYACA      ---------------------------KLINKSCILIRPVNQYKVSNTESLFDFVTKGEN
RPOC2_EMIHU      F--------------------------ELNEKQYILARPVQVFEVPKEEDLSLSQSFFPY
RPOC2_PHATC      ---------------------------TGKNIEQLLVRPIEIYEFPYLNNISAKIQNTHN
RPOC2_THAPS      ---------------------------NNKSNNQLLIRPFAIYEIPKEKTVKSLFSDKNN
RPOC2_TRICV      ---------------------------EGRFNDQLLIRPLQVYEVPQFKSLIQIFGTKFQ
RPOC2_CHLVU      ---------------------------NSSKLLFFTREFLSDFSFYKRKELIQK------
RPOC2_OSTTA      ---------------------------FNAKEKFLLLRSVTKLVSTQTNPLKTQ------
RPOC2_BIGNA      NFW------------------------SFSSSQFYKKHFLFALKTDNLINIKNKNFIFIS
RPOC2_CHLAT      NKPVITNRFVDKKNDVVRETQEDFIKGSENKEVVLLIRPVVQYLVPDNRDVPIPPGIHNI
RPOC2_MESVI      NLS----------------------SGS-----ALLIRPVVQFLIPNSTELKKLEAQYQL
RPOC2_NEPOL      RQTFTGEEKQEGNKPVEITSKNRRKSAANSSHETRMTQNRTWPIVLADTRIQKGASPIQI
                                                                             

RPOC2_STAPU      LTLS-----------FVDQFSKKMFSSVQTPGTSKVSEKS----EEQIIDFQEQLILNYP
RPOC2_ZYGCR      MEPL-----------LTQKISNNILNLTSYPKSSTLISKQ----KNTVSSFASIHIKRPT
RPOC2_CHAVU      ETLY-----------MKKCFDVRISHYTPYEDGQKIRNNA----GAQLISASLVFKLNNQ
RPOC2_ANEMR      NLLR------------NIDLGINTANYLLHADGEQIRVIS-GRC-TPLIRTCLIICWGKK
RPOC2_MARPO      DLLK-----------KNKKVEIKTINYLLYEDDEQIQIIN-EKN-IQLIQTCLLVHWKKK
RPOC2_PHYPA      DLLK-----------EQKKIKIQTVKYILYEDSEEVEINP-DTD-IQLIQTCLILNWETK
RPOC2_ANTAG      NSQK-----------KQEILKVKKIRYLLYEDGEEVEVTN-KTG-IQLIQTGLVLDWKED
RPOC2_ANGEV      TYSR-----------YRDIIQVQAAEYIFYEDGEEVRIRN-NTSSIQLVQTCLVVNWKEP
RPOC2_PSINU      KE--------------QNTLRVKFLDYMLYEDGEEIQIKN-NMS-IQLVQTCLLLDWEKK
RPOC2_PINKO      DLSR-----------EGDNLQIQISNSILYEDGERIQVMS--DTSIPLVRTCLGFDWEQI
RPOC2_PINTH      DLSR-----------EGDNLQIQISYSISYEDGERIQVMS--DISIPLVRTCIGFDWEQI
RPOC2_CYCTA      DLLR-----------EGDNLQVRVGNFLLYGDGERIQVIN--DISIQLVRTYLVLDWEQK
RPOC2_CRYJA      EKKR-------------NSLENQLD------GGPRLKIK---------------------
RPOC2_AGRST      DLLQ-----------EEENLQLRIVNFISHENSKLTQRIY--HTNSQFVRTCLVVNWEQE
RPOC2_LOLPR      DLLQ-----------EEDNLQLRLVNFISHENSKLTQRIY--HTNSQFVRTCLVVNWEQE
RPOC2_HORVU      DLLQ-----------EENNLQIRLVNFIYHENSKLTQRIY--HTNSQFVRTCLVVNWEQE
RPOC2_WHEAT      DLLQ-----------EENNLQIRLVNFISHENSKLTQRIY--HTNSQFVRTCLVVNWEQE
RPOC2_SACHY      DLLQ-----------EEDNLQLRLVNFISHENSKLTQRIY--HTNSQFVRTCLVVNWEQE
RPOC2_SACOF      DLLQ-----------EEDNLQLRLVNFISHENSKLTQRIY--HTNSQFVRTCLVVNWEQE
RPOC2_SORBI      DLLQ-----------EEDNLQLRLVNFISHENSKLTQRIY--HTNSQFVRTCLVVNWEQE
RPOC2_MAIZE      DLLQ-----------EEDNLQLRLVNFISHENSKLTQRIY--HTNSQFVRTCLVVNWEQE
RPOC2_ORYNI      DLLQ-----------EEGNLQLRLVNFISHENSKLTQRIY--HTNSQFVRTCLVLNWEQE
RPOC2_ORYSI      DLLQ-----------EEGNLQLRLVNFISHENSKLTQRIY--HTNSQFVRTCLVLNWEQE
RPOC2_ORYSA      DLLQ-----------EEGNLQLRLVNFISHENSKLTQRIY--HTNSQFVRTCLVLNWEQE
RPOC2_ORYSJ      DLLQ-----------EEGNLQLRLVNFISHENSKLTQRIY--HTNSQFVRTCLVLNWEQE
RPOC2_DIOEL      DLLQ-----------EKDNVQLRVVNYILYGNGKSIRGIY--HTSSQLVRTCLVLNWDQE
RPOC2_PHAAO      DLLQ-----------EKNNVQLRIVNYILYENGKSIRGIS--HTSIQLVRACLVLTWDQE
RPOC2_LEMMI      DLLQ-----------EGDNIQLRVVNYILYGNGKPIRGIS--HTSIQLVRTCLVLNWHQE
RPOC2_ACOCL      DLLQ-----------ERDNVQLRVVNYILYGNGKPIRGIS--HTSIQLVRTCLVLNWDQE
RPOC2_AMBTC      DLLQ-----------EKNNLQLRVVNYILYGDGKPIRGIF--HTSIQLVRTCLVLNWDQD
RPOC2_NYMAL      DMLQ-----------EKDNLRLQVVNYILYGDGKPIRGIS--HTSIQLVRTCLVLNWDQD
RPOC2_ILLOL      DLLQ-----------ERDNLQLRVVNYFLYGNGKPIRGIS--HKSIQLVRTCLVLNWDQD
RPOC2_CALFG      DPLQ-----------ERDNVQLRVVNYILYGNGKPIRGIS--HTSLQLVRTCLVLNWDQD
RPOC2_LIRTU      DLLQ-----------ERDNVQLRVVNYILYGNGKPIRGIY--HTSIQLVRTCLVLNWDQD
RPOC2_DRIGR      DLLQ-----------ERDNVKFRVVNSILYRNGKPIRGIY--YTSIQLVRTCLVLNWDQD
RPOC2_CHLSC      DLLQ-----------ERDNVQLRVVNYILYGNGKPIRGIS--HTSIQLVRTCLVLNWDQD
RPOC2_CERDE      DLLQ-----------ERDNMQLQVVNYIISGNGKPSRGIP--QTSIQLVRTCLVLNWDQD
RPOC2_PIPCE      DSLQ-----------ERDNVQLRVVNYILYGNGKPIRGIS--HTSIQLVRTCLVLNWDQD
RPOC2_BUXMI      DLLQ-----------ERDDVQLRVVNYILYENGKPIRGIS--DTSIQLVRTCLVLNCDQY
RPOC2_PLAOC      DLLQ-----------ERDNVQLRVVNYILYANGKPIRGIS--HTTIQLVRTCLVLNWDQG
RPOC2_NANDO      DPLQ-----------ERDNVQLRVVNYILYGNGKPIRGIS--HTNIQLVRTCLVLNWDQE
RPOC2_RANMC      DPLQ-----------ERDNVQLRVVNYILYGNGKPIRRIS--HTNIQLVRTCLVLNWDQD
RPOC2_SOLBU      DPLQ-----------ERDNVQLRIVNYILYGNGKPIRGIS--DTSIQLVRTCLVLNWNQD
RPOC2_SOLTU      DPLQ-----------ERDNVQLRIVNYILYGNGKPIRGIS--DTSIQLVRTCLVLNWNQD
RPOC2_SOLLC      DPLQ-----------ERDNVQLRIVNYILYGNGKPIRGIS--DTSIQLVRTCLVLNWNQD
RPOC2_ATRBE      DPLQ-----------ERDNVQLRIVNYILYGNGKPIRGIS--DTSIQLVRTCLVLNWNQD
RPOC2_NICSY      DPLQ-----------ERDNVQLRIVNYILYGNGKPIRGIS--DTSIQLVRTCLVLNWNQD
RPOC2_TOBAC      DPLQ-----------ERDNVQLRIVNYILYGNGKPIRGIS--DTSIQLVRTCLVLNWNQD
RPOC2_NICTO      DPLQ-----------ERDNVQLRIVNYILYGNGKPIRGIS--DTSIQLVRTCLVLNWNQD
RPOC2_COFAR      DLLQ-----------ERDNVRLQVVNYILYGNGKPIRGIS--DTSIQLVRTCLVLNWDQD
RPOC2_JASNU      DLLQ-----------ERDNVQLRVVNYILYENGNPIRGFS--HTDSQLVRTCLVLNWDQD
RPOC2_CUSEX      DLLQ-----------QRDNAQLRVVNYILHGTGKPIRGNY--DTSIQLVRTCLVFKRNQD
RPOC2_CUSRE      DLLQ-----------QRENAQLRVVNYILHGNGKPIRGNY--DASIQLVRTCLVFKRNQD
RPOC2_IPOPU      DLLQ-----------ERDNVQLRVVNYILYGNGKPIRGIS--DTSIQLVRTCLVLNWNQD
RPOC2_DAUCA      DLLQ-----------EMDNVQLRVVNYILYGNGKPIREIY--NTSIQLVRTCLVLNCTQD
RPOC2_PANGI      DLLQ-----------ERDNVQLRVVNYILYGTGKPIRGFY--DTSIQLVRTCLVLNWVQD
RPOC2_GUIAB      DLLQ-----------ESDNLQLRVVNYILYYD--PILEIW--DTSIQLVRTCLVLNWDQD
RPOC2_HELAN      DLLQ-----------ESDNLQLRVVNYILYYD--PILEIW--DTSIQLVRTCLVLNWDQD
RPOC2_LACSA      DLLQ-----------ESDNLQLRVVNYILYYD--PILEIW--DTSIQLVRTSLVLNWDQD
RPOC2_SILLA      DLLQ-----------ERGNVQLRVFNYILYGNGKVTRGIY--DTSIQLVRTCLVLNWNQD
RPOC2_SPIOL      DLLQ-----------ERDNVQLRVVNYILYGNGKVTRGIS--DTSIQLVRTCLVLNWNQD
RPOC2_FAGEA      DLLQ-----------ERDKVQLRVVNYILSGNGKPIRGIS--DTSIQLVRTCLVLNWDHD
RPOC2_SOYBN      DMFQ-----------ERDNLELKVINYILSGNGKSIRGIS--DTSIQLVRTCLVLNWDQD
RPOC2_PHAVU      DMLQ-----------ERDNLELQVINYILSGNGKSIRGIS--NTSIQLVRTCLVLNWDQD
RPOC2_LOTJA      DLFK-----------EWDNLELKVLNFILYGNGKSIRGIL--DTSIQLVRTCLVLNWNED
RPOC2_PELHO      DLLQ-----------EIDNIQLRVGNYIRYGDGELIPGISGKNPRIQLVRTFLVLNWDQD
RPOC2_OENAR      DLCQ-----------EKDNMQLQIVNYIVYGNGKPIREIS--DTSIQLVRTWFILNWDQG
RPOC2_OENPA      DLCQ-----------EKDNMQLQIVNYIVYGNGKPIREIS--DTSIQLVRTWFILNWDQD
RPOC2_OENEH      DLCQ-----------EKDNMQLQIVNYIVYGNGKPIREIS--DTSIQLVRTWFILNWDQD
RPOC2_OENGL      DLCQ-----------EKDNMQLQIVNYIVYGNGKPIREIS--DTSIQLVRTWFILNWDQD
RPOC2_OENBI      DLCQ-----------EKDNMQLQIVNYIVYGNGKPIREIS--DTSIQLVRTWFILNWDQD
RPOC2_EUCGG      DLLQ-----------ERDNMQLRVVNYIVYRNGKPIRGIS--DTSIQLVRTCLILNWDQD
RPOC2_AETCO      DLFR-----------EKNNIQLRVVNYILYGNGKPTRGIS--DTSIQLVRTCLVLNWDQD
RPOC2_AETGR      DLFR-----------EKNNIQLRVVNYILYGNGNPTRGIS--DTSIQLVRTCLVLNWDQD
RPOC2_ARATH      DLFR-----------EKDNIQLRVFNYILYGNGKPTRGIS--DTSIQLVRTCLVLNWD--
RPOC2_CAPBU      DLFR-----------EKDNIQLRVFNYILYGNGKPTRGIA--DTSIQLVRTCLVLNWDQD
RPOC2_CRUWA      DLFR-----------EKDNIQLRVFNYILYGNGKPTRGIS--HTSIQLVRTCLVLNWDQD
RPOC2_OLIPU      DLFR-----------EKDNIQLRVFNYILYGNSKPTQGIS--DTSIQLVRTCLVLNWDQD
RPOC2_BARVE      DLFQ-----------EKDNIQLRVFNYILYGNGKPTRGIS--DTSIQLVRTCLVLNWDQE
RPOC2_NASOF      DLFQ-----------EKDNIQLRVFNYILYGNGKPTRGIS--DTSIQLVRTCLVLNWDQE
RPOC2_LEPVR      DLFR-----------EKDNIQLRVFNYILYGNGKPTRGIS--DTSIQLVRTCLVLNWDQD
RPOC2_LOBMA      DLFR-----------EKDNIQLRVFNYILYGNGKPTRGIS--DTSIQLVRTCLVLNWDQD
RPOC2_ARAHI      DLFR-----------EKDNIQLRVFNYILYGNGKPTQGIS--DTSIQLVRTCLVLNWDQD
RPOC2_DRANE      DLFR-----------EKDNIELRVFNYILYGNGKPTRGIS--DTSIQLVRTCLVLNWDQD
RPOC2_SINAL      DLFR-----------EKDNIQLRVFNYILYGNGKPTRGIS--DTSIQLVRTCLVLNWDQD
RPOC2_CARPA      DLFR-----------EKDNMQLRVVNYILYGNGKPVRGIF--DTSIQLVRTCLVLNWDQD
RPOC2_GOSBA      DPFQ-----------EKDNMQLRAVNYILYGNGKPTRRIS--DTSIQLVRTCLVLSWDQD
RPOC2_GOSHI      DPFQ-----------EKDNMQLRAVNYILYGNGKPTRRIS--DTSIQLVRTCLVLSWDQD
RPOC2_CITSI      DPLR-----------EKDNMQFRVVNYVLYGKGKAAGGIS--DTSLQLVRTCLVLNWDQD
RPOC2_CUCSA      DLLQ-----------ERDNLELRVANYILYGNGKPIRGIS--GTSIQLVRTCLLLNWDRD
RPOC2_MORIN      DPLQ-----------EKDNLELRVVNYILYGNGKPILGIS--GTCIQLVRTCLVLNWDQG
RPOC2_POPAL      DLLQ-----------EKENLKLRIVNYILYGNGKPIQGIS--NTSIQLVRTCLVLNWNQD
RPOC2_POPTR      DLLQ-----------EKENLKLRIVNYILYGNGKPIQGIS--NTSIQLVRTCLVLNWNQD
RPOC2_MANES      DLLQ-----------EKDNLKLRVVNYILYGTGKPIRGIS--DTSIQLVRTCLVLNWDQD
RPOC2_VITVI      DLLQ-----------ERDNMHLQVVNYILYGNGKPIRGIS--DTSIQLVRTCLVLNWYQE
RPOC2_WELMI      DLLR-----------EEDNLHIQMSNCFYGDGGKKLQKGI------QLIQTCLIFNWEQI
RPOC2_ADICA      DKPK-----------TQRRAKAKTLSFICCKNGEKIEVIN--DVPTQLVRLCLIIEWQKY
RPOC2_CHAGL      PIFG-----------TKKDIKIALFEFIVYEDGQQVRSKG----KIELVQTCLITNIKKG
RPOC2_ACAM1      ---------------AGRAICLKAVQRLPYKDGERVKSVE----GVDLLRTQLVLEIDTD
RPOC2_THEEB      ---------------SGQSIRLRAVQRLPYKHDERVKSVD----GVDLLRTQLVLEIGSE
RPOC2_NOSS1      ---------------TGRSIQMRAVQRLPYKDSERVKSVE----GVELLRTQLVLEIEQE
RPOC2_TRIV2      ---------------TGRSIQMRAVQRLPYKDSERVKSVE----GVELLRTQLVLEIEQE
RPOC2_NOSP7      ---------------TGRSIQLRAVQRLPYKDSERVKSVE----GVELLRTQLVLEIEQE
RPOC2_SYNE7      ---------------SSRSIRLRAVQRLQFQDGERIKSVE----GVDLLRTQLVLESEEG
RPOC2_SYNP6      ---------------SSRSIRLRAVQRLQFQDGERIKSVE----GVDLLRTQLVLESEEG
RPOC2_TRIEI      ---------------INSSIELRAVQRIPFKDGERVKSVE----GIELLRTQLVLEIGEE
RPOC2_CROS5      E--------------VGRHIELRSVQRLFYKDGERVKSVD----GIHLLSTQLVLEIETG
RPOC2_SYNY3      ---------------GGRQIELRSVQRLFYKDGDRVKSVE----GAPLLSTQLVLEIYGS
RPOC2_MICAN      ---------------GGRHIELRSVQRIFFKDGERVKSVE----GCQLISTQLVLEISSE
RPOC2_SYNP2      G--------------AGRNIELHAVQRLFFKDGERVKSVD----GVSLLSTQLIIEIGAI
RPOC2_SYNJB      ----------------GRSIRLRAVQRVPFKDGERVKSVG----PVELLRTQLVLEIDTD
RPOC2_SYNJA      ----------------GRSIRLRAVQRVPFKDGERVKSVG----PVELLRTQLVLEIDTD
RPOC2_GLOVI      ----------------GSSIRLRGMQRIPYRDGDRVKAID----GIELLKTQLVLEITDQ
RPOC2_PROMA      ---------------QGPSLGLKATQRLGYKDGELIKSVE----GVELLKTQLILETFDT
RPOC2_PROM4      ---------------KGPSLGLRATQRLAFKDGELIKSVE----GVELLKTQLILDTFET
RPOC2_PROM1      ---------------KGPSLGIKASQRLAYKDGELIKSVE----GVELLKTQLMLETFDT
RPOC2_PROMT      ---------------KGPSLGVKASQRLAYKDGELIKSVE----GVELLKTQLMLETFDT
RPOC2_PROM3      ---------------KGPHLGIKATQRLAFKDGELIKSVE----GVELLKTQLILETFDT
RPOC2_PROMM      ---------------KGPHLGIKATQRLAFKDGELIKSVE----GVELLKTQLILETFDT
RPOC2_SYNS3      ---------------NGPHLGIKATQRLAFKDNELVKSVE----GVELLRTQLMLETFDT
RPOC2_SYNPW      ---------------NGPHLGLKASQRLAFKDNELVKSVE----GVELLRTQLMLETFDT
RPOC2_SYNSC      ---------------NGPHLGIKATQRLAFKDNELIKSVE----GVELLKTQLLLETFDT
RPOC2_SYNPX      ---------------NGPHLGIKATQRLAFKDNELIKSVE----GVELLKTQLILETFDT
RPOC2_SYNS9      ---------------NGPHLGIKATQRLAFKDNELIKSVE----GVELLKTQLLLETFDT
RPOC2_PROMS      ---------------KGPYLGLKAIQRLTYKDGELIKSVE----GVELLRTHLSIESFDA
RPOC2_PROM0      ---------------KGPHLGLKAIQRLTYKDGELIKSVE----GVELLRTHLSIESFDA
RPOC2_PROM2      ---------------KGPHLGLKAIQRLTYKDGELIKSVE----GVELLRTHLSIESFDA
RPOC2_PROM9      ---------------KGPHLGLKAIQRLTYKDGELIKSVD----GVELLRTHLSIESFNA
RPOC2_PROM5      ---------------KGPSLGLKAIQRLSYKDGELIKSVE----GVELLKTHLSLESFDA
RPOC2_PROMP      ---------------KGPSLALKAIQRLSYKDGELIKSVE----GVELLKTNLSIESFDA
RPOC2_SYNR3      ---------------NGPSMGLKAVQRLAFKDGELVKSVE----GVELLRTQLLLETFDT
RPOC2_PAUCH      ---------------SGPYLGLKATQRLNFKDGELIKSVE----GVELLKTQLILETFDT
RPOC2_GUITH      ----------------EDILNLKVVNRSLYKDGEKIKSVY----GLDLVKTYLIVNFNSN
RPOC2_RHDSA      ----------------NHHITIKPTKRVLFKDGQRVKSKY----GVDLLKTYLIMSVDFD
RPOC2_PORPU      ----------------VNQTKLKLVKRTVFRDGERVKSID----GVHLVTTNLVAEINHH
RPOC2_PYRYE      ----------------PSQTKLKLVKRTPFRDGERVKSIE----GVHLVTTNLVAEIEHR
RPOC2_GRATL      ----------------SHICSLKLVKRIYFRDGERVKSVS----GIDIVKTYLIAELNKD
RPOC2_CYAPA      -----------------NHLKISSIQSILYKDGERIKSVQ----GIELFKIQLKLQVRKG
RPOC2_CYACA      ----------------KDLISLKVVNKSFFKDGEVIKSVK----GVSLVNIQLIFYTKPS
RPOC2_EMIHU      N--------------SHEHIKLKVIKRVFYKNWEKIISNN----GINLLQTFIVFDFKQE
RPOC2_PHATC      ---------------KDSNIRLSSKIIYSYKPNQLIKGTR----NLNLISTILTLKSKE-
RPOC2_THAPS      ---------------SKSIFTITNKITYLYKTNQKIKTSN----HINLISQNINLKAKN-
RPOC2_TRICV      ---------------TDLPFNLTNNISYRCKSNKIIKESR----NFTIIDNILDVNIRT-
RPOC2_CHLVU      -----------------RERKPHTLQNIKVKNKKFLQVIQ----PCFQLKKKRCLSNLFF
RPOC2_OSTTA      -----------------FANNLFVQNSINKNKKTFLEVVK----PLKTFQKK--------
RPOC2_BIGNA      RIPQIQAVNFALKKSLKSSFDLKSYEILQYNLKFPLGFYS----LIKMIIEERSLFDIDY
RPOC2_CHLAT      ----------------RNNINLKAIQFIRYQDGETVSSFE----PVELVQVSLAIDLKES
RPOC2_MESVI      ----------------KQNISIQPSIHICYKDGQRIHAWQ----SMEIAKIFLRLEI---
RPOC2_NEPOL      ----------------EWTWPHAKNPWISPNHGAIAGHIR----FVNMTILDSSSISTKQ
                                                                             

RPOC2_STAPU      ------------------------------------------------------------
RPOC2_ZYGCR      ------------------------------------------------------------
RPOC2_CHAVU      NL------AHKAE-----------------------------------------------
RPOC2_ANEMR      YF------TEKAH-----------------------------------------------
RPOC2_MARPO      YF------FKEAN-----------------------------------------------
RPOC2_PHYPA      VF------IKEAH-----------------------------------------------
RPOC2_ANTAG      SS------IKKVY-----------------------------------------------
RPOC2_ANGEV      SI------VRVAY-----------------------------------------------
RPOC2_PSINU      SP------IKAAK-----------------------------------------------
RPOC2_PINKO      DS-----IESEAY-----------------------------------------------
RPOC2_PINTH      DS-----IESEAY-----------------------------------------------
RPOC2_CYCTA      DS-----ME-EAY-----------------------------------------------
RPOC2_CRYJA      ----------KTY-----------------------------------------------
RPOC2_AGRST      EK-----EKAGA------------------------------------------------
RPOC2_LOLPR      KK-----EKAGA------------------------------------------------
RPOC2_HORVU      EK-----EKAGA------------------------------------------------
RPOC2_WHEAT      EK-----EKAGA------------------------------------------------
RPOC2_SACHY      EK-----EGARA------------------------------------------------
RPOC2_SACOF      EK-----EGARA------------------------------------------------
RPOC2_SORBI      VK-----EGARA------------------------------------------------
RPOC2_MAIZE      EK-----EGARA------------------------------------------------
RPOC2_ORYNI      EK-----EEARA------------------------------------------------
RPOC2_ORYSI      EK-----EEARA------------------------------------------------
RPOC2_ORYSA      EK-----EEARA------------------------------------------------
RPOC2_ORYSJ      EK-----EEARA------------------------------------------------
RPOC2_DIOEL      --QNDSIEE--VH-----------------------------------------------
RPOC2_PHAAO      --KKSSIEEK-VH-----------------------------------------------
RPOC2_LEMMI      --EKSSIED--SH-----------------------------------------------
RPOC2_ACOCL      --QNGSIEG--VR-----------------------------------------------
RPOC2_AMBTC      --RAGSIEEEEAY-----------------------------------------------
RPOC2_NYMAL      --KKGSIEKVQA------------------------------------------------
RPOC2_ILLOL      --QNGSIEEVYA------------------------------------------------
RPOC2_CALFG      --RNGSIEEVHA------------------------------------------------
RPOC2_LIRTU      --RNGSIEEVHA------------------------------------------------
RPOC2_DRIGR      --RNGSIEKVKA------------------------------------------------
RPOC2_CHLSC      --RNGSIEEAHA------------------------------------------------
RPOC2_CERDE      --LKGSLEEIHA------------------------------------------------
RPOC2_PIPCE      NKKTSSIEEVFA------------------------------------------------
RPOC2_BUXMI      KN-GSSMEEIHA------------------------------------------------
RPOC2_PLAOC      KN-GSSIKEVHA------------------------------------------------
RPOC2_NANDO      KN-GSSMEEVHA------------------------------------------------
RPOC2_RANMC      KK-GSSIEEVRA------------------------------------------------
RPOC2_SOLBU      KK-SSSCEEARA------------------------------------------------
RPOC2_SOLTU      KK-SSSCEEARA------------------------------------------------
RPOC2_SOLLC      KK-SSSCEEARA------------------------------------------------
RPOC2_ATRBE      KK-SSSCEEARA------------------------------------------------
RPOC2_NICSY      KK-SSSCEEARA------------------------------------------------
RPOC2_TOBAC      KK-SSSCEEARA------------------------------------------------
RPOC2_NICTO      KK-SSSCEEARA------------------------------------------------
RPOC2_COFAR      KK-SSSSEEAPA------------------------------------------------
RPOC2_JASNU      KKKSASSEEARA------------------------------------------------
RPOC2_CUSEX      KK-SYYSEAARA------------------------------------------------
RPOC2_CUSRE      KK-SSYSEAARA------------------------------------------------
RPOC2_IPOPU      KK-SSSSEAARA------------------------------------------------
RPOC2_DAUCA      KK-SSYIEETRT------------------------------------------------
RPOC2_PANGI      KK-SSSIEEART------------------------------------------------
RPOC2_GUIAB      KK----IEKACA------------------------------------------------
RPOC2_HELAN      KK----IEKACA------------------------------------------------
RPOC2_LACSA      KK----IEKACA------------------------------------------------
RPOC2_SILLA      KK-DSSIEEARA------------------------------------------------
RPOC2_SPIOL      KK-GSSIEEARG------------------------------------------------
RPOC2_FAGEA      KK-SSSIEESRA------------------------------------------------
RPOC2_SOYBN      KK-FSSIENAHA------------------------------------------------
RPOC2_PHAVU      KK-VSSIEKGHA------------------------------------------------
RPOC2_LOTJA      EK-SSSIEEALA------------------------------------------------
RPOC2_PELHO      KK-DSSIEEAHA------------------------------------------------
RPOC2_OENAR      KK-SASAEAAHA------------------------------------------------
RPOC2_OENPA      KK-SASAEAAHA------------------------------------------------
RPOC2_OENEH      KK-SASAEAAHA------------------------------------------------
RPOC2_OENGL      KK-SASAEAAHA------------------------------------------------
RPOC2_OENBI      KK-SASAEAAHA------------------------------------------------
RPOC2_EUCGG      KK-SSSIEEAHT------------------------------------------------
RPOC2_AETCO      NK-NSSLEEARA------------------------------------------------
RPOC2_AETGR      NK-KSSLEEARA------------------------------------------------
RPOC2_ARATH      -K-NSSLEEVRA------------------------------------------------
RPOC2_CAPBU      NK-NSALEAVRA------------------------------------------------
RPOC2_CRUWA      NK-NSSLEEVRA------------------------------------------------
RPOC2_OLIPU      NK-NSSLEEVRA------------------------------------------------
RPOC2_BARVE      NK-NSSVEEVRA------------------------------------------------
RPOC2_NASOF      NN-NSSLEEIRA------------------------------------------------
RPOC2_LEPVR      NK-NSSLEEVRA------------------------------------------------
RPOC2_LOBMA      NK-NSSLEEVRS------------------------------------------------
RPOC2_ARAHI      NK-NSSLEEVRA------------------------------------------------
RPOC2_DRANE      TK-NSSLEEVRA------------------------------------------------
RPOC2_SINAL      NK-NSSLEEVRA------------------------------------------------
RPOC2_CARPA      NK-SSSVEEVRT------------------------------------------------
RPOC2_GOSBA      NK-SSFAEEVCA------------------------------------------------
RPOC2_GOSHI      NK-SSFAEEVCA------------------------------------------------
RPOC2_CITSI      NK-SSSVEEVCA------------------------------------------------
RPOC2_CUCSA      KK-SSSIEDARA------------------------------------------------
RPOC2_MORIN      NK-SSSSEETHA------------------------------------------------
RPOC2_POPAL      KK-SSSIEEARV------------------------------------------------
RPOC2_POPTR      KK-SSSIEEARV------------------------------------------------
RPOC2_MANES      KK-SSSIEEARA------------------------------------------------
RPOC2_VITVI      KK-SSPIEKTHA------------------------------------------------
RPOC2_WELMI      DS-----TESETS-----------------------------------------------
RPOC2_ADICA      LH--ETLPRKRNY-----------------------------------------------
RPOC2_CHAGL      PY------SENAK-----------------------------------------------
RPOC2_ACAM1      APQ---------------------------------------------------------
RPOC2_THEEB      APQ---------------------------------------------------------
RPOC2_NOSS1      GEQEHN------------------------------------------------------
RPOC2_TRIV2      GEQEHN------------------------------------------------------
RPOC2_NOSP7      GEQDHN------------------------------------------------------
RPOC2_SYNE7      SSQ---------------------------------------------------------
RPOC2_SYNP6      SSQ---------------------------------------------------------
RPOC2_TRIEI      APQ---------------------------------------------------------
RPOC2_CROS5      SEQA--------------------------------------------------------
RPOC2_SYNY3      GNEG--------------------------------------------------------
RPOC2_MICAN      EPES--------------------------------------------------------
RPOC2_SYNP2      EGEDEDV-----------------------------------------------------
RPOC2_SYNJB      APQ---------------------------------------------------------
RPOC2_SYNJA      APQ---------------------------------------------------------
RPOC2_GLOVI      AAQ---------------------------------------------------------
RPOC2_PROMA      TPQ---------------------------------------------------------
RPOC2_PROM4      TPQ---------------------------------------------------------
RPOC2_PROM1      TPQ---------------------------------------------------------
RPOC2_PROMT      TPQ---------------------------------------------------------
RPOC2_PROM3      TPQ---------------------------------------------------------
RPOC2_PROMM      TPQ---------------------------------------------------------
RPOC2_SYNS3      TPQ---------------------------------------------------------
RPOC2_SYNPW      TPQ---------------------------------------------------------
RPOC2_SYNSC      TPQ---------------------------------------------------------
RPOC2_SYNPX      TPQ---------------------------------------------------------
RPOC2_SYNS9      TPQ---------------------------------------------------------
RPOC2_PROMS      TPQ---------------------------------------------------------
RPOC2_PROM0      TPQ---------------------------------------------------------
RPOC2_PROM2      TPQ---------------------------------------------------------
RPOC2_PROM9      TPQ---------------------------------------------------------
RPOC2_PROM5      TPQ---------------------------------------------------------
RPOC2_PROMP      TPQ---------------------------------------------------------
RPOC2_SYNR3      TPQ---------------------------------------------------------
RPOC2_PAUCH      TPQ---------------------------------------------------------
RPOC2_GUITH      KPY---------------------------------------------------------
RPOC2_RHDSA      KPH---------------------------------------------------------
RPOC2_PORPU      DPN---------------------------------------------------------
RPOC2_PYRYE      DDN---------------------------------------------------------
RPOC2_GRATL      SLN---------------------------------------------------------
RPOC2_CYAPA      LKH---------------------------------------------------------
RPOC2_CYACA      ATA---------------------------------------------------------
RPOC2_EMIHU      QQG---------------------------------------------------------
RPOC2_PHATC      ------------------------------------------------------------
RPOC2_THAPS      ------------------------------------------------------------
RPOC2_TRICV      ------------------------------------------------------------
RPOC2_CHLVU      LQKLSYQIFPERKFFYETWLNQSSFDFSLPSPFSTKQFKTTGFFSKNELQKASFDFQPSF
RPOC2_OSTTA      ------------------------------------------------------------
RPOC2_BIGNA      FQKFIIQYKNFSFHLINKKLKNIFTNNSYGSFTDESTLLESKYFNKRRPTKTTFSKLMNQ
RPOC2_CHLAT      GQKTAAIELIPIQDNDMVTTSSKHINKSKKPYDKNLSV----------------------
RPOC2_MESVI      ------------------------------------------------------------
RPOC2_NEPOL      ELDHREAQVIPTTQTVSGVHRLTPLLEKTVFSQD--------------------------
                                                                             

RPOC2_STAPU      -------------------------------------LSKTTIFLKEPSILAKNYSIAEK
RPOC2_ZYGCR      -------------------------------------IGFQFQLPIVPKIRCYSLGLLGK
RPOC2_CHAVU      --------------------------ISWTRIKFQRKISYYLQINLRDKILPYSYSLSEL
RPOC2_ANEMR      --------------------------VSLLKIKTTNNSRNYLQISLIYFDSLDEKRQ---
RPOC2_MARPO      --------------------------VSFLKIKTKNNFKTFLQISLIEYSNLEKKK----
RPOC2_PHYPA      --------------------------ISFIKIRINKIIKNFFQINLIENINLMNKKK---
RPOC2_ANTAG      --------------------------ASLTEIETNGLSKKFLQISLIEHPIFEIEKK---
RPOC2_ANGEV      --------------------------VSPIEIRFNNILKTFLQISLIEFSNAYVEKG---
RPOC2_PSINU      --------------------------TSILELRINKIIKTFLQISLLNSFDFYVK-----
RPOC2_PINKO      --------------------------VSLISVRTNKIVNNMVQISLMKY--PPFFMG---
RPOC2_PINTH      --------------------------VSLISVRTNKIVNNMVQISLMKY--PPFFMG---
RPOC2_CYCTA      --------------------------AYLTEVRTNGIVRNXLQISLAKY--PILYMG---
RPOC2_CRYJA      --------------------------ASLISVGTNEIIINMIQISLLKY--PFFNIA---
RPOC2_AGRST      ---------------------------SLVEVRANNLIRDFLRIELVKS--TISYTR---
RPOC2_LOLPR      ---------------------------SLVEVRANDLIRDFLRIELIKC--TISYTR---
RPOC2_HORVU      ---------------------------SLVEVRANDLIRDFLRIELVKS--TISYTR---
RPOC2_WHEAT      ---------------------------SLVEVRANDLIRDFLRIELVKS--TISYTR---
RPOC2_SACHY      ---------------------------SLVEVRTNDLIRDFLRIELVKS--TISYTR---
RPOC2_SACOF      ---------------------------SLVEVRTNDLIRDFLRIELVKS--TISYTR---
RPOC2_SORBI      ---------------------------SLVEVRTNDLIRDFLRIELVKS--TISYTR---
RPOC2_MAIZE      ---------------------------SLVEVKTNDLIRDFLRIELVKS--TILYTR---
RPOC2_ORYNI      ---------------------------SLVEIRANGLIRDFLRIGLIKS--TISYTR---
RPOC2_ORYSI      ---------------------------SLVEIRANGLIRDFLRIGLIKS--TISYTR---
RPOC2_ORYSA      ---------------------------SLVEIRANGLIRDFLRIGLIKS--TISYTR---
RPOC2_ORYSJ      ---------------------------SLVEIRANGLIRDFLRIGLIKS--TISYTR---
RPOC2_DIOEL      --------------------------TSFIEVRANDLIRDFIRIDLIKS--TISYTG---
RPOC2_PHAAO      --------------------------ASFVEIRTNDLLCYFIRIELVKS--TLSYTE---
RPOC2_LEMMI      --------------------------ASFVEIKTNDLTCNFIRIELGKS--PLLYTG---
RPOC2_ACOCL      --------------------------ASFVEVRANDLIRDFIRIELCKS--AILYTG---
RPOC2_AMBTC      --------------------------TSLAEVRVNDLIRNFIRIDLVKS--PISSTG---
RPOC2_NYMAL      ---------------------------SSAEVRANDLIRYFIRIDLVKS--PILYTG---
RPOC2_ILLOL      ---------------------------SFVKVRANDLIRDFIRIDLVKS--PIS------
RPOC2_CALFG      ---------------------------SFVEVRANGLIRDFLKIDLVKS--PILYSG---
RPOC2_LIRTU      ---------------------------SFVEVGTNDLIRDFIRIDLVKS--PISYIG---
RPOC2_DRIGR      ---------------------------SIVEVRANDLIRDFIRIDLVKS--PISYTG---
RPOC2_CHLSC      ---------------------------SFVEVRANALIRDFIRIHLVKS--PISYTV---
RPOC2_CERDE      ---------------------------SFVEVRTNDLIRDFIRIDLVKS--PISYTG---
RPOC2_PIPCE      ---------------------------SFVEVRANDLIRDFIRVDLVKP--RVLNTG---
RPOC2_BUXMI      ---------------------------SFVEVRTNGLIRYFLRMDLVKS--PISYIV---
RPOC2_PLAOC      ---------------------------SFVEVRANDLIQDFIRMDLVKS--TISHTG---
RPOC2_NANDO      ---------------------------SFVEVRVNNLIRDFIRMDLVKS--PISYTR---
RPOC2_RANMC      ---------------------------SFVEIKINALIRDFIKMDLVKY--PISYTR---
RPOC2_SOLBU      ---------------------------SFVEIRTNGLIRHFLRINLVKS--PISYIG---
RPOC2_SOLTU      ---------------------------SFVEIRTNGLIRHFLRINLVKS--PISYIG---
RPOC2_SOLLC      ---------------------------SFVEIRTNGLIRHFLKINLVKS--PISYIG---
RPOC2_ATRBE      ---------------------------SFVEIRTNGLIRHFLRINLVKS--PISYIG---
RPOC2_NICSY      ---------------------------SFVEIRTNGLIRHFLRINLVKS--PISYIG---
RPOC2_TOBAC      ---------------------------SFVEIRTNGLIRHFLRINLVKS--PISYIG---
RPOC2_NICTO      ---------------------------SFVEIRTNGLIRHFLRINLVKS--PISYIG---
RPOC2_COFAR      ---------------------------SFVEIRTNGLIRHFLRIDLVKS--PISYIV---
RPOC2_JASNU      ---------------------------SFVEIRTNGLIRHFLRIDLVKS--PISYIG---
RPOC2_CUSEX      ---------------------------SVVEIRTNYLIRHFLRIDFVKA--PISYIG---
RPOC2_CUSRE      ---------------------------SVVEIRTNYLIRHFLRIDFVKA--PISYIG---
RPOC2_IPOPU      ---------------------------SVVELRTNDLIRHFLRIDFVKS--PISYIG---
RPOC2_DAUCA      ---------------------------SFVEIGINGLSRDFIKIDLVKS--PISYTA---
RPOC2_PANGI      ---------------------------SFVEIRINSLIRDFLKIDLAKS--PILYTG---
RPOC2_GUIAB      ---------------------------SFVEIRTNGLIRDFLRIDLAKS--PISYTG---
RPOC2_HELAN      ---------------------------SFVEIRTNGLIRDFLRIDLAKS--PISYTG---
RPOC2_LACSA      ---------------------------SFVEIRTNGLLRYFLRIDLAKS--PISYTG---
RPOC2_SILLA      ---------------------------SFVEVRTNGIIRYFLKIGLMNR--ALSYIG---
RPOC2_SPIOL      ---------------------------SFVEVRTNGMIQDFLKVNLVKP--AISYIS---
RPOC2_FAGEA      ---------------------------SFVEVKTNDMMRDFLRIDLVKS--TISYAG---
RPOC2_SOYBN      ---------------------------SFVEISIKGLVRYFLRIDLVKS--HISY--I-R
RPOC2_PHAVU      ---------------------------SFVELSINGLVRYFLKIALVKS--HISY--I-R
RPOC2_LOTJA      ---------------------------SFVEVSTNGLIRYFLRIDLVKS--HISY--I-R
RPOC2_PELHO      ---------------------------SFVEVSTKGMVRDFLRIHLRKS--QIAYAYM-R
RPOC2_OENAR      ---------------------------SFVEVRAKGLIRDFLRIDLVKS--PILDP---R
RPOC2_OENPA      ---------------------------SFVEVRAKGLIRDFLRIDLVKS--PILDP---R
RPOC2_OENEH      ---------------------------SFVEVRAKGLIRDFLRIDLVKS--PILDP---R
RPOC2_OENGL      ---------------------------SFVEVRAKGLIRDFLRIDLVKS--PILDP---R
RPOC2_OENBI      ---------------------------SFVEVRAKGLIRDFLRIDLVKS--PILDP---R
RPOC2_EUCGG      ---------------------------SFVEVSTNGLIRDFLRIDLVKF--PISYL---R
RPOC2_AETCO      ---------------------------FFVAVSTKGLIRDFIRIGLVKS--HISYI---R
RPOC2_AETGR      ---------------------------FFVAVSTKGLIRDFIRIGLVKS--HISYI---R
RPOC2_ARATH      ---------------------------FFVEVSTKGLIQDFIRIGLVKS--HISYI---R
RPOC2_CAPBU      ---------------------------FFVEVSTKGLIRDFIRIGLVKS--HISYI---R
RPOC2_CRUWA      ---------------------------FFVEVSTKGLIRDFIRIGLVKS--HISYI---R
RPOC2_OLIPU      ---------------------------FFVEVSTKGLIRDFIRIGLVKS--HISYI---R
RPOC2_BARVE      ---------------------------FFVEVSTKGLIRDFIRIGLVKS--HMSYI---R
RPOC2_NASOF      ---------------------------FFVEVSTKGLIRDFIRIGLVKS--HISYI---R
RPOC2_LEPVR      ---------------------------FFVEVSTKGLIRDFIRIGLVKS--HISYI---R
RPOC2_LOBMA      ---------------------------FFVEVSTKGLIRDFIRIGLVKS--HISYI---R
RPOC2_ARAHI      ---------------------------FFIEVSTKGLIRDFIRIGLVKS--HISYI---R
RPOC2_DRANE      ---------------------------FFIEVSTKGLIRDFIRIGLVKS--HISYI---R
RPOC2_SINAL      ---------------------------FFVEVNTKGLIRDFIRIGLVKS--HISYI---R
RPOC2_CARPA      ---------------------------FFVEVSTNSLIRDFLRIDLVKSQSHISYI---R
RPOC2_GOSBA      ---------------------------SFVEVRTNGLIRDFLRIDLVKS--HIFYI---R
RPOC2_GOSHI      ---------------------------SFVEVRTNGLIRDFLRIDLVKS--HIFYI---R
RPOC2_CITSI      ---------------------------SFVEVRTNGLIRNFLRINLVKS--NISYL---R
RPOC2_CUCSA      ---------------------------SFVEVSTNGLVRNFLRIDLGKS--DTAYI---R
RPOC2_MORIN      ---------------------------SFVEVSTRDLIRDFLRINLVKS--HISYI---R
RPOC2_POPAL      ---------------------------YFVEVSINGLIRDFLRIHLGKS--RISYI--SR
RPOC2_POPTR      ---------------------------YFVEVSINGLIRDFLRIHLGKS--RISYI--SR
RPOC2_MANES      ---------------------------AFVEISTNGLIRDFLRINLVKF--HISYI--GR
RPOC2_VITVI      ---------------------------SFMEVRTNGLIRDFLTINLVKS--YISYT---G
RPOC2_WELMI      --------------------------ISITSIRIKNIVINTIQFSLRKHS-DSAWSQ---
RPOC2_ADICA      --------------------------FSLISVKISYLFKTFLQVNPMVSPPTQRGVRVDE
RPOC2_CHAGL      --------------------------FFSIDVFFKNLRNRFLNFCFSNQTNFEKMLS---
RPOC2_ACAM1      -------------------------IAADIEILPDEKDEEVSRLQLVILETLVIRRDVSA
RPOC2_THEEB      -------------------------LAADIEIVTDEVDPEAQRLQLVILESLIIRRDIAA
RPOC2_NOSS1      ----------------------ASPLAADIELIPDLEDADVQRLQLVILESLVLRRDIAA
RPOC2_TRIV2      ----------------------ASPLAADIELIPDPEDADVQRLQLVILESLVLRRDIAA
RPOC2_NOSP7      ----------------------ASPLAADIELVEDTENPEVQRLQLVILESLVIRRDITA
RPOC2_SYNE7      -------------------------LSADIELLPDSKDPETLRLQLVIIEPVVIRRDVAS
RPOC2_SYNP6      -------------------------LSADIELLPDSKDPETLRLQLVIIEPVVTRRDVAS
RPOC2_TRIEI      -------------------------LAADIELLPDLEEEGIMRLQLVILESLVIRRDVVA
RPOC2_CROS5      ----------------------AANLAADIELKND-EEEDCQRLQLVILESLILRRDLDT
RPOC2_SYNY3      ----------------------ISHLSADIELQDD-EEEDCQRLQLVILESLVLRRDQES
RPOC2_MICAN      ----------------------VSHLTADIELEPI-EDRDCQRLQLVILESLVLRRDSDN
RPOC2_SYNP2      ----------------------LANLYADIELQDDPTDDEVKRLQLVILESLILRRDSDS
RPOC2_SYNJB      -------------------------LKADIELIQDEKDPDIRRLQLVILETLLLRRDVEA
RPOC2_SYNJA      -------------------------LKADIELIQDEKDPSIRRLQLVILETLLLRRDVEA
RPOC2_GLOVI      -------------------------LAADIEFVPDEKDPSMVRLQLVILETLLIRRDVAA
RPOC2_PROMA      -------------------------MTVDVEVTEDQSTKTIQRLRLVILESILVRRDTIS
RPOC2_PROM4      -------------------------MTVDVEVALDKRAKTINRLRLVILESILVRRDTMS
RPOC2_PROM1      -------------------------MTVDVEVIHDLNSKG-DRLKLVILESILVRRDTTS
RPOC2_PROMT      -------------------------MTVDVEVIQDLNSKG-DRLKLVILESILVRRDTTS
RPOC2_PROM3      -------------------------MTVDVEAVRDKRAKTIERLRLVILESILVRRDTIS
RPOC2_PROMM      -------------------------MTVDVEAVRDKRAKTIERLRLVILESILVRRDTIS
RPOC2_SYNS3      -------------------------MTVDVEAVPDKRAKTIERLQLVILESILVRRDTIS
RPOC2_SYNPW      -------------------------MTVDVEAVPDKRAKTIERLQLVILESILVRRDTIS
RPOC2_SYNSC      -------------------------MTVDVEKAPDKRAKTISRLRLVILESILVRRDTMS
RPOC2_SYNPX      -------------------------MTVDVEKAPDKRAKTISRLRLVILESILVRRDTMS
RPOC2_SYNS9      -------------------------MTVDVERAPDKRAKTISRLRLVILESILVRRDTMS
RPOC2_PROMS      -------------------------MTIDVESIEDKNDSSINRLNLVILESILVRRDTIS
RPOC2_PROM0      -------------------------MTIDVESIEDKNDASINRLNLVILESILVRRDTLS
RPOC2_PROM2      -------------------------MTIDVESIKDDKDESINRLNLVILESILVRRDTVS
RPOC2_PROM9      -------------------------MTIDVESMEDENDASINRLNLVILESILVRRDTMS
RPOC2_PROM5      -------------------------MTIDVETIKDKSNDSINRLNLVILESILVRRDTIS
RPOC2_PROMP      -------------------------MTIDVETIQDKSDKSINRLNLVILESILVRRDTIS
RPOC2_SYNR3      -------------------------MTVDVESAQDKRAKTIQRLQLTILETHLVRRDTLS
RPOC2_PAUCH      -------------------------MTVDVEKVTDKRSKTLERLQLVILETLLVRRDTIS
RPOC2_GUITH      -------------------------ASADIEFAPIENS-TKYKLNLTITESIQLNYDIFG
RPOC2_RHDSA      -------------------------LSADVEFVPAHED-DIYKLHLTVLETLQIKQDDFG
RPOC2_PORPU      -------------------------LVSAIEFLAKEDSSNCFALGLSTFETLSIKSID-N
RPOC2_PYRYE      -------------------------LISSIEFSAKESGNNYFDLRLSTFETLSIKSIDVN
RPOC2_GRATL      -------------------------LKCTLQLNLDSNNRSISRMRIVTMDKLSLKDENNI
RPOC2_CYAPA      ---------------------------LPIKTNFIPSSQNSFELEFLIIESILPKNDKYF
RPOC2_CYACA      -------------------------VTTKMEFVKDLDKSTNSTSEIKLRITATETTKIKY
RPOC2_EMIHU      -----------------------------LEPRLEFTPSKVPGKSFLKIALYEVIKTFEN
RPOC2_PHATC      -------------------------TVTKNLNLELSHNQKTKLIDLKISEKFNLNHYISP
RPOC2_THAPS      -------------------------SVQNNTIIDLSNSFKTKRLNLRISENLLLKHYIPA
RPOC2_TRICV      -------------------------FAKKQFEIELFSDVKKNHLNFLVSEKLSLNHFILP
RPOC2_CHLVU      LSQKISSSSQLTLRGSWVSMTNSFKIHFEVKTPKFFGKIEEFQQKKFFDKKLKFGIQSPS
RPOC2_OSTTA      ------------------------------------------------------------
RPOC2_BIGNA      IKFKFFIKVPLLLSTFSKKDTVLFNIFITNKKENFRNYKIVNMLTNDFYKNLNLQTHSSE
RPOC2_CHLAT      ----------------------KEKNRNRVTQILSLDKGKLFEFQIGLFESLFIRSNEYI
RPOC2_MESVI      -----------------------DSHLHKLNVTLNLIENKLL--QIKMFEYLMIDLNQII
RPOC2_NEPOL      -----------------------DGEIQRMLPFSRALVKPVRTNRSKTRRNASGKTQVKA
                                                                             

RPOC2_STAPU      DSCIGLLGE--------------------------------------------------F
RPOC2_ZYGCR      ------------------------------------------------------------
RPOC2_CHAVU      KKLKFNSHFSNKNK-----QINNIDEVILGDTIFHTPLLTKNYGCI------------RT
RPOC2_ANEMR      GDMVYSQYILRRN------------YYDDFF-----SICRNRLKSK---HKG---IIRIS
RPOC2_MARPO      -EKTISKNVLKKN------------YYDHFF-----SISKNELKNK---KQG---VIRII
RPOC2_PHYPA      NNNIILNYLFKKKR-----------YIINQK-----DCEKILLLSK---TWG---IIRTP
RPOC2_ANTAG      KNNVNLKYLFTNEI-----------NYSSHS-----FNYENGLFNG---YRG---IIRIS
RPOC2_ANGEV      NSRASLKRLFSNQ------------PFYSNNAN---NHLLSQFPIN---HPG---VVRRL
RPOC2_PSINU      --GSKFKRFFNNKK-----------SFVADSIP---KTLESQLSIK---HQG---TIRSV
RPOC2_PINKO      RRDNKASSNLMFHN-----NLDHTNLFSSNGAS-------QLISKH------QG-TICSL
RPOC2_PINTH      RRDNKTSPNLMFHN-----NLDHTNLLSSNGAS-------QLISKH------QG-IICSL
RPOC2_CYCTA      KRKNTAGSKSMFHN-----KLDHANPISSNEES-------QLLSQH------QG-TIRAL
RPOC2_CRYJA      KRENIASSPFLFHN-----KLGHTNLN---DQS-------KLLSK--------G-TIRSL
RPOC2_AGRST      KRYDRTSAGPIPHN--RLDHTN-TNSFYSKAKI-------ESLSQ----HQE---ATGTL
RPOC2_LOLPR      KRYDRTSAGPIPHN--RLDHTN-LNSFYSKAKI-------ESLSQ----HQE---AIGTL
RPOC2_HORVU      KRYDRTSGGPTPHN--RLDRAN-SNSFYSKAKI-------ESLSQ----HQE---AIGTL
RPOC2_WHEAT      KRYDRTSAGPIPHN--RLDRAN-INSFYSKAKI-------ESLSQ----HPE---AIGTL
RPOC2_SACHY      RRYDRTSVGLIPNN--RLDRNN-TNSFYSKAKI-------QSLSQ----HQE---VIGTL
RPOC2_SACOF      RRYDRTSVGLIPNN--RLDRNN-TNSFYSKAKI-------QSLSQ----HQE---VIGTL
RPOC2_SORBI      RRYDRTSVGLIPNN--RLDRNN-TNSFYSKAKI-------QSLSQ----HQE---VIGTL
RPOC2_MAIZE      RRYDRTSVGLIPNN--RLDRNN-TNSFYSKAKI-------QSLSQ----HQE---VIGTL
RPOC2_ORYNI      KRYDSRSAGLILHN--RLDRTN-TNSFYSKAKI-------QSLSQ----HQE---AIGTL
RPOC2_ORYSI      KRYDSRSAGLILHN--RLDRTN-TNSFYSKAKI-------QSLSQ----HQE---AIGTL
RPOC2_ORYSA      KRYDSRSAGLILHN--RLDRTN-TNSFYSKAKI-------QSLSQ----HQE---AIGTL
RPOC2_ORYSJ      KRYDSRSAGLILHN--RLDRTN-TNSFYSKAKI-------QSLSQ----HQE---AIGTL
RPOC2_DIOEL      KRNDTGSSGLIPDN--GLNSTN-INPFYSKSK-------IQSLTQ----DQETI-GMGTL
RPOC2_PHAAO      KRYDTAGSGLISNN--ELDRIHRKNPFDSKAK-------IQIFPQ----HQGT---LGTL
RPOC2_LEMMI      KRNSVVSSGLINHN--GLDYLN-SNPFYSKAK-------IPSLTK----QKGT---GGTL
RPOC2_ACOCL      KRKDIAGSGLIHDN--VSDRTN-INPVYLKDK-------IPSFIQ----HQGT---VGTL
RPOC2_AMBTC      KENDMAGSGLIPNN--GSDRIN-TNPFFSKAK-------TQSLSQ----HQGT---IRTL
RPOC2_NYMAL      KRNDRSGS-VIPDT--GSYCAN-TNLFSSKVK-------IKSLSQ----HQGT---VRTF
RPOC2_ILLOL      KRNDTAGSGLIPVN--GSDRTN-INPFCSKAR-------IQSLSQ----HQGT---VRTF
RPOC2_CALFG      KRNDTTSSGFIPNN--GSDRTN-INPFYFKAR-------IQSLTQ----HQGT---IRTL
RPOC2_LIRTU      KRDDTTGSGLIPDN--ESDRTN-INTFYSKTR-------IQSLTQ----HQGT---IRTF
RPOC2_DRIGR      KRNDMAGSGLIPDN--GSDHTN-INPFYSKVRR------IQSLTQ----HQGT---IRTL
RPOC2_CHLSC      KRNDTASSGLIPDN--ASDRPN-INPFDFKAR-------VQSLTQ----HQGT---IRTL
RPOC2_CERDE      KRNDTWGSGLNPDS--ISDCTN-INPFYSKAR-------LPSFTQ----PKGT---VRTL
RPOC2_PIPCE      KRNDTAGYGLNPDN--GSDCPN-RNPFYSKIK-------IQSFTQ----DNGT---IHTS
RPOC2_BUXMI      KRNDPSSSGLIPDN--GSDRNN-INPFYSIYY---KARIQQSLSQ----HQG---TIRTL
RPOC2_PLAOC      KRNDPAGSGLIPDN--GSDRTN-INPFYS------KARIQQSLSR----HQG---TLRSL
RPOC2_NANDO      KRNAPAGSELILAN--GSDYTN-LNPFYS------KARIQQSLTQ----HQG---TIRTL
RPOC2_RANMC      KRNDPVGSGLIPVN--GSDHTN-LNPFYS------KASIKQSLIR----HQG---TIRTL
RPOC2_SOLBU      KRNDPSGSGLLSDN--GSDCTN-INPFSAIYSY-SKAKIQQSLNQ----PQG---TIHTL
RPOC2_SOLTU      KRNDPSGSGLLSDN--GSDCTN-INPFSAIYSY-PKAKIQQSLNQ----PQG---TIHTL
RPOC2_SOLLC      KRNDPSGSGLLSDN--GSDCTN-INPFSAIYSY-SKAKIQQSLNQ----PQG---TIHTL
RPOC2_ATRBE      KRNDPSGSGLLSDN--GSDCTN-INPFSSIYSY-SKAKIQQSLNQ----PQG---TIHTL
RPOC2_NICSY      KRNDPSGSGLLSDN--GSDCTN-INPFSSIYSY-SKAKIQQSINQ----PQG---TIHTL
RPOC2_TOBAC      KRNDPSGSGLLSDN--GSDCTN-INPFSSIYSY-SKAKIQQSINQ----PQG---TIHTL
RPOC2_NICTO      KRNDPSGSGLLSDN--GSDCTN-INPFSSIYSY-SKAKIQQSLNQ----PQG---TIHTL
RPOC2_COFAR      KRNDPSGSGLLSDN--GSDCTN-INPFSSIYSY-SKARIQQFLNP----NQG---TIHTL
RPOC2_JASNU      KRNDPSGSGLPSDN--GSGWTN-MNPFSSIYS---KARIQQSLNQ----NQG---TIHTL
RPOC2_CUSEX      KRNDPLGLGLLADN--GLDWTH-KNPYS-------EARIHQNLNQ----NQG---TIHTF
RPOC2_CUSRE      KRYDPLGLGLLAE-----DWTH-KNPYS-------KARIHQNLNQ----NKG---TIHTF
RPOC2_IPOPU      KRNDPWGLGLLADN--GLDWTN-INPYS-------KARIQQTLNQ----NQG---TIHTF
RPOC2_DAUCA      KRNDPSRSGLIYEN--GSDCTN-INPFSSRFFYYSNARIKESLNQ----NQG---TIHTL
RPOC2_PANGI      KRKDPSGSGLISEN--GSDRTN-INPFSSSFFY-SKARIKESLNQ----NQG---TIHTL
RPOC2_GUIAB      KRNDLPGSGLIYEN--GSDRAN-VNPFSSIYSS-SKARIQESLNP----NQG---TIHTL
RPOC2_HELAN      KRNDLPGSGLISEN--GSDRAN-GNPFSSIYSY-SKATIQESLNP----NQG---TIHTL
RPOC2_LACSA      KRNDLSGSGLISEN--GSDRAN-VNPFSSIYSY-SKSRIKESLNP----NQG---TIHTL
RPOC2_SILLA      KRNNPP-LFSDDGL----EYTN-MNPFFSIYS---KPKLQQAFNP----NQG---TVRML
RPOC2_SPIOL      KRNDPS-SEKKEGS----DHTN-MNPFYSIYIY-PKTKLQKSFNQ----NQG---TVRTL
RPOC2_FAGEA      KRNDPSGSGLLSDN----ESDR-MNPFYSIYIY-SKARLQQPFSQ----NNE---TVRTL
RPOC2_SOYBN      KRNNPPGSRFILD--NESDRTT-INPFFSIDSR--EK-IQQSLSK------NHG-TIRML
RPOC2_PHAVU      KRNDPSGSRFILD--NESDWTN-INPFFSMNSR--EK-VQQSLSQ------NHG-TIHML
RPOC2_LOTJA      KRNDPSSSGLISY--NESDRIN-INPFFSI-YK--EN-IQQSLSQ------KHG-TIRML
RPOC2_PELHO      KRNDPSGSGFPSD--NELDHSN-RNPFSSSYPK--AR-VRQSL---------NG-TIRTL
RPOC2_OENAR      KRNDPSGSGLISD--NVSDHTN-INPFYSKPK------MKQSPRQ----NHG---TIRTL
RPOC2_OENPA      KRNDPSGSGLISD--NVSDHTN-INPFYSKPK------MKQSPRQ----NHG---TIRTL
RPOC2_OENEH      KRNDPSGSGLISD--NVSDHTN-INPFYSKPK------MKQSPRQ----NHG---TIRTL
RPOC2_OENGL      KRNDPSGSGLISD--NVSDHTN-INPFYSKPK------MKQSPRQ----NHG---TIRTL
RPOC2_OENBI      KRNDPSGSGLISD--NVSDHTN-INPFYSKPK------MKQSPRQ----NHG---TIRTL
RPOC2_EUCGG      KRNDPSGSGLISDSDNVSDHTN-SNPFYSKTK------IQQLLSQ----NQG---TIRTL
RPOC2_AETCO      KRNNPPDSGLISA--DH------MNPFYSISPK--AGI-QQSLSQ----NNG---TIRMF
RPOC2_AETGR      KRTNPPDSGLISA--DH------MNPFYSISPK--AGI-QQSLSQ----NNG---TIRMF
RPOC2_ARATH      KRNNSPDSGLISA--DH------MNPFYSISPK--SGILQQSLRQ----NHG---TIRMF
RPOC2_CAPBU      KRKNSPDSGFISA--DH------MNPFYPISPK--AGILQQSLRQ----NRG---TIRMF
RPOC2_CRUWA      KRNNSPDSGLISA--DH------MNPFYSISPK--AGILQQSLRQ----NHG---TIRMF
RPOC2_OLIPU      KRNNSRDSGLISA--DH------MNPFYSISPK--AGILQQSLRQ----NHG---TIRMF
RPOC2_BARVE      KRNNTPDSGLISA--DN------MNPVYSISPK--VGIFQQSLRQ----NHG---TIRMF
RPOC2_NASOF      KRNNPSDSGLISA--DH------MNPFYSISPK--AGILQQSLRQ----NHG---TIRMF
RPOC2_LEPVR      KRNNPPDSGWISA--DH------MNPFYSISPK--ADILQQSLRQ----NHG---TIRMF
RPOC2_LOBMA      KRQNPADSGLISA--DH------MNPFYSISPK--AGILQQSLRQ----NHG---TIRMF
RPOC2_ARAHI      KRNNPPDSGWIYA--DH------INPFYSISPK--AFILQQSLRQ----NHG---TIRMF
RPOC2_DRANE      KRNNPPDSGLISA--DH------INPFYSISPK--AFILQQSLRQ----NHG---TVRMF
RPOC2_SINAL      KRNNPSSEKKEGS--DHS-----MNPFYSISPK--AGILHQSLRQ----NHG---TIRMF
RPOC2_CARPA      KRNDPSGSGLISD--NGSD--R-INPFYYKER------IQQSLSK----NHG---TIRTL
RPOC2_GOSBA      KRNDPSGSELISD--NRSDRTN-KNPFYSIYSN--ARI-QQSFSQ----NHG---TIHTL
RPOC2_GOSHI      KRNDPSGSELISD--NRSDRTN-KNPFYSIYSN--ARI-QQSFSQ----NHG---TIHTL
RPOC2_CITSI      KRDHPSGSGLISD--NGSARTN-SNPFYSVFGK--AGV-EQSLRQ----NQG---TIRTL
RPOC2_CUCSA      KRKDPSGSGLIFN--NESDRTN-INPFFSIYSK--TR-VPQSPSQ----NQG---TIRTL
RPOC2_MORIN      KRNDPLGSVLISD--NRSDRT---NPFYSIYSK--EK-IRQLLKE----NQG---TIHTL
RPOC2_POPAL      KRNDPSGLGLISD--NGPDRTN-INPFYSIYSK--TR-IPQSLKQ----NQGTI-SISTL
RPOC2_POPTR      KRNDPSGLGLISD--NGPDRTN-INPFYSIYSK--TR-IPQSLKQ----NQGTI-SISTL
RPOC2_MANES      KRNDPSGSEPISN--NGSDRTN-INPFYPIYSK--TR-VQQSLKQ----NQG---TISTL
RPOC2_VITVI      KRNDPSSSGLIAD--NGSDHTN-INPFYSIYPK--ER-IQQLLRQRQKKNQG---TIRTL
RPOC2_WELMI      KKNQISSKRTFPPV------LDKTQSFSLSGKI-------QLPSN----------YTATF
RPOC2_ADICA      IFRTSTPLGKPSPPQLDLANSCCKSAVNCQGIIHLTLEPATSFLILSPFNLSRNNSVTDT
RPOC2_CHAGL      KRNFHKNLYFCFKT------LNNKNKENLANKK-----NKDSLIQ----NKG---YLQLL
RPOC2_ACAM1      DQTQGS------------------------------------------------TKTRLL
RPOC2_THEEB      DQTQGS------------------------------------------------TFTSLL
RPOC2_NOSS1      DATQGS------------------------------------------------TQTSLE
RPOC2_TRIV2      DATQGS------------------------------------------------TQTSLE
RPOC2_NOSP7      DATQGS------------------------------------------------TQTTLE
RPOC2_SYNE7      DTTHGS------------------------------------------------THTELR
RPOC2_SYNP6      DTTHGS------------------------------------------------THTELR
RPOC2_TRIEI      DTTQGS------------------------------------------------TSTRLL
RPOC2_CROS5      DPHGGT------------------------------------------------ITTSVL
RPOC2_SYNY3      DPLGGA------------------------------------------------SKTRLL
RPOC2_MICAN      DPLGGN------------------------------------------------IQTRVL
RPOC2_SYNP2      DPFGGQ------------------------------------------------VQTRLM
RPOC2_SYNJB      DLTQGS------------------------------------------------THTRLL
RPOC2_SYNJA      DLTQGS------------------------------------------------THTRLL
RPOC2_GLOVI      DLLHGS------------------------------------------------TLTHIL
RPOC2_PROMA      DSSHGS------------------------------------------------THTELQ
RPOC2_PROM4      DSSHGS------------------------------------------------THTELQ
RPOC2_PROM1      DSSHGS------------------------------------------------THTELQ
RPOC2_PROMT      DSSHGS------------------------------------------------THTELQ
RPOC2_PROM3      DSSHGS------------------------------------------------THTELQ
RPOC2_PROMM      DSSHGS------------------------------------------------THTELQ
RPOC2_SYNS3      DSSHGS------------------------------------------------THTELQ
RPOC2_SYNPW      DSSHGS------------------------------------------------THTELQ
RPOC2_SYNSC      DSSHGS------------------------------------------------THTELQ
RPOC2_SYNPX      DSSHGS------------------------------------------------THTELQ
RPOC2_SYNS9      DSSHGS------------------------------------------------THTDLQ
RPOC2_PROMS      DSSHGS------------------------------------------------THTELQ
RPOC2_PROM0      DSSHGS------------------------------------------------THTELQ
RPOC2_PROM2      DASHGS------------------------------------------------THTELQ
RPOC2_PROM9      DSSHGS------------------------------------------------THTELQ
RPOC2_PROM5      DSSHGS------------------------------------------------THTELQ
RPOC2_PROMP      DSSHGS------------------------------------------------THTELQ
RPOC2_SYNR3      DASHGS------------------------------------------------THTEVK
RPOC2_PAUCH      DASHGS------------------------------------------------THTELQ
RPOC2_GUITH      AINNED------------------------------------------------VKTSLV
RPOC2_RHDSA      ESKKKS------------------------------------------------TITSLC
RPOC2_PORPU      KVEKEQ------------------------------------------------SQTRII
RPOC2_PYRYE      KSEKQQ------------------------------------------------SQTRII
RPOC2_GRATL      ASTKDLY-----------------------------------------------TRTRLL
RPOC2_CYAPA      DSTVLESLAK--------------------------------------------AQTKIL
RPOC2_CYACA      KQQKNI-------------------------------------------------ISQIL
RPOC2_EMIHU      NRKSSHSSLP--------------------------------------------TTTRNF
RPOC2_PHATC      NLRYKN------------------------------------------------LQSCLL
RPOC2_THAPS      HLKYTN------------------------------------------------LQYCLL
RPOC2_TRICV      QLRYTD------------------------------------------------IQSCLL
RPOC2_CHLVU      KSLSKALSFG-------------------------IPIPEFSLAVSRKIIFEKAHTYIFQ
RPOC2_OSTTA      -------------------------------------------------------TNFFP
RPOC2_BIGNA      KNSQLKLSSKNLEI------------FNLFYTSSIINVIMKKSITNFNKNFFIDNLFQFS
RPOC2_CHLAT      ESNSQK------------------------------------------------NICRLL
RPOC2_MESVI      DFQSYQ------------------------------------------------NVTRLV
RPOC2_NEPOL      QARSQA------------------------------------------------KARSVR
                                                                             

RPOC2_STAPU      FIFLNELSIVSVRTFISTSQINLFLKK---------------------------------
RPOC2_ZYGCR      --------------LQRPLQYNLVLSS---------------------------------
RPOC2_CHAVU      FSRRRQDNKTSFVLLSSSDQLELPLPI---------------------------------
RPOC2_ANEMR      SDRKDEYR--SSIILSPPDLIEVSK---------------------------------MI
RPOC2_MARPO      SNQNNGMQ--SFIILSSSDLVKTFK---------------------------------FK
RPOC2_PHYPA      SNKNQEKS--FFLILSPFNLFQTIL---------------------------------FD
RPOC2_ANTAG      SNENQEDK--SLPILSPFDFVQIFLSKNSEEYTPEMKDEGNFNLDTNSIFYAKSFVKKFN
RPOC2_ANGEV      SDQGT-DR--SFVVLLPSDSYQSFYSP---CHDGRNRRKQ----------------FVES
RPOC2_PSINU      SNR---KT--SFLVLSPSDSFQNSLSTNFQYYDSKNRYGK----------------KKEL
RPOC2_PINKO      SNGEEDSG--SFMVLSPSDCFRIVLFN---------------------------------
RPOC2_PINTH      SNGEEDSG--SFMVLSPSDYFRIVLFN---------------------------------
RPOC2_CYCTA      PNEREEGG--SLMVLSPSDCSRIVLSK---------------------------------
RPOC2_CRYJA      PNENKKDE--SFTILSPSDFLQIVLFH---------------------------------
RPOC2_AGRST      LNRNKEYQ--PLMILSASNCSRIGLFK---------------------------------
RPOC2_LOLPR      LNRNKEYQ--SLMILSASNCSQIGLFK---------------------------------
RPOC2_HORVU      LNRNKEYQ--SLMILSASNCSRIGLFK---------------------------------
RPOC2_WHEAT      LNRNKEYH--SLMILSASNCSRIGLFK---------------------------------
RPOC2_SACHY      LNRNKEYP--SLMILLASNCSRIGLFK---------------------------------
RPOC2_SACOF      LNRNKEYP--SLMILLASNCSRIGLFK---------------------------------
RPOC2_SORBI      LNRNKEYP--SLMILLASNCSRIGLFK---------------------------------
RPOC2_MAIZE      LNRNKEYP--SLMILLASNCSRIGLFK---------------------------------
RPOC2_ORYNI      LNRNKEYQ--SLMVLSASNCSRIGFFK---------------------------------
RPOC2_ORYSI      LNRNKEYQ--SLMVLSASNCSRIGFFK---------------------------------
RPOC2_ORYSA      LNRNKEYQ--SLMVLSASNCSRIGFFK---------------------------------
RPOC2_ORYSJ      LNRNKEYQ--SLMVLSASNCSRIGFFK---------------------------------
RPOC2_DIOEL      LNRNKECQ--SLIILSSSNCSQIGPF----------------------------------
RPOC2_PHAAO      LNRNKECQ--SFLILSSSNCSRIGPF----------------------------------
RPOC2_LEMMI      LNGNKECQ--SLKILLSSNYSRIGPF----------------------------------
RPOC2_ACOCL      LNRNKECQ--SLILLSSSNCFRIGPF----------------------------------
RPOC2_AMBTC      LNRNKEGQGESLMVLSSSNCSRIGPL----------------------------------
RPOC2_NYMAL      LNRNKEGQ--SLIVFSSSNCSRI-------------------------------------
RPOC2_ILLOL      LNRNKEGE--SFLVLSSSNCSRIGPF----------------------------------
RPOC2_CALFG      LNRNKECQ--SFLILSSSDCSRIGSF----------------------------------
RPOC2_LIRTU      LNRNKECQ--SFLILSSSDCSRIGPF----------------------------------
RPOC2_DRIGR      LNRNKECQ--SFLILSSSNCSRIGPF----------------------------------
RPOC2_CHLSC      LNRNKECQ--SLIILSSSNCSRLGPF----------------------------------
RPOC2_CERDE      RN--KEYQ--SLIILSSSDCYQIGPF----------------------------------
RPOC2_PIPCE      LNINKQLP--PFLILSSSNCFQAGPLKV--------------------------------
RPOC2_BUXMI      LNRNKECQ--SLIILSSSNCSRMHPFN---------------------------------
RPOC2_PLAOC      LNRNKECQ--SLIILSSSNCSQMGPLN---------------------------------
RPOC2_NANDO      LNRNKECQ--SLIFLSSSNCFRIGPFK---------------------------------
RPOC2_RANMC      LNKNKECQ--SLITLSSSNCSRIDPFN---------------------------------
RPOC2_SOLBU      LNRNKECQ--SLIILSAANCSRMEPFK---------------------------------
RPOC2_SOLTU      LNRNKECQ--SLIILSAANCSRMEPFK---------------------------------
RPOC2_SOLLC      LNRNKECQ--SLIILSAANCSRMEPFK---------------------------------
RPOC2_ATRBE      LNRNKECQ--SLIILSSANCSRMGTLK---------------------------------
RPOC2_NICSY      LNRNKECQ--SLIILSAANCSRMGPFK---------------------------------
RPOC2_TOBAC      LNRNKECQ--SLIILSAANCSRMGPFK---------------------------------
RPOC2_NICTO      LNRNKECQ--SLIILSAANCSRMGPFK---------------------------------
RPOC2_COFAR      LNKNREFQ--SLIILLSSNCSRMGPFA---------------------------------
RPOC2_JASNU      LNRNTGFQ--SLRILSSSNCSRMGPFN---------------------------------
RPOC2_CUSEX      LNRNKESQ--SLSILSSSNCSRMDPAN---------------------------------
RPOC2_CUSRE      FNRNKGSQ--SLIILSSSNCSRMDPAN---------------------------------
RPOC2_IPOPU      LNRNKGCQ--SLSILSSSNCSRMDPVN---------------------------------
RPOC2_DAUCA      FNRNKEYQ--SLIILSSSNCFRMGPFN---------------------------------
RPOC2_PANGI      LNRNKECQ--SLIILSSSNCFRMGPFN---------------------------------
RPOC2_GUIAB      LNRNKESQ--SLIILSSSNCSRIGPFN---------------------------------
RPOC2_HELAN      LNRNKESQ--SLIILSSSNCSRIGPFN---------------------------------
RPOC2_LACSA      LNRNKESQ--SLIILSSSNCFRIGPFN---------------------------------
RPOC2_SILLA      VGKNKECQ--SFIILSSSNCFRMGPFT---------------------------------
RPOC2_SPIOL      LGINKECQ--FFLILSSSNCFRIGPF----------------------------------
RPOC2_FAGEA      LNRTKEFQ--SFIILSSANCFRMGPF----------------------------------
RPOC2_SOYBN      LNRNEKCR--SLIILSSSNCFQIRSFN---------------------------------
RPOC2_PHAVU      LNRNDKCR--SLIILSSSNCFQIRSFH---------------------------------
RPOC2_LOTJA      LNRNKENR--SFIILSSSNCFQMGPFN---------------------------------
RPOC2_PELHO      LNRNKECQ--SLLILSSSNCFRLGPFN---------------------------------
RPOC2_OENAR      LNQNKECP--SLMILSASNCFRMGPFN---------------------------------
RPOC2_OENPA      LNQNKECP--SLMILSASNCFRMGPFN---------------------------------
RPOC2_OENEH      LNQNKECP--SLMILSASNCFRMGPFN---------------------------------
RPOC2_OENGL      LNQNKECP--SLMILSASNCFRMGPFN---------------------------------
RPOC2_OENBI      LNQNKECP--SLMILSASNCFRMGPFN---------------------------------
RPOC2_EUCGG      LNKNKECP--SLIILSSSNCFRMGPFN---------------------------------
RPOC2_AETCO      LNRNKESQ--FLLILSSSNCFRMGPFD---------------------------------
RPOC2_AETGR      LNRNKESQ--FLLILSSSNCFRMGPFN---------------------------------
RPOC2_ARATH      LNRNKESQ--SLLILSSSNCFRMGPFN---------------------------------
RPOC2_CAPBU      LNRNKESQ--SLLILSSSNCFRMGPFN---------------------------------
RPOC2_CRUWA      LNRNKESQ--SLLILSSSNCFRMGPFN---------------------------------
RPOC2_OLIPU      LNRNKESQ--SLLILSSSNCFRMGPFN---------------------------------
RPOC2_BARVE      LNRNKESQ--SLLILSASNCFRIGPFN---------------------------------
RPOC2_NASOF      LNRNKESQ--SLLILSSSNCFRIGPFN---------------------------------
RPOC2_LEPVR      LNRNKESQ--SLLILSSSNCFRIGPFN---------------------------------
RPOC2_LOBMA      LNRNKESQ--SLLILSSSNCFRIGPFN---------------------------------
RPOC2_ARAHI      LNSNKESQ--SLLIFSSSNCFRIGLFN---------------------------------
RPOC2_DRANE      LNSNKESP--SLLILSSSNCFRIGLFN---------------------------------
RPOC2_SINAL      LNRNR-NP--ILLILSSSNCFRIGPFN---------------------------------
RPOC2_CARPA      LNRNKECQ--SLIILSSSNCFQMGPFN---------------------------------
RPOC2_GOSBA      LNRNKESQ--SLIILSASNCFRMGPFN---------------------------------
RPOC2_GOSHI      LNRNKESQ--SLIILSASNCFRMGPFN---------------------------------
RPOC2_CITSI      LNKNKECQ--VLIILSSSNYFRMGPLN---------------------------------
RPOC2_CUCSA      LNRNKERQ--SLIILSASNCLQIDLFN---------------------------------
RPOC2_MORIN      LNRSKESQ--SLIILSSSNCFEMGPFN---------------------------------
RPOC2_POPAL      LNRNMECQ--SLIILSSSNCFRMDPSN---------------------------------
RPOC2_POPTR      LNRNMECQ--SLIILSSSNCFRMDPSN---------------------------------
RPOC2_MANES      LNINKECQ--SLIILSSSNCFQMDPFN---------------------------------
RPOC2_VITVI      LNRNKECQ--SLIILSSSNCSRMGPFN---------------------------------
RPOC2_WELMI      RSLNNEKN--MFLILSTSDCFRIHLFQ---------------------------------
RPOC2_ADICA      RDGGCGGEIGKYFYGSEDGFFCIGENK---------------------------------
RPOC2_CHAGL      ETKNTINK--NLLFVSRKNQIQILYNK---------------------------------
RPOC2_ACAM1      VEEGQQIDPGAVVARTEIKAKQGGKVR---------------------------------
RPOC2_THEEB      VKDGDHIGPGAVIARTDIKAKQAGEVQ---------------------------------
RPOC2_NOSS1      VKDGDTIVPGSVVARTQILSKEGGIVR---------------------------------
RPOC2_TRIV2      VKDGDTIVPGSVVARTQILSKEGGIVR---------------------------------
RPOC2_NOSP7      VYDGLTIAPGSVVARTQILCKEGGEVR---------------------------------
RPOC2_SYNE7      VKDGQKVKPGAVIACTQIQCKEAGVVR---------------------------------
RPOC2_SYNP6      VKDGQKVKPGAVIACTQIQCKEAGVVR---------------------------------
RPOC2_TRIEI      VKDGDVIEAGGVVSRTQILSKKSGEVR---------------------------------
RPOC2_CROS5      VTDGDQIAPGAVVAKTEIQCREEGEVR---------------------------------
RPOC2_SYNY3      VQDGDQIPPGAVVARTEIQCKEAGTVR---------------------------------
RPOC2_MICAN      VQDGDEIPPGAVVARTEIQCKEAGEIR---------------------------------
RPOC2_SYNP2      VEDGQEIVPGAVVARTEIQCKEPGEVR---------------------------------
RPOC2_SYNJB      VKEGDSIASGDVIARTEIQAKKAGIVQ---------------------------------
RPOC2_SYNJA      VSEGDSIGRGGVIARTEIQAKKAGIVQ---------------------------------
RPOC2_GLOVI      VKDGERIGPGAIIARTEILAKQAGTVR---------------------------------
RPOC2_PROMA      VKDQQIVKAGDIVATTQILCKEKGIVQ---------------------------------
RPOC2_PROM4      IKDNQLVNADDVVATTQILCKEDGIVQ---------------------------------
RPOC2_PROM1      IENAQVVSAGDVVATTQILCKQEGVVQ---------------------------------
RPOC2_PROMT      IENAQVVSAGDVVATTQILCKQEGVVQ---------------------------------
RPOC2_PROM3      IEDGQSVKASDVVATTQILCKQEGIAQ---------------------------------
RPOC2_PROMM      IEDGQSVKASDVVATTQILCKQEGIAQ---------------------------------
RPOC2_SYNS3      VEDGQSIKAGDVVATTQILCKQAGVAE---------------------------------
RPOC2_SYNPW      VEDGQSIKAGEVIATTQILCKQEGVAQ---------------------------------
RPOC2_SYNSC      VEDGVSVKAGDVVATTQILCKQAGLAQ---------------------------------
RPOC2_SYNPX      VEDGISVKAGDVIATTQILCKQAGVAQ---------------------------------
RPOC2_SYNS9      VEDGISVKAGDVVATTQILCKQEGVVQ---------------------------------
RPOC2_PROMS      VNDNQLVKAGDVISTTQILCKEKGLVQ---------------------------------
RPOC2_PROM0      VKNDQLVKAGDVIATTQILCKEKGFVQ---------------------------------
RPOC2_PROM2      VNNNQLVKAGDVIATTQILCKEKGLVQ---------------------------------
RPOC2_PROM9      VKNNTLVKAGDVIATTQILCKEKGLVQ---------------------------------
RPOC2_PROM5      VKNNQQVKAGDVIATTQILCKEKGIVQ---------------------------------
RPOC2_PROMP      INNNQLVKAGDVIATTQILCKERGVLQ---------------------------------
RPOC2_SYNR3      VADGDNIKRGDVVATVQILCKDDGVAQ---------------------------------
RPOC2_PAUCH      VNDGDLVKSGDVVATTQILCKEVGIVQ---------------------------------
RPOC2_GUITH      IKDGQRIKKEDLIAETHLVARNKGILK---------------------------------
RPOC2_RHDSA      VKQNELIKAGSTVAETHLLAHSAGFVQ---------------------------------
RPOC2_PORPU      VSDGEYIQPLTVVASTEIISMSKGFVE---------------------------------
RPOC2_PYRYE      VKNGEYIKPFTVVASTEIIAMSEGTVE---------------------------------
RPOC2_GRATL      VTNNQYIKSGTVVAQTELFSSLEGQVV---------------------------------
RPOC2_CYAPA      VKNNQLVKKGELIAQIEIISINQGEIR---------------------------------
RPOC2_CYACA      IKEGQYITKDFPIIETLFLSRHDGRVV---------------------------------
RPOC2_EMIHU      VSNKQYVASNTLIGQIETTAGLVNKLA---------------------------------
RPOC2_PHATC      IQPNQFIDRYTNLGYLESKTSNSLEIV---------------------------------
RPOC2_THAPS      VEPTQFIDSYTTLGYLESLITNSLEIV---------------------------------
RPOC2_TRICV      VQTHQFIDSYTILGYLEVMISKSLEIV---------------------------------
RPOC2_CHLVU      SFQCRQVLPKVPITQVFLKSKTVGEFQ---------------------------------
RPOC2_OSTTA      SPTHENIKSFNPSLQNGNLMSVDADYV---------------------------------
RPOC2_BIGNA      KTHFNWLPKWDTIVRIQFLSPYQGEII---------------------------------
RPOC2_CHLAT      AKNGQYVVPEDSIAIKEVIGKYSGEVR---------------------------------
RPOC2_MESVI      RKFNNYIIPGTILAKTEIIAKDHGEVR---------------------------------
RPOC2_NEPOL      LKLKETVKTRSQEKFTNEMKKQLAKSS---------------------------------
                                                                             

RPOC2_STAPU      ------------------------------------------------------NVFSLL
RPOC2_ZYGCR      ------------------------------------------------------PTQPIF
RPOC2_CHAVU      ------------------------------------------------------IFFAFI
RPOC2_ANEMR      G-SKNPIGKDTDNFSSTEFFNFQN-QLEKIG---SIRNRIRSRAKHFLRIVSFDEICFLG
RPOC2_MARPO      KLTKNISIKTNTNTSTAKFFEFNK-NFKILN---KKKKLNLTKKNFSIGLLLFKKLGFLG
RPOC2_PHYPA      KTKQNL--KIENNVEKLFTYEPKK-IIKTFN---IEK-----------RKNFVEFLGLLG
RPOC2_ANTAG      QNSITSSQNSSGTFINKEFYNHNN-INQEFNSRKIIRNFFLSIERNFMEILLLRKLGLLG
RPOC2_ANGEV      RYKISFCEKEISERSNTLFLSFNR---KKFLKLKEKLTNSFSSFDHHCMMQTTERLGLLG
RPOC2_PSINU      KWNTFFDTKKVSRSLKKNYLSSIKDSEKRSLNSKVGLT-SVSSFDHTRQLQGMKILGLLG
RPOC2_PINKO      ----------DSKCYDTGNKSNRKDP---MRKIIEFSGL-------------LGHLHSIT
RPOC2_PINTH      ----------DSKCYDTGNQSNRKDP---MRKIIEFSGL-------------LGNLHSIT
RPOC2_CYCTA      ----------GSKHYDMVNRSIQDDS---MMQIIELSGF-------------LGNLHSIA
RPOC2_CRYJA      ----------DLKCLNTVKKLDAN------KKRIELSGL-------------LGHLHSIA
RPOC2_AGRST      ----------NSKHPNAIKEL---------NPRIPIQE---IFGP-------LGVIVPST
RPOC2_LOLPR      ----------NPKHPNTIKEL---------NRRIPIRE---IFGP-------LGVIVPSI
RPOC2_HORVU      ----------NSKHPNAIKEW---------NPRIPILE---IFGP-------LGAIVASI
RPOC2_WHEAT      ----------NSKHPNAIKEW---------NPRIPIRE---IFGP-------LGAIVASI
RPOC2_SACHY      ----------NSKYPNAVKES---------NPRIPIRD---IFGL-------LGVIVPSI
RPOC2_SACOF      ----------NSKYPNAVKES---------NPRIPIRD---IFGL-------LGVIVPSI
RPOC2_SORBI      ----------NSKYPNAVKES---------NPRIPIRD---VFGL-------LGVIVPSI
RPOC2_MAIZE      ----------NSKYPNAVKES---------NPRIPIRD---IFGL-------LGVIVPSI
RPOC2_ORYNI      ----------NSKNPNGVKES---------NPRIPIPK---FFGLFRNFSGLLGTIAPSI
RPOC2_ORYSI      ----------NSKNPNGVKES---------NPRIPIPK---FLGLFRNFSGLLGTIAPSI
RPOC2_ORYSA      ----------NSKNPNGVKES---------NPRIPIPK---FWGLFRNFSGLLGTIAPSI
RPOC2_ORYSJ      ----------NSKNPNGVKES---------NPRIPIPK---FWGLFRNFSGLLGTIAPSI
RPOC2_DIOEL      ---------NGSKYKNVTKES---------ENIIPIMD---FLGS-------LGTIVPKI
RPOC2_PHAAO      ---------NTSRYNNATKEL---------DPMTPIRY---LLGP-------LGTIVPRI
RPOC2_LEMMI      ---------NGLKYNTVTKQSIKA------DPVTPIRN---CLGL-------LGTVVLKI
RPOC2_ACOCL      ---------NGSKYHNVPKESIKE------DPIIPIRD---SLGL-------LGTTVPKI
RPOC2_AMBTC      ---------NGSKYHNVTK-ESIQE-----DPMISIRN---SLGP-------LGTVPNIL
RPOC2_NYMAL      ---------NVSKYHNVTK-ESIKEK---EDTPIPILN---LLGP-------LGTVPKIH
RPOC2_ILLOL      ---------NGLKYHNLTKKESIQIK---EDPMIPIRN---SLGP-------FGTVPKIA
RPOC2_CALFG      ---------NGSKSHKVTK-ESITIK---EDPTIPIRN---SLGP-------LGTVPKIA
RPOC2_LIRTU      ---------NGSKSHKVTK-ESIK-----EDPMIPIRN---SLGP-------LGTVPKIA
RPOC2_DRIGR      ---------NGSKSHNVTK-ESIQIK---EDPMIPIRN---SLGP-------LGTVPKIA
RPOC2_CHLSC      ---------NGSKYHNVTK-ESIQTKDK-EDPSISIRN---SLGP-------LGIVPKIA
RPOC2_CERDE      ---------KDSKYNKTTNCHNITKELIKEDSPVPISN---SLGP-------LGAVPKFL
RPOC2_PIPCE      ---------NGSKSDNGKK-KSIK-----EDPAILIRN---FFGP-------LGTIAKIT
RPOC2_BUXMI      ---------GLKY-HNVTKESSK------GDPLIPIKN---WLGP-------LGTVPKIA
RPOC2_PLAOC      ---------TLKY-HNVTKESIK------RDPPIPIRN---SLGP-------LGTVPKIT
RPOC2_NANDO      ---------GLKY-NNMTKKSNK------RDSLLLIRN---SLGP-------LGIVPKIA
RPOC2_RANMC      ---------RLKYHNNMIKKSNK------RDILPPIRN---LLGP-------LGIIPKIT
RPOC2_SOLBU      ---------DV-KYHSVIKESIK------KDPLIPIRN---SLGP-------LGTCLPIE
RPOC2_SOLTU      ---------DV-KYHSVIKESIK------KDPLIPIRN---SLGP-------LGTCLPIE
RPOC2_SOLLC      ---------DV-KYHSVIKESIK------KDPLIPIRN---SLGP-------LGTCLPIE
RPOC2_ATRBE      -------------YHSVIKDSIK------KDPLIPIRN---SLGP-------LGTCLPIE
RPOC2_NICSY      ---------DV-KYHSVIKKSIK------KDPLIPIRN---SLGP-------LGTSLPIE
RPOC2_TOBAC      ---------DV-KYHSVIKKSIK------KDPLIPIRN---SLGP-------LGTSLPIE
RPOC2_NICTO      ---------DV-KYHSVIKESIK------KDPLIPIRN---SLGP-------LGTSLPIE
RPOC2_COFAR      ---------GV-KYHNVIKESIKN-K---KDPRISIRN---SLGP-------LGSAPPIA
RPOC2_JASNU      ---------DVIKYHKESIPITLI-T---KDPFIPIKNFKNSLGP-------FGTAFPIA
RPOC2_CUSEX      ---------GA-KSNNVIQESKK--E---EYPILKISN---SLGP-------LGTYPPIA
RPOC2_CUSRE      ---------GA-KSNNVIQESKK--E---EYPMLQISN---SLGP-------LGTYPPIA
RPOC2_IPOPU      ---------GA-KYHNVIQESIQ--E----DPLIPIRN---SLGP-------LGTSLPIA
RPOC2_DAUCA      ---------NV-KYHNVIKESIK------KDPPIPIRN---LLGP-------LGTALKTA
RPOC2_PANGI      ---------DV-KYHNVIKESIQ------KDPLIQIRN---SLGP-------LGTALQIA
RPOC2_GUIAB      ---------DV-KSPNVIKESIK------KDPLIPIRN---SLGP-------LGTGFPIS
RPOC2_HELAN      ---------DV-KYPNVIKDSIK------KDPLIPIRN---SLGP-------LGTGFPIY
RPOC2_LACSA      ---------DV-KSPNVIKESIK------KNPLIPIRN---SLGP-------LGTGFPIY
RPOC2_SILLA      ---------L--NGVKYPKESIK------KDRLILIKN---SFGP-------LGTVLNFV
RPOC2_SPIOL      ------------KGVKYPKELIK------KDPLIPIRN---SFGP-------LGTALQIA
RPOC2_FAGEA      ------------KGLKYYKE---------LDPIIPIKN---SSGP-------FGTSLQIA
RPOC2_SOYBN      ---------HG-KYYNGIKEGINQIQ---RDAMIPIKN---SLGP-------LGIAPQVA
RPOC2_PHAVU      ---------DG-KYY---KEEMNPIQ---RDPLIPIKN---SLGP-------LGIALQVA
RPOC2_LOTJA      ---------NV-KYHNGIKEEINQFK---RNHKIPIKI---SLGP-------LGVAPQIA
RPOC2_PELHO      ---------NV-KYHNPKKESIKRDT----DPLIPIRN---FSGP-------LGTVPQIA
RPOC2_OENAR      ---------DV-KSQNVIKESIK------KDAIIQIRN---SIGP-------LGTALQVV
RPOC2_OENPA      ---------DV-KSQNVIKESIK------KDAIIQIRN---SIGP-------LGTALQVV
RPOC2_OENEH      ---------DV-KSQNVIKESIK------KDAIIQIRN---SIGP-------LGTALQVV
RPOC2_OENGL      ---------DV-KSQNVIKESIK------KDAIIQIRN---SIGP-------LGTALQVV
RPOC2_OENBI      ---------DV-KSQNVIKESIK------KDAIIQIRN---SIGP-------LGTALQVV
RPOC2_EUCGG      ---------AG-KYHNVIKESIK------KDPIIKIRN---SIGP-------LGTVLQFV
RPOC2_AETCO      ---------HV-KYHNVINQSIK------KNPLITIKN---ASGP-------LGTTIQIS
RPOC2_AETGR      ---------HV-KYHNVINQSIK------KNPLITIQK---ASGP-------LGTTIQIS
RPOC2_ARATH      ---------HV-KHHNVINQSIK------KNTLITIKN---SSGP-------LGTATPIS
RPOC2_CAPBU      ---------HV-KYHNVINQSIK------KNTLITIKN---SSGP-------LGTATQIS
RPOC2_CRUWA      ---------HV-KYHNVINESIK------KNPLITIKN---SSGP-------LGTAAQIS
RPOC2_OLIPU      ---------HL-KYHNVINQSIT------KNPLITIKN---SSGP-------LGTATQIS
RPOC2_BARVE      ---------HV-KYHNVINQSIK------KNPLITIKN---SPGP-------LGTSIQIS
RPOC2_NASOF      ---------HV-KYHNVINQSIK------KNPLITIKN---SLGP-------LGTAIQIS
RPOC2_LEPVR      ---------HV-KYHNVINQSIK------KKPLITIKN---SPGP-------LGTSIPIS
RPOC2_LOBMA      ---------HV-KYHNVINQSIK------KNPIITIKN---SSGP-------LGTAIQIS
RPOC2_ARAHI      ---------HV-KYHNVRNELIK------KNPLITIKN---SSGP-------LGTAIQIS
RPOC2_DRANE      ---------HV-KYHNVINQSIK------KNPLITIKN---SSGP-------LGTAIQIS
RPOC2_SINAL      ---------HV-KYHNVINQSIK------KKTSNYIKN---CRAP-------YGTAIQIL
RPOC2_CARPA      ---------HV-KYHNVIKQSIK------KDPLIPIRN---SLGP-------VGTAIQIA
RPOC2_GOSBA      ---------DV-KYHNVIKQSIK------KDPLIPIKN---LLGP-------LGTAPKIA
RPOC2_GOSHI      ---------DV-KYHNVIKQSIK------KDPLIPIKN---LLGP-------LGTAPKIA
RPOC2_CITSI      ---------DV-KYHNVIKQSIPIQ----KDSLTPIKT---SLGP-------LGTFLQIA
RPOC2_CUCSA      ---------DV-KDYNVIKESSK------KDPLISIRN---SLGP-------LGAAPQIV
RPOC2_MORIN      ---------DV-KHYNVIKESIK------RDPLIPIRN---SLGP-------LGTACQVA
RPOC2_POPAL      ---------GV-KSYNVIKESTK------RDPIIPIRN---LLGP-------LGTTLQIA
RPOC2_POPTR      ---------GV-KSYNVIKESTK------RDPIIPIRN---LLGP-------LGTALQIA
RPOC2_MANES      ---------DV-KHHNVIKESIK------RDPIIPIRN---SLGP-------LGTALQIA
RPOC2_VITVI      ---------DV-KYHNVIKESIK------KDTPIPIRN---SLGP-------LGTALQIT
RPOC2_WELMI      ----------TKKNDNIQNKS---------NPNKPINNH--FVGF-------FGHLHSIE
RPOC2_ADICA      ----------KKISLSSKCISENYANPNVEEGWIKARRASSNLGQ-----RKAEEVGLVG
RPOC2_CHAGL      ---------ITKEDLKENYKDINTISKIKKTKIYHTDQQVFTIQSFYLLNKNLGLLGNFY
RPOC2_ACAM1      ------------------------------------------------------------
RPOC2_THEEB      ------------------------------------------------------------
RPOC2_NOSS1      ------------------------------------------------------------
RPOC2_TRIV2      ------------------------------------------------------------
RPOC2_NOSP7      ------------------------------------------------------------
RPOC2_SYNE7      ------------------------------------------------------------
RPOC2_SYNP6      ------------------------------------------------------------
RPOC2_TRIEI      ------------------------------------------------------------
RPOC2_CROS5      ------------------------------------------------------------
RPOC2_SYNY3      ------------------------------------------------------------
RPOC2_MICAN      ------------------------------------------------------------
RPOC2_SYNP2      ------------------------------------------------------------
RPOC2_SYNJB      ------------------------------------------------------------
RPOC2_SYNJA      ------------------------------------------------------------
RPOC2_GLOVI      ------------------------------------------------------------
RPOC2_PROMA      ------------------------------------------------------------
RPOC2_PROM4      ------------------------------------------------------------
RPOC2_PROM1      ------------------------------------------------------------
RPOC2_PROMT      ------------------------------------------------------------
RPOC2_PROM3      ------------------------------------------------------------
RPOC2_PROMM      ------------------------------------------------------------
RPOC2_SYNS3      ------------------------------------------------------------
RPOC2_SYNPW      ------------------------------------------------------------
RPOC2_SYNSC      ------------------------------------------------------------
RPOC2_SYNPX      ------------------------------------------------------------
RPOC2_SYNS9      ------------------------------------------------------------
RPOC2_PROMS      ------------------------------------------------------------
RPOC2_PROM0      ------------------------------------------------------------
RPOC2_PROM2      ------------------------------------------------------------
RPOC2_PROM9      ------------------------------------------------------------
RPOC2_PROM5      ------------------------------------------------------------
RPOC2_PROMP      ------------------------------------------------------------
RPOC2_SYNR3      ------------------------------------------------------------
RPOC2_PAUCH      ------------------------------------------------------------
RPOC2_GUITH      ------------------------------------------------------------
RPOC2_RHDSA      ------------------------------------------------------------
RPOC2_PORPU      ------------------------------------------------------------
RPOC2_PYRYE      ------------------------------------------------------------
RPOC2_GRATL      ------------------------------------------------------------
RPOC2_CYAPA      ------------------------------------------------------------
RPOC2_CYACA      ------------------------------------------------------------
RPOC2_EMIHU      ------------------------------------------------------------
RPOC2_PHATC      ------------------------------------------------------------
RPOC2_THAPS      ------------------------------------------------------------
RPOC2_TRICV      ------------------------------------------------------------
RPOC2_CHLVU      ------------------------------------------------------------
RPOC2_OSTTA      ------------------------------------------------------------
RPOC2_BIGNA      ------------------------------------------------------------
RPOC2_CHLAT      ------------------------------------------------------------
RPOC2_MESVI      ------------------------------------------------------------
RPOC2_NEPOL      ------------------------------------------------------------
                                                                             

RPOC2_STAPU      CITHGNTFKGKEKIFFIN-------DSKNIYNI---------------KNWLISVNFLIW
RPOC2_ZYGCR      IDRYYNTFTNWCYLNEHG-------NSYNLYGL---------------QMIVL-------
RPOC2_CHAVU      SYKRFFNKKLGLIGNLYT-------KKTKLRNS---------------NQNLFLNLFFIS
RPOC2_ANEMR      NLRT-STKLDECFYWIIYTG---AKTCLRIDQS--RQTFQNPK------WFLIDEYIGIY
RPOC2_MARPO      NLHNIVTNSFSSFYLINYTKL-ISNKYSIITKF--QHTCQNPK------WYLIDESKKIN
RPOC2_PHYPA      YLQN-ITKSFQLFSCKKFSDKSIPINFSIIDNL--KKKIKISK------WFFLNENKKVQ
RPOC2_ANTAG      NSHS-LPSPFQFSCWANTHNQPIINRYSILENL--RDVFQVPK------WYFFDENKKTH
RPOC2_ANGEV      TVHS--IAHYSLYSHRIINKNFFLSKDLDIDNS--RAISQNSN------WYILDENRVIC
RPOC2_PSINU      YLYS--IANCFLYPKGIFRNEVFFHRDSSIDDL--VGFDKLPN------WYFLDENRKIY
RPOC2_PINKO      SRFPSSQFI---TDKKVLS-----KKHSIFHN------------------YFMDENMRIS
RPOC2_PINTH      NRFPSSHFL---TYKKVLS-----KKHSIFHNS--FNTFQVPK------YYFMDENMIIY
RPOC2_CYCTA      NRSPSSHSI---TYNKYYNIS--LKEQPIFGNS--ENTLRVPK------WYFMDENTVVS
RPOC2_CRYJA      NRFPYSHFM---TYKKVLL-----TERSISNND--SNNFQLAK------CYFMDEKREIY
RPOC2_AGRST      SNFSSSYYLL--THNQSL-----LKKYLFLANL--KQTFQVLQGL---KYSLIDENKRVS
RPOC2_LOLPR      SNFSSSYYLL--THNKIL-----LKKYLFLDNL--KQTFQVLQGL---KYSLIDENKRIS
RPOC2_HORVU      SHFSSSYYLL--THNKIL-----LKKYLFVDNL--KQTFQVLQEL---KYSLIDENKRIS
RPOC2_WHEAT      SHFSSSYYLL--THNKIL-----LKKYLFVDNL--KQTFQVLQEL---KYSLIDENKRIS
RPOC2_SACHY      SNFSSSYYLL--THNQIL-----LKKYLFLDNL--KQTFQVLQGL---KYSLIDENKRIS
RPOC2_SACOF      SNFSSSYYLL--THNQIL-----LKKYLFLDNL--KQTFQVLQGL---KYSLIDENKRIS
RPOC2_SORBI      SNFSSSYYLL--THNQIL-----LKKYLFLDNL--KQTFQVLQGL---KYSLIDENQRIS
RPOC2_MAIZE      SNFSSSYYLL--THNQIL-----LKKYLFLDNL--KQTLQVLQGL---KYSLIDENKRIS
RPOC2_ORYNI      SNFSSSYYLL--TYNQIL-----LKKHLLLDNL--KQNFKVLQGL---KHSLINENQRTS
RPOC2_ORYSI      SNFSSSYYLL--TYNQIL-----LKKHLLLDNL--KQNFKVLQGL---KHSLINENQRTS
RPOC2_ORYSA      SNFSSSYYLL--TYNQIL-----LKKHLLLDNL--KQNFKVLQGL---KHSLINENQRTS
RPOC2_ORYSJ      SNFSSSYYLL--TYNQIL-----LKKHLLLDNL--KQNFKVLQGL---KHSLINENQRTS
RPOC2_DIOEL      ANF--YSSYHLITHNQIL-----LKRFLLLDN--SKQTFQVLK------YGLIDENSRIY
RPOC2_PHAAO      VNS--RSSYYLRTYNQVF-----LKKSFLLEN--FQQTFQVLQVPPF-QYCFLDENSRIY
RPOC2_LEMMI      ANF--YSSCHLITYNKTL-----LKKYFLIEN--LSQTFQGII------FFLIDENRGIY
RPOC2_ACOCL      ANFF-YLSYHVITHNHIL-----LTKYLLRDH--LKQAFQVLR------YCLMDENRRIY
RPOC2_AMBTC      NFS---SSYHSITHNEIL-----FNKYLLPDN--SRETFLVPKSY------FMDENRRIY
RPOC2_NYMAL      NFS---PSYHSITHNEIL-----LNKYLILDNKNPKQTFQLLKYY------LVDENGRIS
RPOC2_ILLOL      NFY---SSYQLITHNEIL-----LNKYLLLDN--PKQTFEALKYY------FMDENGIIY
RPOC2_CALFG      NFD---SSYYLITHNQIL-----LNKYLSLDN--LKQTFQVLKYY------LMDENGRIY
RPOC2_LIRTU      NFY---SSYYLITHNQIL-----LNKYLLLDN--LKQTFQVLKYY------LMDENGRIY
RPOC2_DRIGR      NFD---SPYYLITHNQIL-----LNKYLLLDN--LKQTFQVLKYY------LMDENGRIY
RPOC2_CHLSC      NF------YYLMTHNQIL-----LNKYLLLDN--LKQTFQVLQYYQVIKYSLMDENGQIY
RPOC2_CERDE      NFD---SFSHLITHNQIL-----LKKYLLLDN--LKHTSQVMKYF------LLDENGKIH
RPOC2_PIPCE      NLD---SRNYYLTDNQIL-----LKKYLILDN--FKNLFQDVLYY------LIDEKGRIL
RPOC2_BUXMI      NFYS-FYHLI--THNQIL-----VNKYLILNNL--KQIFQVLK------YYLMDENGRIY
RPOC2_PLAOC      NFYSSYYQLI--THNQIL-----VSKYLLLANL--KQTLQVFK------YYLMDENGKIY
RPOC2_NANDO      NFSS-FYYLI--THNQIL-----INKYLLLDNL--KQTFQKLK------YYLMDENGRIY
RPOC2_RANMC      NFFS-FYYLI--THNQIL-----VKKNSQLDNL--KRTSPVLK------YYLIDENGRIF
RPOC2_SOLBU      NFYSSYHLI---THNQIL-----VTKYLQLDNL--KQTFQVIKLK----YYLMDENGKIF
RPOC2_SOLTU      NFYSSYHLI---THNQIL-----VTKYLQLDNL--KQTFQVIKLK----YYLMDENGKIF
RPOC2_SOLLC      NFYSSYHLI---THNQIL-----VTKYLQLDNL--KQTFQVIKLK----YYLMDENGKIF
RPOC2_ATRBE      NFYSSYRLI---THNQIL-----VTNYLQLDNL--KQTFQVIKFK----YYLMDENGKIF
RPOC2_NICSY      NFYSSYHLI---THNQIL-----VTNYLQLDNL--KQTFQVIKFK----YYLMDENGKIF
RPOC2_TOBAC      NFYSSYHLI---THNQIL-----VTNYLQLDNL--KQTFQVIKFK----YYLMDENGKIF
RPOC2_NICTO      NFYSSYHLI---THNQIL-----VTNYLQLDNL--KQTFQVIKFH----YYLMDENGKIF
RPOC2_COFAR      NFFSFSHLL---THNQIL-----VTNYLQLDNI--KETFQVIK------YYSMDENGKIY
RPOC2_JASNU      NFDSFSHLI---TQNRIL-----VNNYLELDNF--KQTFQVIQ------YYLMDENPKIY
RPOC2_CUSEX      NCDSLNHLL---THNQIL-----VTNYFKLDNV--KPPFQVFKLK----YYFIAENWKVC
RPOC2_CUSRE      NCDSFNRLL---THNQIL-----VTNYFHLDNV--KPPFQVFKFK----YYFIAENLKIC
RPOC2_IPOPU      NFYSFDRLL---THNQIL-----VTNYLQLDNL--KQPFQVLKLK----YYLIAENGKIY
RPOC2_DAUCA      NFYPFSHLI---TYNQIL-----VINYLQLDNL--KQTFQVIK------YFLMDEIGKIY
RPOC2_PANGI      NFYSFSHLI---TYNQIL-----VTNYLQLDNL--KQSFQVLK------YYLMDENGKIY
RPOC2_GUIAB      NFDLFSHLI---THNKIL-----VTNYLQLDNL--KHIFQILK------YYLLDENGKIY
RPOC2_HELAN      HFDLFSHLI---THNQIL-----VTNYLQLDNL--KQIFQILK------YYLLDENGKIY
RPOC2_LACSA      NFDLFSHLI---THNQIL-----VTNYLQLDNF--KQIFQILK------YYLLDENGQIY
RPOC2_SILLA      NFFFFYHLI---THNQIL-----VNNYLQLDNL--KQTCQVLKYQ----YYLMDENGIIY
RPOC2_SPIOL      NFFSFYYLI---THNQIL-----VTNYLQLDNL--KQTFQPFKFQ----YYLMDENGRIY
RPOC2_FAGEA      NFYSFYRLI---TQDKIL-----VTNYLQLDNL--KQTFWVMK------YYFIDDNRKIY
RPOC2_SOYBN      HF-DFYRLI---THNQIS-----IIKNGQLDKL--KETFQVFQ------YYFLDENERIY
RPOC2_PHAVU      NL-DFYLLI---THNQIS-----INKNGQLDKL--KETFQVFK------YYLIDENERIY
RPOC2_LOTJA      NFFSFYHLI---THNKISS----IKKNLQLNKF--KETFQVIK------YYLMDENERIY
RPOC2_PELHO      NFDVFYHLI---TKNRIS-------VFHYLPPE--KGKLQVIQ------SFLMDENGRIY
RPOC2_OENAR      NFDS-FYYFI--THNQVL-----LTKYLQVENL--KQTFQVLQ------YYLMDESGRIY
RPOC2_OENPA      NFDS-FYYFI--THNQVL-----LTKYLQVENL--KQTFQVLQ------YYLMDESGRIY
RPOC2_OENEH      NFDS-FYYFI--THNQVL-----LTKYLQVENL--KQTFQVLQ------YYLMDESGRIY
RPOC2_OENGL      NFDS-FYYFI--THNQVL-----LTKYLQVENL--KQTFQVLQ------YYLMDESGRIY
RPOC2_OENBI      NFDS-FYYFI--THNQVL-----LTKYLQVENL--KQTFQVLQ------YYLMDESGRIY
RPOC2_EUCGG      NFYS-FYYLI--THNPIL-----VTKYLQLENL--KQTFQVIN------YYLMDENGRIL
RPOC2_AETCO      NFYS-FFPLL--TYNKMS-----VIKYLQLDNL--KQILKVIN------SYLIDENGRIC
RPOC2_AETGR      NFYS-FFPLL--TYNKMS-----VIKYLQLDNL--KQILKVIN------SYLIDENGRIC
RPOC2_ARATH      NFYS-FLPLL--TYNQIS-----LIKYFQLDNL--KYIFQKIN------SYLIDENGIIL
RPOC2_CAPBU      NFYS-FLPLL--TYNQIS-----LIKYLQLDNF--KYIFQVIN------SYLIDENGRIF
RPOC2_CRUWA      NFYS-FLPLL--TYNKIS-----VIKYLQLDNL--KDIFQVIN------SYLIDENGRIF
RPOC2_OLIPU      NFYS-FLPLL--TYNKIS-----LIKYLKLDNL--KYIFQVIN------SYLIDENGKIF
RPOC2_BARVE      NFFS-FLPLL--TYNLIS-----VIKYLQLDNL--KYIFQVIN------SYLIDENGRIF
RPOC2_NASOF      NFYS-FLPLL--TYNLIS-----VIKYLQLDNL--KYIFQVIN------SYLIDENGRIF
RPOC2_LEPVR      NFYS-FLPLL--TYNQIS-----VIKYLQLDNL--KYIFQVIN------SYLIDEKGRIL
RPOC2_LOBMA      NFYS-FLPLL--TYNQIS-----VIKYLQLDNL--KYIFQVIN------SYLIDENGRIL
RPOC2_ARAHI      NFYS-FLPLL--TYNQIS-----VIKYLKLDNV--KYIFQVIH------SYLIDEKGRIF
RPOC2_DRANE      NCYS-FLPLL--TYNKIS-----AIKYLQLDKV--KYSFQVIN------SYLIDENGRSF
RPOC2_SINAL      IFIH-FAFTK--LINQIS-----CIKYLHLQTS--NVFFPVIH------SYLIDENGRIF
RPOC2_CARPA      NFYS-IYHLI--THNQIS-----VTKYFQLDNL--NQIFEVIK------YYLMDETGRVY
RPOC2_GOSBA      NFYSSFYPLI--THNQTS-----VAKYFELDNL--KQAFQVLN------YYLIAENGRIY
RPOC2_GOSHI      NFYSSFYPLI--THNQTS-----VAKYFELDNL--KQAFQVLN------YYLIAENGRIY
RPOC2_CITSI      NFYS-FYYLI--THNHIS-----VTKYLKLDNL--KQPFQVLK------YYLMDETGEIY
RPOC2_CUCSA      NFYS-FYYL--ITHNPIS-----LTKYLQLDNL--KQIFQVLK------YYLMDENGGIL
RPOC2_MORIN      NFY---YIL--KTHNQIS-----VTKNLQLENL--KQTFQVLK------YYLMDENGRIY
RPOC2_POPAL      NFYS-FYHL--LTHNQIS-----VIKYLKLDNLKLKQTSKVLK------YYLMDENGRIV
RPOC2_POPTR      NFYS-FYHL--LTHNQIS-----VIKYLKLDNLKLKQTSKVLK------YYLMDENGRIV
RPOC2_MANES      NFYL-FYHLNLITHNQIS-----VTKYSKLYNL--KQTFQVLK------YYLMDENGRIV
RPOC2_VITVI      NFYS-FYHL--ITHNHIL-----VTKYFQLDNF--KQTFQTLK------YYLMDENGITY
RPOC2_WELMI      NLYPSSHFL---NYNKIL-----FNKFCYNFNI-----FEIPN------CYILDEFQK-V
RPOC2_ADICA      TLSPISCSSI--PHHLSLG-----GKNLSTRKGFVDYSIDKSE---HQDFYLIDESKLLL
RPOC2_CHAGL      KNKLLFQFIF--DYNKIKT----YKKDLSLDIN--TNLLKNKN------WFLIDESNNFF
RPOC2_ACAM1      ------------GIRS-----------------------------------GNEATRRIL
RPOC2_THEEB      ------------GIVR-----------------------------------SGESVRRIL
RPOC2_NOSS1      ------------GVQK-----------------------------------GSEAVRRCL
RPOC2_TRIV2      ------------GVQK-----------------------------------GSEAVRRCL
RPOC2_NOSP7      ------------GVRK-----------------------------------GTENVRRCL
RPOC2_SYNE7      ------------GIQE-----------------------------------GSEAVRRLL
RPOC2_SYNP6      ------------GIQE-----------------------------------GSEAVRRLL
RPOC2_TRIEI      ------------GIRE-----------------------------------GSEAIRRIL
RPOC2_CROS5      ------------GIRR-----------------------------------GLEAVRRVL
RPOC2_SYNY3      ------------GIKE-----------------------------------GQESIRRVL
RPOC2_MICAN      ------------GIRK-----------------------------------GSEAVRRLL
RPOC2_SYNP2      ------------GIRS-----------------------------------GQEAIRRLL
RPOC2_SYNJB      ------------GIRE-----------------------------------GAEVVRRVL
RPOC2_SYNJA      ------------GIRQ-----------------------------------GAEVVRRVL
RPOC2_GLOVI      ------------GISR-----------------------------------VGQTVRRIL
RPOC2_PROMA      ------------LPEMK----------------------------------EDEPIRRLI
RPOC2_PROM4      ------------LPNAV----------------------------------DDEPIRRLI
RPOC2_PROM1      ------------LPDAV----------------------------------DGDPVRRLI
RPOC2_PROMT      ------------LPDAV----------------------------------DGDPVRRLI
RPOC2_PROM3      ------------LPVPQ----------------------------------EGDPVRRLI
RPOC2_PROMM      ------------LPVVQ----------------------------------EGDPVRRLI
RPOC2_SYNS3      ------------MPEAT----------------------------------EDEPVRRLI
RPOC2_SYNPW      ------------MPEAT----------------------------------ADEPVRRLI
RPOC2_SYNSC      ------------LPEAT----------------------------------EADPVRRMI
RPOC2_SYNPX      ------------LPEAT----------------------------------EADPVRRLL
RPOC2_SYNS9      ------------LPEAT----------------------------------EAEPVRRLI
RPOC2_PROMS      ------------LPNVV----------------------------------DDEPIRRLI
RPOC2_PROM0      ------------LPNVV----------------------------------EDEPIRRLI
RPOC2_PROM2      ------------LPNVV----------------------------------DDEPIRRLI
RPOC2_PROM9      ------------LPNVV----------------------------------EDDPIRRLI
RPOC2_PROM5      ------------LPDLV----------------------------------ENEPIRRLI
RPOC2_PROMP      ------------LPDSV----------------------------------EGEPIRRLI
RPOC2_SYNR3      ------------LPDRK----------------------------------DDEPIRRLI
RPOC2_PAUCH      ------------LPKQI----------------------------------DNEPIRRII
RPOC2_GUITH      ------------NILI-----------------------------------SSQSTKKLL
RPOC2_RHDSA      ------------SINQ-----------------------------------TSQSTCKVL
RPOC2_PORPU      ------------EIHV-----------------------------------EKNTSRRIL
RPOC2_PYRYE      ------------EIYS-----------------------------------EKNTSRRIL
RPOC2_GRATL      ------------SIQK-----------------------------------NKSSNPRIL
RPOC2_CYAPA      ------------WIGDN----------------------------------TAKQIRRLL
RPOC2_CYACA      ------------IKSNF----------------------------------KQKNNACLI
RPOC2_EMIHU      ------------AINPHL---------------------------------NSGNMKEVL
RPOC2_PHATC      ------------KIKLK-----------------------------------IKDSKQIL
RPOC2_THAPS      ------------KFKSK-----------------------------------RANKKQVF
RPOC2_TRICV      ------------QFKSK-----------------------------------YKDSKQIC
RPOC2_CHLVU      ------------RIQLKNQ------------------------------KGSSSFLRAED
RPOC2_OSTTA      ------------RLNVQYG------------------------------KGFSSLLNCGE
RPOC2_BIGNA      ------------AQNIVKY------------------------------SGYKTLYNHLM
RPOC2_CHLAT      ------------QSEKASEEE--------------------------RS---------FL
RPOC2_MESVI      ------------QSNKNFEEQ--------------------------KS---------FL
RPOC2_NEPOL      ------------EGNKGFQIR--------------------------QALFPKKLIRLMV
                                                                             

RPOC2_STAPU      CHFSNRILNKNQTLATIFLSNRSLRNEK------DLQVKEFKIGQSICPSRDLGEKIFEP
RPOC2_ZYGCR      ----DKKLYNNNSISGLFNTYRNIPKIG------QLICKGTFVQQTTQLS----------
RPOC2_CHAVU      WYIIDEYSCNFLFWGAFSQLIKDARNKY------SHNCFPIIIKKAFFSLGKFLSKIEMK
RPOC2_ANEMR      RCRCEKNINHNLFDYYLPSPSREGTKIP-------------SLGHFLFKD--FRMV--ET
RPOC2_MARPO      KLILGKHINYNLFNWCFPLFSLLKKKID---------FQTIKLGQLLFEN--FVIS--KY
RPOC2_PHYPA      KFFLTQNTILSLLNWSFPIFDLAKKKTQ---------L--FNLGHFFCDG--LSIA--EY
RPOC2_ANTAG      KLDLSKNSIYHLLTWSFSI-ALSYEEGA---------IHLVGLGQFICEN--ISISS-KY
RPOC2_ANGEV      GFDLIDSTQEDLSNR--PHYLSVPCDVI---------IPFVNLGQFICEG--VSLY--EH
RPOC2_PSINU      SFHLRNLIGKRFFYW--TRNLSNFNE-----------IPLVNLGQFICEG--ARLF--EN
RPOC2_PINKO      HFDPCRNIISNLLGPNWCSSSSE---------FCKKTFPVVSLGQLIPES--VWISE---
RPOC2_PINTH      HFDPCRNIISNLLGPNWCSSSSES-------EFCEKTFPVVSLGQLIPES--VWISE---
RPOC2_CYCTA      NFGPCRNIISDLFNSNRCFPLSK---------FCENPFPVVSLGQLIRES--VRISE---
RPOC2_CRYJA      QFDSCRNIIFDFFNLNLYFCLSN---------FFEKTFSVVSLGQFCSES--IWISE---
RPOC2_AGRST      NFD--SNIMLDPLLLNCHFVHHDS---------WEETLAIIHLGQFICEN--VCLFK---
RPOC2_LOLPR      NFD--SNIMLDPFLLNCHFVHHDS---------WEETSAIIHLGQLICEN--VCLFK---
RPOC2_HORVU      NFD--SNIMLDPFLLNCHFVHHDS---------WEETLAIIHLGQFICEN--VCLFK---
RPOC2_WHEAT      NFD--SNIMLDPFLLNCHFVHHDS---------WEETLAIIHLGQFICEN--VCLFK---
RPOC2_SACHY      NFD--SNIMLEPFHLNWHFLHHDS---------WEETLAIIHLGQFICEN--LCLFK---
RPOC2_SACOF      NFD--SNIMLEPFHLNWHFLHHDS---------WEETLAIIHLGQFICEN--LCLFK---
RPOC2_SORBI      NFG--SNIMLEPFHLNWHFLHHDS---------WEETLAIIHLGQFICEN--LCLFK---
RPOC2_MAIZE      NFD--SNIMLEPFHLNWHFLHHDS---------WEETLAIIHLGQFICEN--LCLFK---
RPOC2_ORYNI      NFD--SNIMLDPFQLNWHFLPHDS---------WEETSAKIHLGQFICEN--VCLFK---
RPOC2_ORYSI      NFD--SNIMLDPFQLNWHFLPHDS---------WEETSAKIHLGQFICEN--VCLFK---
RPOC2_ORYSA      NFD--SNIMLDPFQLNWHFLPHDS---------WEETSAKIHLGQFICEN--VCLFK---
RPOC2_ORYSJ      NFD--SNIMLDPFQLNWHFLPHDS---------WEETSAKIHLGQFICEN--VCLFK---
RPOC2_DIOEL      SPDPCSNIILNPFRLNWCFLRHNYCEE-------TST--IISLGQFFCEN--ICLFK--Y
RPOC2_PHAAO      NPDPCSNIIWNSFHLNWCFLHHDSCEE-------AWP--IISLGQFLCEN--VYLLK--Y
RPOC2_LEMMI      NLDPCSKTVFNPFDLNWRFFHHDYCDE-------TST--LITLGQIFCEN--VCLFK--Y
RPOC2_ACOCL      NPDPCSNIIFNAFDLNWRFLHHDYSEE-------TST--ILSLGQFVCEN--VCLFK--H
RPOC2_AMBTC      NLDPCSNIILTPFNLNWCFLHHDYWED-------TST--IISLGQFLCEN--ICISK--D
RPOC2_NYMAL      NANPCSDIIFNLFGS--CFLPHDYCEG-------TSTTRIISLGQFICEN--VCLSK--H
RPOC2_ILLOL      NPDPCSNIILNPFDSNWYFPHQDYCEE-------TCT--IISLGQFICEN--VCISK--H
RPOC2_CALFG      NPDPRSNIIFNPFDLNWCFLPHDYCEE-------TST--IINPGQFICEN--VCISK--Y
RPOC2_LIRTU      NPNLHSNIIFNPFDLNWCFLRHDYCEE-------TST--IISLGQFICEN--VCISK--Y
RPOC2_DRIGR      NPYPCRNIIFHPFDLTWCFLHHDYCEK-------TST--IIVLGQFICENENVCISK--Y
RPOC2_CHLSC      NPDPYSNTILNPFDLNWRFLHHDYCEE-------TST--IISLGQFICEN--GCISK--Y
RPOC2_CERDE      NTDPCRNIFFNPSHLNWYSLHHDFFYE-------TPI--TISLGQFICEN--VYIFE--Y
RPOC2_PIPCE      NPDPCSNIILNAFDLNWCFLHHNSCEK-------TFS--IISLGQLFYEN--GSIYK--Y
RPOC2_BUXMI      NPDRCRNIIFNPFNFNWYFLHHDY---------CEETSTIISPGQFICEN--VCISK--N
RPOC2_PLAOC      NPDPCSNIIFNPFNLNWYFLHHDY---------CEETSTIISLGQFFCEN--VCISK--K
RPOC2_NANDO      NPDPCSNMILNPFNWNWYFLHHDY---------CEETSTIISLGQFFCEN--VCISK--Y
RPOC2_RANMC      NPDPSINMILNPFNWNWYFIHHDY---------CEETSTIINLGQFFCEN--VCISK--S
RPOC2_SOLBU      NPDPCRNIILNPFNLNWSFLHHNY---------CAETSKIISLGQFICEN--VCIAK--N
RPOC2_SOLTU      NPDPCRNIILNPVNLNWSFLHHNY---------CAETSKIISLGQFICEN--VCIAE--N
RPOC2_SOLLC      NPDPCRNIILNPFNLNWSFLHHYY---------CAETSKIISLGQFICEN--VCIAK--N
RPOC2_ATRBE      NPDPCRNIILNPFNLNWYFLHHNY---------CEETSKIISLGQFICEN--VCIAK--N
RPOC2_NICSY      NPDPCRNIILNPFNLNWYFLHHNY---------CEETSKIISLGQFICEN--VCIAK--N
RPOC2_TOBAC      NPDPCRNIILNPFNLNWYFLHHNY---------CEETSKIISLGQFICEN--VCIAK--N
RPOC2_NICTO      NPDPCRNIILNPFNLNWYFLHHNY---------CEETSKIISLGQFICEN--VCIAK--N
RPOC2_COFAR      NPDPCNNIILNPLNLNWYFRHHNY---------CEETSTIISLGQFICEN--VCIAK--N
RPOC2_JASNU      NPDLGSNILLNPFNWNWYFYHHTY---------CQETSPIISLGQFICEN--VCIAK--N
RPOC2_CUSEX      NYNPGSNLRLNVFDFHWNFLHHNS---------CAETSKIMSLGQFICQN--VCIDK--T
RPOC2_CUSRE      NYNPCSNLRLNAFYLNLNFLHPNS---------CAETSKIMSLGQFICQN--VCIDK--T
RPOC2_IPOPU      NPNPRSKILLNPLNLNWYFLHHNY---------CAETSKIMSLGQFICEN--VFIAK--K
RPOC2_DAUCA      NYDLCSNIILNPFNLNWYFLQHNY---------CEGMSTIMSLGQFICEN--VCIAK--N
RPOC2_PANGI      NPDRCCNIILNPFNLNWFFLHHNY---------CEETSTTMSLGQFICEN--VCIAK--N
RPOC2_GUIAB      NPYSCSNIILNPFNLNWYFLHYNY---------CEETSTIVSLGQFLCEN--VCIAK--K
RPOC2_HELAN      NPYSCSNIILNPFKLNWYFLHYNY---------CEETSTIVSLGQFLCEN--VCIAK--K
RPOC2_LACSA      NPYSCSNIILNPFHLNWYFLHYNY---------CEETSPIVSLGQFLCEN--VCIAK--K
RPOC2_SILLA      NPDFCSNIILNPFNLHWDFLHYNF---------CDETSTKMRLGQFICEN--ICIKK--N
RPOC2_SPIOL      NPDPCSNIIFNPFKLNWYFLHYHF---------CEETSTKIDLGQFVCEN--VCITK--K
RPOC2_FAGEA      NPDPVSNIVLNSFKLNWYCLHHNY---------YEETSARMGLGQFLCEN--VCLAK--N
RPOC2_SOYBN      KPDLCSNIILNPFYLNWHFLHHNYCEK---------TFTIMSLGQFICEN--VCIVQTKN
RPOC2_PHAVU      KPDISSNILLNPFYLNWHFFHHNSCEKK--------TFPIISLGQFICEN--VCIVQMKN
RPOC2_LOTJA      KPDLYNNIILNPFHLNWDFIHPNYCEK---------TFPIISLGQFICEN--VCIVQTKN
RPOC2_PELHO      KSDPYSNIFLNPFNFNWYFLQHNYHKNYP--NYCEETSTIINLGQFLFET--VCIAK--N
RPOC2_OENAR      NPDPRSNIVLNSFNLSWYFLPHNNYENS-----CEEISTIVSLGQFICEN--GCIAK--N
RPOC2_OENPA      NPDPRSNIVLNSFNLSWYFLPHNNYENS-----CEEISTIVSLGQFICEN--GCIAK--N
RPOC2_OENEH      NPDPRSNIVLNSFNLSWYFLPHNNYENS-----CEEISTIVSLGQFICEN--GCIAK--N
RPOC2_OENGL      NPDPRSNIVLNSFNLSWYFLPHNNYENS-----CEEISTIVSLGQFICEN--GCIAK--N
RPOC2_OENBI      NPDPRSNIVLNSFNLSWYFLPHNNYENS-----CEEISTIVSLGQFICEN--GCIAK--N
RPOC2_EUCGG      NPDSCSNIVLNSFNLNWYFLHHNYYHNY-----FEERSTIISLGQFICEN--VCISK--N
RPOC2_AETCO      NRDPYSNVVLNPFKLNWYFLHQNYHHNY-----CEEMSTLISLGQFFCEN--VCIAK--K
RPOC2_AETGR      NRDPYSNVVLNPFKLNWYFLHQNYHHNY-----CEEISTIISLGQFFCEN--LCIAK--K
RPOC2_ARATH      NLDPYSNVVLNPFKLNWYFLHQNYHHNY-----CEETSTIISLGQFFCEN--VCIAK--K
RPOC2_CAPBU      NLDPYSNVVLNPFKLNWYFLHQNYHHNY-----CEETSTIISLGQFFCEN--VCIAK--K
RPOC2_CRUWA      NLDPYSNVVLNPFKLNWYFLHKNYHHNY-----CEETSTIISLGQFFCEN--LCIAK--K
RPOC2_OLIPU      NLDPYSNVVLNPFKLNWYFLHQNYHHNY-----CEETSTIISLGQLFCEN--VCIAK--K
RPOC2_BARVE      NLDPYNNVVLNPFKLNWYFLHKNYHHNY-----CEETSTIISLGQFFCEN--VCIAK--N
RPOC2_NASOF      NLDPYNNVVLNPFKLNWYFLHQNYHHNY-----CEETSTIISLGQFFCEN--VCIAK--K
RPOC2_LEPVR      NLDPYSNVVLNPIKLNWYFLHQNYYHNY-----CAETSTIISLGQFFCEN--VCIAK--K
RPOC2_LOBMA      NPDPYSNVVLNPFKLNWYFLHQNYHHNY-----CEETSTIISLGQFFCEN--VCIAK--K
RPOC2_ARAHI      NLDRYSNVVLNPFKLNWYFLHQNYHHNY-----CEETSTIISLGQFFCEN--LCIAK--K
RPOC2_DRANE      NLDRYSNGVLNPLKLNWYFLHQNYYHNY-----CEETSTIISLGQFFCEN--LCIAK--K
RPOC2_SINAL      NLDPYSNLVLNPFKLNWYFLHQNYNNNY-----CEETSTIISLGQFFCEN--VCIAK--K
RPOC2_CARPA      NPDPCSNIILNPFNLNWYFLYQNYHHNY-----CEETSTIISLGQFICEN--VCLAK--N
RPOC2_GOSBA      NFDPCRNIFLNAVNLNWYFPHHHY--NY-----CEETSTIISLGQFICEN--VCIAK--S
RPOC2_GOSHI      NFDPCRNIFLNAVNLNWYFPHHHYHHNY-----CEETSTIISLGQFICEN--VCIAK--S
RPOC2_CITSI      NPDTDSKILLNPFNLNWYFLQPNY---------CEEMSPIISLGQFLCEN--VRITK--R
RPOC2_CUCSA      NSDPCINIVFNTFNLNWHFLHDNYHNNY-----CEETPTRISLGQFFFEN--VCIAK--N
RPOC2_MORIN      NSDPCSNILFNPFNLNWHFLH----HNY-----CEKKSTIISLGQFFFEN--VCITK--H
RPOC2_POPAL      NHDPYSNNVLNPFKLNWYFLHHNYHHNY-----CEETFTIINLGQFICEN--VCMTK--N
RPOC2_POPTR      NHDPYSNNVLNPFKLNWYFLHHNYHHNY-----CEETFTIINLGQFICEN--VCMTK--N
RPOC2_MANES      NPDPCSNSVLNPFNLNWYFLHHNY---------CESFFTIISLGQFICEN--LCMAK--N
RPOC2_VITVI      NPDPCSNIILNPFNLNWYFLH----HNY-----CEETSTIISLGQFICEN--VCIAK--N
RPOC2_WELMI      LIYPRINHLWNPKKMRYRRYSKNR-------------YPTMNLGQLLWENFAICKNE---
RPOC2_ADICA      KCPINFYVKKGFLDKPSYLPTRVF----------SREIMLISLGLLISES--RYLHR--D
RPOC2_CHAGL      QLKTRKNQNVKQKKIEKDI--------------------RINLGNFFSQN--VVLFNTRQ
RPOC2_ACAM1      LMTDDDLITIETQG---------------------K-ATSASEGELLRAGDEVA------
RPOC2_THEEB      VVTDSDRLRVETNG---------------------A-KPTVKVGDLVRPGDELA------
RPOC2_NOSS1      VLRHSDMATLNIS----------------------A-KPKVKAGDLIVAGTELA------
RPOC2_TRIV2      VLRHSDMTTLNTS----------------------A-KPKVKAGDLIVAGTELA------
RPOC2_NOSP7      VLRDVDRLTINTS----------------------T-QPKVKVGDLLVEGTEVA------
RPOC2_SYNE7      VERERDCVTLDLDVT--------------------A-ATQLQPGSLIVAGTQLV------
RPOC2_SYNP6      VERERDCVTLDLDVT--------------------A-ATQLQPGSLIVAGTQLV------
RPOC2_TRIEI      IVREADLVKIPVN----------------------T-LPSVVEGDLLVAGTEIA------
RPOC2_CROS5      IVRDEDLEIITLK----------------------E-KPTVAKDDLIVAGTEFA------
RPOC2_SYNY3      LERAADRLVVDLP----------------------S-APEVKPGQLLVAGQELV------
RPOC2_MICAN      IVSDRDEFILPLA----------------------V-APTVKARDLVIAEAEIA------
RPOC2_SYNP2      IVRDSDRQTLAID----------------------G-KAKVKENTLVVAGTEIA------
RPOC2_SYNJB      VITDDDLVQVPLT----------------------G-PANVEVGALVRVGDELA------
RPOC2_SYNJA      VVTDDDLLTVPLT----------------------G-QASVEVGALVRAGDELA------
RPOC2_GLOVI      LVTQSDLVNVPVE----------------------G-TLTVKPGDLLRAGDKLA------
RPOC2_PROMA      VERQEDTVTLTAAS-----------------------KPVVKIGQRVIDGDLLS------
RPOC2_PROM4      VERAQDTTVLTAKD-----------------------NPILKVGERVVDGDLLS------
RPOC2_PROM1      VERDEDTITIDSKG-----------------------TTLLKVGQRVVDGDFVS------
RPOC2_PROMT      VEREEDTITIDSKG-----------------------TTLLKVGQRVVDGDFVS------
RPOC2_PROM3      VERDEDTITVTTKG-----------------------SPLVGVGQRLVDGDSLA------
RPOC2_PROMM      VERDEDTITVTTNG-----------------------SPLVEVGQRLVDGDSLA------
RPOC2_SYNS3      VERPEDTITINTSG-----------------------APVVTVGQRVVDGEELA------
RPOC2_SYNPW      VERPEDTLTISTNS-----------------------QPVVTVGQRIVDGEELA------
RPOC2_SYNSC      VERPEDTTTLSTSG-----------------------KPVVSVGQRIVDGDALA------
RPOC2_SYNPX      VERPEDTTTLSTSG-----------------------KPVVAVGQRIVDGELLA------
RPOC2_SYNS9      VERPEDTTTISTSG-----------------------KPSVAVGDRVVDGDLLA------
RPOC2_PROMS      VERQEDKIKIKISD-----------------------KALVKVGDRVVDGDPIS------
RPOC2_PROM0      VEREEDKIKIKISD-----------------------KAVVKIGDRVVDGDPIS------
RPOC2_PROM2      VEREQDKIKVKISD-----------------------KAVVKVGDRVVDGDPIT------
RPOC2_PROM9      VEREEDKIKIKISN-----------------------KAVVKVGDRVVDGDPIS------
RPOC2_PROM5      VEREEDKIKINITG-----------------------KALVKVGDRVVDGDSIS------
RPOC2_PROMP      VERNEDKIKINIKD-----------------------KAVVKTGDRVVDGDLIS------
RPOC2_SYNR3      VERPSDTITVDLGG----------------------SKLSLKAGQRVVEGDDLG------
RPOC2_PAUCH      VERDQDTMTIPLGS-----------------------APLVSVGQRLVDGDLLA------
RPOC2_GUITH      IMREEDTFRVPTNN----------------------ATIQVSRGDLVKYGDQLA------
RPOC2_RHDSA      ILTNSDEKSIDIYN----------------------QTPQVSQGDFIRSGDQIA------
RPOC2_PORPU      LTTSIDNKVFDLHQ----------------------QNTLVQVGDWIRCGDLIS------
RPOC2_PYRYE      IATSSDKKTFNIGK----------------------STVKVSVGDWIRCGDFIT------
RPOC2_GRATL      LITSLDTKVFSINNN---------------------QNIKVNINDLIYAGDEIA------
RPOC2_CYAPA      LITEKQIVTIPIQNLT------------------KLKNKNLNLGNFIRAGEEIE------
RPOC2_CYACA      IISPSNKKEIYINKK----------------------EHKLKIGDFIRVGDHLGT-----
RPOC2_EMIHU      ILNPSDLKKVFCPNV--------------------ELLKKVSVGDLVRIGTLLN------
RPOC2_PHATC      LISNQDCLTVKKEKFIG----------------KKLNDFIINSSNVNETGKIIIE-----
RPOC2_THAPS      LISNKDCITVRKEQGKN----------------KTANELIIDNINVNQTGKVLID-----
RPOC2_TRICV      LISNEDCRTIPKNSVKN----------------KTIDNLLINNANVNYTGKILMD-----
RPOC2_CHLVU      TVTFLLPSLVPKKQS----------------FLKKEEKVLVSCGQRIRWGQEIF------
RPOC2_OSTTA      VRATNCMMTEKDQIA----------------FKSPVCDLKMKVGDYARVEDQLT------
RPOC2_BIGNA      ILTKNEKLQVSIFRNKNQETIIKKDTKNYFITKPHCCKIYPKFGSLIYSTSQVS------
RPOC2_CHLAT      IMNESDHITLSLKDS----------------------SKNLKLGDLLHKEDFIA------
RPOC2_MESVI      IMNEHDQMTLFVKNA----------------------YEFFQLGDLVHKGKEIV------
RPOC2_NEPOL      VLRPVDIMTFATYGA----------------------RVCIPLGAMIYQGEELF------
                                                                             

RPOC2_STAPU      FTHSILPESGHLLSLNEGN-----------------------------------------
RPOC2_ZYGCR      -------ESGKIVSIFKHK-----------------------------------------
RPOC2_CHAVU      ILGNLETELGQVISLCNKK-----------------------------------------
RPOC2_ANEMR      KQFLP---PGQVIGIHMDY-----------------------------------------
RPOC2_MARPO      KTSYP---SGQIISININY-----------------------------------------
RPOC2_PHYPA      PTFSE---SGQIIAIYDDLS----------------------------------------
RPOC2_ANTAG      QTISE---SGQIIAIHPEF-----------------------------------------
RPOC2_ANGEV      ETSYQ---SGQIIAIYQES-----------------------------------------
RPOC2_PSINU      QISSQ---SGQIIALSPEF-----------------------------------------
RPOC2_PINKO      DEPLP--ESGQIIAVDEES-----------------------------------------
RPOC2_PINTH      DEPLP--ESGQIIAVDEES-----------------------------------------
RPOC2_CYCTA      DEPLP--GSGQIIAVHEES-----------------------------------------
RPOC2_CRYJA      DKQLQ--GSGQIVVVHEES-----------------------------------------
RPOC2_AGRST      -SHIK--KSGQIFIVNMDS-----------------------------------------
RPOC2_LOLPR      -SHIK--KSGQIFIINMDS-----------------------------------------
RPOC2_HORVU      -SHIK--KSGQIFSVNMDS-----------------------------------------
RPOC2_WHEAT      -SHIK--KSGQIFIVNMNS-----------------------------------------
RPOC2_SACHY      -SHIK--KSGQIFIVNMDS-----------------------------------------
RPOC2_SACOF      -SHIK--KSGQIFIVNMDS-----------------------------------------
RPOC2_SORBI      -SHIK--KSGQIFIVNMDS-----------------------------------------
RPOC2_MAIZE      -LHIK--KSGQIFIVNMDS-----------------------------------------
RPOC2_ORYNI      -SHIK--KSGQIFIVNIDS-----------------------------------------
RPOC2_ORYSI      -SHIK--KSGQIFIVNIDS-----------------------------------------
RPOC2_ORYSA      -SHIK--KSGQIFIVNIDS-----------------------------------------
RPOC2_ORYSJ      -SHIK--KSGQIFIVNIDS-----------------------------------------
RPOC2_DIOEL      GPNINIKKSGQIIIVHVDS-----------------------------------------
RPOC2_PHAAO      GSRIK--KSGQIFIVHVDS-----------------------------------------
RPOC2_LEMMI      GSQKK---SGQVIIVHVDY-----------------------------------------
RPOC2_ACOCL      GPQIK---SGQVIIVHVDS-----------------------------------------
RPOC2_AMBTC      GPCVK---SGQIIIVHVDS-----------------------------------------
RPOC2_NYMAL      GTRIK---SGQVIMVYLDS-----------------------------------------
RPOC2_ILLOL      GPRIK---SGQVLIVHVDS-----------------------------------------
RPOC2_CALFG      GPHIK---SGQILIVRVDS-----------------------------------------
RPOC2_LIRTU      GPHIK---SGQVLIVHVDS-----------------------------------------
RPOC2_DRIGR      GPQIK---SGQVLIVHVDS-----------------------------------------
RPOC2_CHLSC      GPHIE---SGQVLIVHVDS-----------------------------------------
RPOC2_CERDE      GPHIK---SGQVLIVQFDS-----------------------------------------
RPOC2_PIPCE      RSHIK---SGQIVTVHGDS-----------------------------------------
RPOC2_BUXMI      GPHLK---SGQVLIVHIDS-----------------------------------------
RPOC2_PLAOC      GPHLK---SGQVLIVHVDS-----------------------------------------
RPOC2_NANDO      GPHLK---SGQVIIVHVDS-----------------------------------------
RPOC2_RANMC      GPHLK---SGQVLIVDVDS-----------------------------------------
RPOC2_SOLBU      GPPLK---SGQVILVQVDS-----------------------------------------
RPOC2_SOLTU      GPPLK---SGQFILVQVDS-----------------------------------------
RPOC2_SOLLC      GPPLK---SGQVILVQVDS-----------------------------------------
RPOC2_ATRBE      GPPLK---SGQVILVQVDS-----------------------------------------
RPOC2_NICSY      GPPLK---SGQVILVQVDS-----------------------------------------
RPOC2_TOBAC      GPPLK---SGQVILVQVDS-----------------------------------------
RPOC2_NICTO      GPPLK---SGQVILVQVDS-----------------------------------------
RPOC2_COFAR      RPHLK---PGQVIFVQVDS-----------------------------------------
RPOC2_JASNU      APHLK---SGQVILVQVAS-----------------------------------------
RPOC2_CUSEX      RPPRK---SGQVILVQVDS-----------------------------------------
RPOC2_CUSRE      RPPFK---SGQVIFIQVDS-----------------------------------------
RPOC2_IPOPU      RPPLK---SGQVILVQVDS-----------------------------------------
RPOC2_DAUCA      GPHLK---SGQVLIVKMDS-----------------------------------------
RPOC2_PANGI      GPHLK---PGQVLIVQVDS-----------------------------------------
RPOC2_GUIAB      GPHLK---SGQVLILQVDS-----------------------------------------
RPOC2_HELAN      GPHLK---SGQVLILQVDS-----------------------------------------
RPOC2_LACSA      GPHLK---SGQVLIVQVDS-----------------------------------------
RPOC2_SILLA      GLHLK---PGQIIIVQFDS-----------------------------------------
RPOC2_SPIOL      GTHLK---SGQVLIVQFDS-----------------------------------------
RPOC2_FAGEA      GPRLK---AGQVLIVQVDS-----------------------------------------
RPOC2_SOYBN      APHLK---SGQILTVQMDS-----------------------------------------
RPOC2_PHAVU      APHLK---SGQILTVQMDS-----------------------------------------
RPOC2_LOTJA      GPNLK---SGQVITVQMDF-----------------------------------------
RPOC2_PELHO      GPRLK---SGQVFILQVGY-----------------------------------------
RPOC2_OENAR      GPYLR---SGQVLIVRLDS-----------------------------------------
RPOC2_OENPA      GPYLR---SGQVLIVQLDS-----------------------------------------
RPOC2_OENEH      GPYLR---SGQVLIVQLDS-----------------------------------------
RPOC2_OENGL      GPYLR---SGQVLIVQLDS-----------------------------------------
RPOC2_OENBI      GPYLR---SGQVLIVQLDS-----------------------------------------
RPOC2_EUCGG      GPHLK---SGQVLIVQVDS-----------------------------------------
RPOC2_AETCO      GPHLK---SGQALIVQMDS-----------------------------------------
RPOC2_AETGR      GPHLK---SGQVLIVQMDS-----------------------------------------
RPOC2_ARATH      EPHLK---SGQVLIVQRDS-----------------------------------------
RPOC2_CAPBU      EPHLK---SGQVLIVQRDS-----------------------------------------
RPOC2_CRUWA      EPQLK---SGQVLIVQRDS-----------------------------------------
RPOC2_OLIPU      EPHLK---SGQVLIVQRDS-----------------------------------------
RPOC2_BARVE      EPHLK---SGQVLIVQRDS-----------------------------------------
RPOC2_NASOF      EPHLK---SGQVLIVQRDS-----------------------------------------
RPOC2_LEPVR      EPHLK---SGQVLIVQRDS-----------------------------------------
RPOC2_LOBMA      EPHLK---SGQVLIVERDS-----------------------------------------
RPOC2_ARAHI      EPHLK---SGQVLIVQRDS-----------------------------------------
RPOC2_DRANE      EPHLK---SGQVLIVQKDS-----------------------------------------
RPOC2_SINAL      EPYLK---SGQVLIVQRDS-----------------------------------------
RPOC2_CARPA      GPHLK---SGQVLIVQVDS-----------------------------------------
RPOC2_GOSBA      GPRLK---SGQVFIVQADS-----------------------------------------
RPOC2_GOSHI      GPRLK---SGQVFIVQADS-----------------------------------------
RPOC2_CITSI      GPYLK---SGQVLIVQVNS-----------------------------------------
RPOC2_CUCSA      RPHLK---SGQIIIVQVDS-----------------------------------------
RPOC2_MORIN      GPHLK---SGQVIIVQIDS-----------------------------------------
RPOC2_POPAL      GPRLK---SGQVLIVHADS-----------------------------------------
RPOC2_POPTR      GPRLK---SGQVLIVHADS-----------------------------------------
RPOC2_MANES      GPHLK---SGQVIIVHIDS-----------------------------------------
RPOC2_VITVI      GPHLK---SGQVLIVQVDS-----------------------------------------
RPOC2_WELMI      -SFSE---SGQIIAVREES-----------------------------------------
RPOC2_ADICA      RTCFQ---SGQVMAIHQDY-----------------------------------------
RPOC2_CHAGL      LPE-----SGQILYIEKKI-----------------------------------------
RPOC2_ACAM1      -AGVTVAESCQVIKVQDGQ-----------------------------------------
RPOC2_THEEB      -KGVTAPETAAVMAVADDH-----------------------------------------
RPOC2_NOSS1      -PGIFAEESGQIVGVKNAGESTTTQ-----------------------------------
RPOC2_TRIV2      -PGVFAEESGQIVAVKNAGESTTTQ-----------------------------------
RPOC2_NOSP7      -PGVFAPESGQVVDIKNAAAASG-G-----------------------------------
RPOC2_SYNE7      -DGIIAPESGEVRAIAPGQ-----------------------------------------
RPOC2_SYNP6      -DGIIAPESGEARAIAPGQ-----------------------------------------
RPOC2_TRIEI      -PGIVIPRSGLVSKVEETVLNDG-------------------------------------
RPOC2_CROS5      -PGVVAAESGLVVAVNQGE-----------------------------------------
RPOC2_SYNY3      -PGVKLEESGKVLEINGKG-----------------------------------------
RPOC2_MICAN      -AGVLAPNSGQVLAVDKTA-----------------------------------------
RPOC2_SYNP2      -EGVVIEDSAQVLKVSDK------------------------------------------
RPOC2_SYNJB      -PGIPSPQSGQVMQITDGQ-----------------------------------------
RPOC2_SYNJA      -PGIPAPESGQVMQIADGQ-----------------------------------------
RPOC2_GLOVI      -KDFASPESGQVVLAESGR-----------------------------------------
RPOC2_PROMA      -NEEPINCCGEIEAIKENK-----------------------------------------
RPOC2_PROM4      -KGEPINCCGEVEDIKGNK-----------------------------------------
RPOC2_PROM1      -KDQSIDACGEIENIDGKK-----------------------------------------
RPOC2_PROMT      -KDQSIDACGEIENIDGKK-----------------------------------------
RPOC2_PROM3      -KDEPSSCCGEVEEVEGKA-----------------------------------------
RPOC2_PROMM      -KDEPSSCCGEVEEVDGKA-----------------------------------------
RPOC2_SYNS3      -QGQPSDCCGEVEQVSANS-----------------------------------------
RPOC2_SYNPW      -AGQPSDCCGEVEKVDSTS-----------------------------------------
RPOC2_SYNSC      -EGETASCCGEIEAVSGNS-----------------------------------------
RPOC2_SYNPX      -EGDPSSCCGEVEAVDSNS-----------------------------------------
RPOC2_SYNS9      -SGQPSDCCGEVEAVDGSS-----------------------------------------
RPOC2_PROMS      -KSIKSTFCGEIEEVSNSS-----------------------------------------
RPOC2_PROM0      -KSVKSTSCGEIEEISNSS-----------------------------------------
RPOC2_PROM2      -KTVKSTSCGEIEEISNSS-----------------------------------------
RPOC2_PROM9      -GSEKAISCGEIEEVSSSS-----------------------------------------
RPOC2_PROM5      -EGEKATSCGEIEEVSSKC-----------------------------------------
RPOC2_PROMP      -KGVKSTSCGEIEEVSSEY-----------------------------------------
RPOC2_SYNR3      -GGLTCPHSGQVEEVKGSS-----------------------------------------
RPOC2_PAUCH      -ENDPSPCCGQVETIKNNT-----------------------------------------
RPOC2_GUITH      -GSVIASESGQVFEITKNE-----------------------------------------
RPOC2_RHDSA      -NGIIAETSGQIVEIETNK-----------------------------------------
RPOC2_PORPU      -ESIISLDSGQITHISQES-----------------------------------------
RPOC2_PYRYE      -ENMTSLDSGQIIEISSRS-----------------------------------------
RPOC2_GRATL      -TNIISYISGQVISIRDNQ-----------------------------------------
RPOC2_CYAPA      -ETIKIPNSGQIIEITSTY-----------------------------------------
RPOC2_CYACA      NKNFKSPYSGEVLDINDKL-----------------------------------------
RPOC2_EMIHU      -DNVKSPYSGQILEIFEDH-----------------------------------------
RPOC2_PHATC      NENNLTLQKGKPYFFPNCKDDNVINKTNLQYKTISPTRVSPRLEKNINYKISLNYYDMMK
RPOC2_THAPS      NGQFLTVQKGRPYFFPNCKSDDSKEKLDLQYKLIGLNNTISN-----NTNTFLNYYDVTK
RPOC2_TRICV      NDEFVTIQKGRPYFFPNCKNEEAIINTDLIYKPLQSSSFLDNSKLKTNRLVYLNYFDITK
RPOC2_CHLVU      -PGFASSLSGRILDITATQ-----------------------------------------
RPOC2_OSTTA      -TSTRIPLSGQINFITAEN-----------------------------------------
RPOC2_BIGNA      -PGKKINQSGQIIEKSNSF-----------------------------------------
RPOC2_CHLAT      -PGVRLPQSGQIIQLQSDQ-----------------------------------------
RPOC2_MESVI      -PGILAPQSGQVIQLQANR-----------------------------------------
RPOC2_NEPOL      -EGASTPISGQLIEIRRDR-----------------------------------------
                                                                             

RPOC2_STAPU      ------------------------------------------------------------
RPOC2_ZYGCR      ------------------------------------------------------------
RPOC2_CHAVU      ------------------------------------------------------------
RPOC2_ANEMR      ------------------------------------------------------------
RPOC2_MARPO      ------------------------------------------------------------
RPOC2_PHYPA      ------------------------------------------------------------
RPOC2_ANTAG      ------------------------------------------------------------
RPOC2_ANGEV      ------------------------------------------------------------
RPOC2_PSINU      ------------------------------------------------------------
RPOC2_PINKO      ------------------------------------------------------------
RPOC2_PINTH      ------------------------------------------------------------
RPOC2_CYCTA      ------------------------------------------------------------
RPOC2_CRYJA      ------------------------------------------------------------
RPOC2_AGRST      ------------------------------------------------------------
RPOC2_LOLPR      ------------------------------------------------------------
RPOC2_HORVU      ------------------------------------------------------------
RPOC2_WHEAT      ------------------------------------------------------------
RPOC2_SACHY      ------------------------------------------------------------
RPOC2_SACOF      ------------------------------------------------------------
RPOC2_SORBI      ------------------------------------------------------------
RPOC2_MAIZE      ------------------------------------------------------------
RPOC2_ORYNI      ------------------------------------------------------------
RPOC2_ORYSI      ------------------------------------------------------------
RPOC2_ORYSA      ------------------------------------------------------------
RPOC2_ORYSJ      ------------------------------------------------------------
RPOC2_DIOEL      ------------------------------------------------------------
RPOC2_PHAAO      ------------------------------------------------------------
RPOC2_LEMMI      ------------------------------------------------------------
RPOC2_ACOCL      ------------------------------------------------------------
RPOC2_AMBTC      ------------------------------------------------------------
RPOC2_NYMAL      ------------------------------------------------------------
RPOC2_ILLOL      ------------------------------------------------------------
RPOC2_CALFG      ------------------------------------------------------------
RPOC2_LIRTU      ------------------------------------------------------------
RPOC2_DRIGR      ------------------------------------------------------------
RPOC2_CHLSC      ------------------------------------------------------------
RPOC2_CERDE      ------------------------------------------------------------
RPOC2_PIPCE      ------------------------------------------------------------
RPOC2_BUXMI      ------------------------------------------------------------
RPOC2_PLAOC      ------------------------------------------------------------
RPOC2_NANDO      ------------------------------------------------------------
RPOC2_RANMC      ------------------------------------------------------------
RPOC2_SOLBU      ------------------------------------------------------------
RPOC2_SOLTU      ------------------------------------------------------------
RPOC2_SOLLC      ------------------------------------------------------------
RPOC2_ATRBE      ------------------------------------------------------------
RPOC2_NICSY      ------------------------------------------------------------
RPOC2_TOBAC      ------------------------------------------------------------
RPOC2_NICTO      ------------------------------------------------------------
RPOC2_COFAR      ------------------------------------------------------------
RPOC2_JASNU      ------------------------------------------------------------
RPOC2_CUSEX      ------------------------------------------------------------
RPOC2_CUSRE      ------------------------------------------------------------
RPOC2_IPOPU      ------------------------------------------------------------
RPOC2_DAUCA      ------------------------------------------------------------
RPOC2_PANGI      ------------------------------------------------------------
RPOC2_GUIAB      ------------------------------------------------------------
RPOC2_HELAN      ------------------------------------------------------------
RPOC2_LACSA      ------------------------------------------------------------
RPOC2_SILLA      ------------------------------------------------------------
RPOC2_SPIOL      ------------------------------------------------------------
RPOC2_FAGEA      ------------------------------------------------------------
RPOC2_SOYBN      ------------------------------------------------------------
RPOC2_PHAVU      ------------------------------------------------------------
RPOC2_LOTJA      ------------------------------------------------------------
RPOC2_PELHO      ------------------------------------------------------------
RPOC2_OENAR      ------------------------------------------------------------
RPOC2_OENPA      ------------------------------------------------------------
RPOC2_OENEH      ------------------------------------------------------------
RPOC2_OENGL      ------------------------------------------------------------
RPOC2_OENBI      ------------------------------------------------------------
RPOC2_EUCGG      ------------------------------------------------------------
RPOC2_AETCO      ------------------------------------------------------------
RPOC2_AETGR      ------------------------------------------------------------
RPOC2_ARATH      ------------------------------------------------------------
RPOC2_CAPBU      ------------------------------------------------------------
RPOC2_CRUWA      ------------------------------------------------------------
RPOC2_OLIPU      ------------------------------------------------------------
RPOC2_BARVE      ------------------------------------------------------------
RPOC2_NASOF      ------------------------------------------------------------
RPOC2_LEPVR      ------------------------------------------------------------
RPOC2_LOBMA      ------------------------------------------------------------
RPOC2_ARAHI      ------------------------------------------------------------
RPOC2_DRANE      ------------------------------------------------------------
RPOC2_SINAL      ------------------------------------------------------------
RPOC2_CARPA      ------------------------------------------------------------
RPOC2_GOSBA      ------------------------------------------------------------
RPOC2_GOSHI      ------------------------------------------------------------
RPOC2_CITSI      ------------------------------------------------------------
RPOC2_CUCSA      ------------------------------------------------------------
RPOC2_MORIN      ------------------------------------------------------------
RPOC2_POPAL      ------------------------------------------------------------
RPOC2_POPTR      ------------------------------------------------------------
RPOC2_MANES      ------------------------------------------------------------
RPOC2_VITVI      ------------------------------------------------------------
RPOC2_WELMI      ------------------------------------------------------------
RPOC2_ADICA      ------------------------------------------------------------
RPOC2_CHAGL      ------------------------------------------------------------
RPOC2_ACAM1      ------------------------------------------------------------
RPOC2_THEEB      ------------------------------------------------------------
RPOC2_NOSS1      ------------------------------------------------------------
RPOC2_TRIV2      ------------------------------------------------------------
RPOC2_NOSP7      ------------------------------------------------------------
RPOC2_SYNE7      ------------------------------------------------------------
RPOC2_SYNP6      ------------------------------------------------------------
RPOC2_TRIEI      ------------------------------------------------------------
RPOC2_CROS5      ------------------------------------------------------------
RPOC2_SYNY3      ------------------------------------------------------------
RPOC2_MICAN      ------------------------------------------------------------
RPOC2_SYNP2      ------------------------------------------------------------
RPOC2_SYNJB      ------------------------------------------------------------
RPOC2_SYNJA      ------------------------------------------------------------
RPOC2_GLOVI      ------------------------------------------------------------
RPOC2_PROMA      ------------------------------------------------------------
RPOC2_PROM4      ------------------------------------------------------------
RPOC2_PROM1      ------------------------------------------------------------
RPOC2_PROMT      ------------------------------------------------------------
RPOC2_PROM3      ------------------------------------------------------------
RPOC2_PROMM      ------------------------------------------------------------
RPOC2_SYNS3      ------------------------------------------------------------
RPOC2_SYNPW      ------------------------------------------------------------
RPOC2_SYNSC      ------------------------------------------------------------
RPOC2_SYNPX      ------------------------------------------------------------
RPOC2_SYNS9      ------------------------------------------------------------
RPOC2_PROMS      ------------------------------------------------------------
RPOC2_PROM0      ------------------------------------------------------------
RPOC2_PROM2      ------------------------------------------------------------
RPOC2_PROM9      ------------------------------------------------------------
RPOC2_PROM5      ------------------------------------------------------------
RPOC2_PROMP      ------------------------------------------------------------
RPOC2_SYNR3      ------------------------------------------------------------
RPOC2_PAUCH      ------------------------------------------------------------
RPOC2_GUITH      ------------------------------------------------------------
RPOC2_RHDSA      ------------------------------------------------------------
RPOC2_PORPU      ------------------------------------------------------------
RPOC2_PYRYE      ------------------------------------------------------------
RPOC2_GRATL      ------------------------------------------------------------
RPOC2_CYAPA      ------------------------------------------------------------
RPOC2_CYACA      ------------------------------------------------------------
RPOC2_EMIHU      ------------------------------------------------------------
RPOC2_PHATC      LSVNKDCTLSEKNEDPIKIKSEFSKLFLKKNGKLYSSLIPQFFKKFSLHTSEFS------
RPOC2_THAPS      RSLVERLGPNKKS---YGFKVKFSKMFIKKNGKFYSSPIPLFLNNFSIIKEEQK------
RPOC2_TRICV      GLINQRIHS-------QDIICKFSKMFIKKNGKLYSSLLAGLINRIAIINKQLDSQQIPS
RPOC2_CHLVU      ------------------------------------------------------------
RPOC2_OSTTA      ------------------------------------------------------------
RPOC2_BIGNA      ------------------------------------------------------------
RPOC2_CHLAT      ------------------------------------------------------------
RPOC2_MESVI      ------------------------------------------------------------
RPOC2_NEPOL      ------------------------------------------------------------
                                                                             

RPOC2_STAPU      ------------------------------------------------------------
RPOC2_ZYGCR      ------------------------------------------------------------
RPOC2_CHAVU      ------------------------------------------------------------
RPOC2_ANEMR      ------------------------------------------------------------
RPOC2_MARPO      ------------------------------------------------------------
RPOC2_PHYPA      ------------------------------------------------------------
RPOC2_ANTAG      ------------------------------------------------------------
RPOC2_ANGEV      ------------------------------------------------------------
RPOC2_PSINU      ------------------------------------------------------------
RPOC2_PINKO      ------------------------------------------------------------
RPOC2_PINTH      ------------------------------------------------------------
RPOC2_CYCTA      ------------------------------------------------------------
RPOC2_CRYJA      ------------------------------------------------------------
RPOC2_AGRST      ------------------------------------------------------------
RPOC2_LOLPR      ------------------------------------------------------------
RPOC2_HORVU      ------------------------------------------------------------
RPOC2_WHEAT      ------------------------------------------------------------
RPOC2_SACHY      ------------------------------------------------------------
RPOC2_SACOF      ------------------------------------------------------------
RPOC2_SORBI      ------------------------------------------------------------
RPOC2_MAIZE      ------------------------------------------------------------
RPOC2_ORYNI      ------------------------------------------------------------
RPOC2_ORYSI      ------------------------------------------------------------
RPOC2_ORYSA      ------------------------------------------------------------
RPOC2_ORYSJ      ------------------------------------------------------------
RPOC2_DIOEL      ------------------------------------------------------------
RPOC2_PHAAO      ------------------------------------------------------------
RPOC2_LEMMI      ------------------------------------------------------------
RPOC2_ACOCL      ------------------------------------------------------------
RPOC2_AMBTC      ------------------------------------------------------------
RPOC2_NYMAL      ------------------------------------------------------------
RPOC2_ILLOL      ------------------------------------------------------------
RPOC2_CALFG      ------------------------------------------------------------
RPOC2_LIRTU      ------------------------------------------------------------
RPOC2_DRIGR      ------------------------------------------------------------
RPOC2_CHLSC      ------------------------------------------------------------
RPOC2_CERDE      ------------------------------------------------------------
RPOC2_PIPCE      ------------------------------------------------------------
RPOC2_BUXMI      ------------------------------------------------------------
RPOC2_PLAOC      ------------------------------------------------------------
RPOC2_NANDO      ------------------------------------------------------------
RPOC2_RANMC      ------------------------------------------------------------
RPOC2_SOLBU      ------------------------------------------------------------
RPOC2_SOLTU      ------------------------------------------------------------
RPOC2_SOLLC      ------------------------------------------------------------
RPOC2_ATRBE      ------------------------------------------------------------
RPOC2_NICSY      ------------------------------------------------------------
RPOC2_TOBAC      ------------------------------------------------------------
RPOC2_NICTO      ------------------------------------------------------------
RPOC2_COFAR      ------------------------------------------------------------
RPOC2_JASNU      ------------------------------------------------------------
RPOC2_CUSEX      ------------------------------------------------------------
RPOC2_CUSRE      ------------------------------------------------------------
RPOC2_IPOPU      ------------------------------------------------------------
RPOC2_DAUCA      ------------------------------------------------------------
RPOC2_PANGI      ------------------------------------------------------------
RPOC2_GUIAB      ------------------------------------------------------------
RPOC2_HELAN      ------------------------------------------------------------
RPOC2_LACSA      ------------------------------------------------------------
RPOC2_SILLA      ------------------------------------------------------------
RPOC2_SPIOL      ------------------------------------------------------------
RPOC2_FAGEA      ------------------------------------------------------------
RPOC2_SOYBN      ------------------------------------------------------------
RPOC2_PHAVU      ------------------------------------------------------------
RPOC2_LOTJA      ------------------------------------------------------------
RPOC2_PELHO      ------------------------------------------------------------
RPOC2_OENAR      ------------------------------------------------------------
RPOC2_OENPA      ------------------------------------------------------------
RPOC2_OENEH      ------------------------------------------------------------
RPOC2_OENGL      ------------------------------------------------------------
RPOC2_OENBI      ------------------------------------------------------------
RPOC2_EUCGG      ------------------------------------------------------------
RPOC2_AETCO      ------------------------------------------------------------
RPOC2_AETGR      ------------------------------------------------------------
RPOC2_ARATH      ------------------------------------------------------------
RPOC2_CAPBU      ------------------------------------------------------------
RPOC2_CRUWA      ------------------------------------------------------------
RPOC2_OLIPU      ------------------------------------------------------------
RPOC2_BARVE      ------------------------------------------------------------
RPOC2_NASOF      ------------------------------------------------------------
RPOC2_LEPVR      ------------------------------------------------------------
RPOC2_LOBMA      ------------------------------------------------------------
RPOC2_ARAHI      ------------------------------------------------------------
RPOC2_DRANE      ------------------------------------------------------------
RPOC2_SINAL      ------------------------------------------------------------
RPOC2_CARPA      ------------------------------------------------------------
RPOC2_GOSBA      ------------------------------------------------------------
RPOC2_GOSHI      ------------------------------------------------------------
RPOC2_CITSI      ------------------------------------------------------------
RPOC2_CUCSA      ------------------------------------------------------------
RPOC2_MORIN      ------------------------------------------------------------
RPOC2_POPAL      ------------------------------------------------------------
RPOC2_POPTR      ------------------------------------------------------------
RPOC2_MANES      ------------------------------------------------------------
RPOC2_VITVI      ------------------------------------------------------------
RPOC2_WELMI      ------------------------------------------------------------
RPOC2_ADICA      ------------------------------------------------------------
RPOC2_CHAGL      ------------------------------------------------------------
RPOC2_ACAM1      ------------------------------------------------------------
RPOC2_THEEB      ------------------------------------------------------------
RPOC2_NOSS1      ------------------------------------------------------------
RPOC2_TRIV2      ------------------------------------------------------------
RPOC2_NOSP7      ------------------------------------------------------------
RPOC2_SYNE7      ------------------------------------------------------------
RPOC2_SYNP6      ------------------------------------------------------------
RPOC2_TRIEI      ------------------------------------------------------------
RPOC2_CROS5      ------------------------------------------------------------
RPOC2_SYNY3      ------------------------------------------------------------
RPOC2_MICAN      ------------------------------------------------------------
RPOC2_SYNP2      ------------------------------------------------------------
RPOC2_SYNJB      ------------------------------------------------------------
RPOC2_SYNJA      ------------------------------------------------------------
RPOC2_GLOVI      ------------------------------------------------------------
RPOC2_PROMA      ------------------------------------------------------------
RPOC2_PROM4      ------------------------------------------------------------
RPOC2_PROM1      ------------------------------------------------------------
RPOC2_PROMT      ------------------------------------------------------------
RPOC2_PROM3      ------------------------------------------------------------
RPOC2_PROMM      ------------------------------------------------------------
RPOC2_SYNS3      ------------------------------------------------------------
RPOC2_SYNPW      ------------------------------------------------------------
RPOC2_SYNSC      ------------------------------------------------------------
RPOC2_SYNPX      ------------------------------------------------------------
RPOC2_SYNS9      ------------------------------------------------------------
RPOC2_PROMS      ------------------------------------------------------------
RPOC2_PROM0      ------------------------------------------------------------
RPOC2_PROM2      ------------------------------------------------------------
RPOC2_PROM9      ------------------------------------------------------------
RPOC2_PROM5      ------------------------------------------------------------
RPOC2_PROMP      ------------------------------------------------------------
RPOC2_SYNR3      ------------------------------------------------------------
RPOC2_PAUCH      ------------------------------------------------------------
RPOC2_GUITH      ------------------------------------------------------------
RPOC2_RHDSA      ------------------------------------------------------------
RPOC2_PORPU      ------------------------------------------------------------
RPOC2_PYRYE      ------------------------------------------------------------
RPOC2_GRATL      ------------------------------------------------------------
RPOC2_CYAPA      ------------------------------------------------------------
RPOC2_CYACA      ------------------------------------------------------------
RPOC2_EMIHU      ------------------------------------------------------------
RPOC2_PHATC      --------PKYKQIIQPNGLAKRTIG---KMDRTLLMQSSEITKNDYKNLKNSNYQLALL
RPOC2_THAPS      --------RLNEGKNEINNFIIKNTQLKIKQCLPLLLKSSELVTNKIKRKTPFNNNLTGL
RPOC2_TRICV      CPTSIRKYREENSSKKLKKRMKRKYKKITGIKTLLFIKNSELNLNPLKDTQDRKNSLTVA
RPOC2_CHLVU      ------------------------------------------------------------
RPOC2_OSTTA      ------------------------------------------------------------
RPOC2_BIGNA      ------------------------------------------------------------
RPOC2_CHLAT      ------------------------------------------------------------
RPOC2_MESVI      ------------------------------------------------------------
RPOC2_NEPOL      ------------------------------------------------------------
                                                                             

RPOC2_STAPU      --------------LLIRLAKLYLIPTGGIAHTFHKQTINEGDTLVTLAYERLKASDIIQ
RPOC2_ZYGCR      --------------IVLRLSQPYLLAPGTFIHPDCYDVINRGDIVITMMYEQLRTTDIIQ
RPOC2_CHAVU      --------------IILRIGKPYLATRGAIVHPRNGETIREGDTLMTLIYERLKAGDIIQ
RPOC2_ANEMR      --------------LIIRLGKPHLANEGAIIHNNCGGSVEEGDTLITLIYERLKSGDIIQ
RPOC2_MARPO      --------------FIIRLAKPYLATGGATIHNNYGEFIKEGDTLITLIYERLKSGDIIQ
RPOC2_PHYPA      --------------LVIRLAKPYLATGGAIIHNNYGEIVKEGDILITLIYERLKSGDIIQ
RPOC2_ANTAG      --------------LVVRLAKPSLATGGATIHSHYGQIIKKGDVLITLVYERLKSGDIIQ
RPOC2_ANGEV      --------------VMIRLSKPYLATKGATVHSNYGDILKEGDTLITLIYERLRSGDIIQ
RPOC2_PSINU      --------------LIIRLAKLYLATKGATIHNHYGDLLREGDTLITLTYERFKSGDIIQ
RPOC2_PINKO      --------------LVIRSAKPYLATRKATVHGHYGEILDKGDTLITLIYERLKSSDIIQ
RPOC2_PINTH      --------------LVIRSAKPYLATRKATVHSHYGKILDKGDTLITLIYERFKSSDIIQ
RPOC2_CYCTA      --------------LVIRLAELYLATRRATVHGHYGEIINEGDTLITLIYERFKSGDIIQ
RPOC2_CRYJA      --------------FVIRLAKPYLGARGATLNSYYGKILSQGDTLITMLYERLKSDDIIQ
RPOC2_AGRST      --------------FVIRAAKPYLATTGATVNGHYGEILYKGDRLVTFIYEKSRSSDITQ
RPOC2_LOLPR      --------------FVIRAAKPYLATTGATVNGHYGEILYKGDRLVTFIYEKSRSSDITQ
RPOC2_HORVU      --------------FVIRAAKPYLATTGATVNGHYGEILYKGDRLVTFIYEKSRSSDITQ
RPOC2_WHEAT      --------------FVIRAAKPYLATTGATVNGHYGEILYKGDRLVTFIYEKSRSSDITQ
RPOC2_SACHY      --------------FVLRAAKPYLATIGATVHGHYGKILYKGDRLVTFIYEKSRSSDITQ
RPOC2_SACOF      --------------FVLRAAKPYLATIGATVHGHYGKILYKGDRLVTFIYEKSRSSDITQ
RPOC2_SORBI      --------------FVLRAAKPYLATIGATVHGHYGKILYKGDRLVTFIYEKSRSSDITQ
RPOC2_MAIZE      --------------FVLRAAKPYLATIGATVHGHYGKILYKGDRLVTFIYEKSRSSDITQ
RPOC2_ORYNI      --------------FVIRAAKPYLATTGATVHGHYGEILYKGDRLVTFIYEKARSSDITQ
RPOC2_ORYSI      --------------FVIRAAKPYLATTGATVHGHYGEILYKGDRLVTFIYEKARSSDITQ
RPOC2_ORYSA      --------------FVIRAAKPYLATTGATVHGHYGEILYKGDRLVTFIYEKARSSDITQ
RPOC2_ORYSJ      --------------FVIRAAKPYLATTGATVHGHYGEILYKGDRLVTFIYEKARSSDITQ
RPOC2_DIOEL      --------------LVIRSAKPYLVTLGATVHGHYGKILYEGDRLVTFIYERSRSGDITQ
RPOC2_PHAAO      --------------LVIRSAKPYLVTPGATVHGHYGETFYEGDTLITFIYEKSRSGDITQ
RPOC2_LEMMI      --------------LVIRSAKPYLATPGATVHGHYGETLHEGDTLVTFIYEKSRSGDITQ
RPOC2_ACOCL      --------------FVIRAAKPYLATPGATVHGHYGEILYGGDTLITFIYEKSRSGDITQ
RPOC2_AMBTC      --------------LVIRLAKYHLATRGATVHGHYGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_NYMAL      --------------FIIRSAKPYLATRGATVHGDYGEIFYEGDTLVTFIYEKSRSGDITH
RPOC2_ILLOL      --------------LVIRSAKPHLATPGATVHGHYGEILYEGNTLVTFIYEKSRSGDITQ
RPOC2_CALFG      --------------LVIRSAKPHLATPGATVHGHCGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_LIRTU      --------------LVIRSAKPHLATPGATVHGHYGEILSEGDTLVTFIYEKSRSGDITQ
RPOC2_DRIGR      --------------LVIRSAKPHLATPGATVHGHYGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_CHLSC      --------------LVIRSAKPHLATPGATVHGHYGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_CERDE      --------------LVIRSAKPHLATPGATVHGHYGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_PIPCE      --------------LVIRSAKLHLATPGATVHGHYGEIIYEGDTLVTFIYEKSRSGDITQ
RPOC2_BUXMI      --------------LVIRSAKPYLATPGATVHGHYGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_PLAOC      --------------LVIRSAKPYLATPGATVHGHYGEILYKGDTLVTFIYEKSRSGDITQ
RPOC2_NANDO      --------------LVIRSAKPYLATPGATVHGHYGEILYKGDTLVTFIYEKSRSGDITQ
RPOC2_RANMC      --------------LVIRSAKPYLATPGATVHGHYGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_SOLBU      --------------IVIRSAKPYLATPGATVHGHYGETLYEGDTLVTFIYEKSRSGDITQ
RPOC2_SOLTU      --------------IVIRSAKPYLATPGATVHGHYGETLNQGNTLVTFIYEKSISDDITQ
RPOC2_SOLLC      --------------IVIRSAKPYLATPGATVHGHYGETLYEGDTLVTFIYEKSRSGDITQ
RPOC2_ATRBE      --------------IVIRSAKPYLATPGATVHGHYGETLYEGDTLVTFIYEKSRSGDITQ
RPOC2_NICSY      --------------IVIRSAKPYLATPGATVHGHYGETLYEGDTLVTFIYEKSRSGDITQ
RPOC2_TOBAC      --------------IVIRSAKPYLATPGATVHGHYGETLYEGDTLVTFIYEKSRSGDITQ
RPOC2_NICTO      --------------IVIRSAKPYLATPGATVHGHYGETLYEGDTLVTFIYEKSRSGDITQ
RPOC2_COFAR      --------------VVIRSAKPYLATPGATVHGHYGETLYEGDILVTFIYEKSRSGDITQ
RPOC2_JASNU      --------------VVIRSAKPYLATPGTTVHGHYGEILYEGDTLITFLYEKSRSSDITQ
RPOC2_CUSEX      --------------VVIRLAKPYLATPGATVHGLYGETFFGGDTVVTFNYEKSISGDITQ
RPOC2_CUSRE      --------------VVIRLAKPYLATPGATVHGLYGETFFGGDTVVTFNYEKSRSGDITQ
RPOC2_IPOPU      --------------VVIRSAKPYLATPGATVRGLYGETFYEGDTLVTFHYEKSRSGDITQ
RPOC2_DAUCA      --------------VVIRSAKPYLATPGATVHGHYGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_PANGI      --------------VVIRSAKPYLATPGATVHGHYGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_GUIAB      --------------VVIRSAKPYLATPGATVHGHYGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_HELAN      --------------VVIRSAKPYLATPGATVHGHYGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_LACSA      --------------VVIRSAKPYLATPGATVHGHYGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_SILLA      --------------VVIRSAKPCLATPGATVHGHYGEIIYEGDTLVTFIYEKSRSGDITQ
RPOC2_SPIOL      --------------VVIRSAKPYLATPGATLHGHYGEIIYEGDTLVTFIYEKSRSGDITQ
RPOC2_FAGEA      --------------VVIRAAKPYLATPGATVHGHYGEIIYEGDTLVTFIYEKSRSGDITQ
RPOC2_SOYBN      --------------VGIRSANPYLATPGATVHGHYGEILSEGDILVTFIYEKSRSGDITQ
RPOC2_PHAVU      --------------VGIRSANPYLATPGTTVHGHYGEILSEGDILVTFIYQKSRSGDITQ
RPOC2_LOTJA      --------------VGIRLANPYLATPGATIHGHYGEMLYEGDILVTFIYEKSRSGDITQ
RPOC2_PELHO      --------------VIIRSGKPYLAIPGATVHGHSGQIVYGGDTLVTFIYEKARSADITQ
RPOC2_OENAR      --------------VVIRSAKPYLATPGATVHGHYGEILYDGDTVVTFLYEKSRSGDITQ
RPOC2_OENPA      --------------VVIRSAKPYLATPGATVHGHYGEILYDGDTVVTFLYEKSRSGDITQ
RPOC2_OENEH      --------------VVIRSAKPYLATPGATVHGHYGEILYDGDTVVTFLYEKSRSGDITQ
RPOC2_OENGL      --------------VVIRSAKPYLATPGATVHGHYGEILYDGDTVVTFLYEKSRSGDITQ
RPOC2_OENBI      --------------VVIRSAKPYLATPGATVHGHYGEILYDGDTVVTFLYEKSRSGDITQ
RPOC2_EUCGG      --------------VVIRSAKPYLATPGATVHGHYGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_AETCO      --------------VVIRSAKPYLATPGAKVHGHYGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_AETGR      --------------VVLRCAKPYLATPGAKVHGHYGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_ARATH      --------------AVIRSAKPYLATPGAKVHGHYSEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_CAPBU      --------------VVIRSAKPYLATPGAKVHGHYREILYEGDTLVTFIYEKSRSGDITQ
RPOC2_CRUWA      --------------VVIRAAKPYLATPGAKVHGHYREILYEGDTLVTFIYEKSRSGDITQ
RPOC2_OLIPU      --------------VVIRSAKPYLATPGAKVHGHYREILYEGDTLVTFIYEKSRSGDITQ
RPOC2_BARVE      --------------VVIRSAKPYLATPGAKVHGHYREILYEGDTLVTFIYEKSRSGDITQ
RPOC2_NASOF      --------------VVIRSAKPYLATPGAKVHGHYREILYEGDTLVTFIYEKSRSGDITQ
RPOC2_LEPVR      --------------VVIRSAKPYLATPGAKVHGHYREILYEGDTLVTFIYEKSRSGDITQ
RPOC2_LOBMA      --------------VVIRSAKPYLATPGAKVHGHYREILYEGDTLVTFIYEKSRSGDITQ
RPOC2_ARAHI      --------------IVIRSAKPYLATPGAKVHGHYREILYEGDTLVTFIYEKSRSGDITQ
RPOC2_DRANE      --------------IVIRSAKPYLATPGAKVHGHYREILYEGDTLVTFIYEKSRSGDITQ
RPOC2_SINAL      --------------VVIRSAKPYLATPGAKVHGHYREILYEGDTLVTFIYEKSRSGDITQ
RPOC2_CARPA      --------------VVIRSAKPYLATPGATVHGHYGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_GOSBA      --------------IVIRSAKPYLATPGATVHGHYGETLYEGDTLVTFIYEKSRSGDITQ
RPOC2_GOSHI      --------------IVIRSAKPYLATPGATVHGHYGETLYEGDTLVTFIYEKSRSGDITQ
RPOC2_CITSI      --------------VVIRSAKPYLATPGATVHGHYGAILYEGDTLVTFIYEKSRSGDITQ
RPOC2_CUCSA      --------------LVIRSAKPYLATSGATVHRHYGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_MORIN      --------------VVIRSAKSYLATPGATVHGHYGEILSEGDTLVTFIYEKSRSGDITQ
RPOC2_POPAL      --------------VILRLAKPYLATPGATVHGHYGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_POPTR      --------------VILRLAKPYLATPGATVHGHYGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_MANES      --------------VVIRSAKPYLATPGATVHGHYGEILYEGNTLVTFIYEKSRSGDITQ
RPOC2_VITVI      --------------VVIRSAKPYLATLGATVHGHYGEILYEGDTLVTFIYEKSRSGDITQ
RPOC2_WELMI      --------------LVVRLAKPYLATPKATIHGNFAEIINQGDPLITFFYERFKSSDITQ
RPOC2_ADICA      --------------SLVRTGKTFLATRGANPHKSSGDILEEGDTLITLPYDRLKSGDITQ
RPOC2_CHAGL      --------------CVFRLCRPYLATKNAIIYGNYKQIITSGDNFITIVYERFKTRDIIQ
RPOC2_ACAM1      --------------VTLRIARPYLVSPGAVLQIDDQDLVQRGDNLALLVFERTKTGDIIQ
RPOC2_THEEB      --------------VILRLARPYLVSPGAVLQIEEGDLVQRGDNLALLVFERAKTGDIIQ
RPOC2_NOSS1      ----DAALSTQNYAVTIRAGRPYRVSPGAVLQIEDGDLVQRGDNLVLLVFERAKTGDIIQ
RPOC2_TRIV2      ----DAALSTQNYAVTIRAGRPYRVSPGAVLQIEDGDLVQRGDNLVLLVFERAKTGDIIQ
RPOC2_NOSP7      ----ESALSTKNYVITTRIGRPYRVSPGAVLQIEDGDLVQRGDNLVLLVFERAKTGDIIQ
RPOC2_SYNE7      --------------LQLRIARPYRVSQGAVLHVEDKGLVQRGDNLVLLVFERAKTGDIIQ
RPOC2_SYNP6      --------------LQLRIARPYRVSQGAVLHVEDKGLVQRGDNLVLLVFERAKTGDIIQ
RPOC2_TRIEI      ---------SKGYQVILRKGRPYRVSTGAVLLTMDGDLVQRGDILVLLVFERTKTGDIIQ
RPOC2_CROS5      ----------EGYEIKLRLARPYRVSPGAILHIADGDLVQRGDNLVLLVYERAKTGDIIQ
RPOC2_SYNY3      ----------DNYQLVLRRARPYRVSPGAVLHIEDGDLVQRGDNLVLLVFERAKTGDIVQ
RPOC2_MICAN      ----------TGYEIRLRKARPYRVSAGAILHIDEGDLVQRGDNLVLLVFERSKTGDIIQ
RPOC2_SYNP2      -------------EIVLRHARPYRVSGGAVLHIDEGDLVQRGDNLVLLVFERAKTGDIIQ
RPOC2_SYNJB      --------------VLLRMARPYLVSAGAILQVRNGDLVQRGDSLALLVFERAKTGDIIQ
RPOC2_SYNJA      --------------VVLRLARPYLVSAGAILQVRDGDLVQRGDSLALLVFERAKTGDIIQ
RPOC2_GLOVI      --------------VVVRIGRPYLVSGGAILLVVDGDLIQRGDNLALLVFERAKTGDIIQ
RPOC2_PROMA      --------------VTLRLGRPYMVSPDSVLHVKNGDLVQRGDGLALLVFERQKTGDIVQ
RPOC2_PROM4      --------------VTLRLGRPYMVSPDSVLHVRDGDLVQRGDGLALLVFERQKTGDIVQ
RPOC2_PROM1      --------------VKLRLGRPYMVSPDSVLHVRDGDLVQRGDGLALLVFERQKTGDIVQ
RPOC2_PROMT      --------------VKLRLGRPYMVSPDSVLHVRDGDLVQRGDGLALLVFERQKTGDIVQ
RPOC2_PROM3      --------------ITLRLGRPYMVSPDSVLHVRDGDLVQRGDGLALLVFERQKTGDIVQ
RPOC2_PROMM      --------------ITLRLGRPYMVSPDSVLHVRDGDLVQRGDGLALLVFERQKTGDIVQ
RPOC2_SYNS3      --------------VTMRLGRPYMISPDSLLHVRDGDLVQRGDGLALLVFERQKTGDIVQ
RPOC2_SYNPW      --------------VTLRLGRPYMVSPDSLLHVRDGDLVQRGDGLALLVFERQKTGDIVQ
RPOC2_SYNSC      --------------VTLRLGRPYMVSPDSVLHVRDGNLVQRGDGLALLVFERQKTGDIVQ
RPOC2_SYNPX      --------------VTLRLGRPYMVSPDSVLHVRDGDLVQRGDGLALLVFERQKTGDIVQ
RPOC2_SYNS9      --------------VTLRLGRPYMVSPDSLLHVRDGDLVQRGDGLALLVFERQKTGDIVQ
RPOC2_PROMS      --------------VTLRYGRPYMVSPDSVLHVKDGDLVLRGDGLALLVFERQKTGDIVQ
RPOC2_PROM0      --------------VTLRLGRPYMVSPDSVLHVKDGDLVLRGDGLALLVFERQKTGDIVQ
RPOC2_PROM2      --------------VTLRLGRPYMVSPDSVLHVKDGDLVLRGDGLALLVFERQKTGDIVQ
RPOC2_PROM9      --------------VTLRIGRPYMVSPDSVLHVEDGDLVLRGDGLALLVFERQKTGDIVQ
RPOC2_PROM5      --------------VTLRLGRPYMVSPDSVLHVKDGDLVLRGDGLALLVFERQKTGDIVQ
RPOC2_PROMP      --------------VILRIGRPYMVSPDSVLHVKDGDLVLRGDGLALLVFERQKTGDIVQ
RPOC2_SYNR3      --------------LTLRVGRPYMVSPDSILHVRDGDLVLRGDTLAQLVFERAKTGDIVQ
RPOC2_PAUCH      --------------IIIRIGRPYMISSDSTLHVKDRELVQRGDSLALLVFERQKTGDIVQ
RPOC2_GUITH      --------------IILRKAYPYLVSAGAILQIKDHELVQRNDTLAILVFERSKTGDIVQ
RPOC2_RHDSA      --------------IKIRSGTPYLVSSNAILQVKNGNLVETGDTLAILVFERSKTGDIVQ
RPOC2_PORPU      --------------ATLRIARPYLVSNAAILHVDNNALIRKGETLAVLVFDRAKTGDIIQ
RPOC2_PYRYE      --------------VTLRIARPYLVSNGAILHVDNNALIRRGETLAILVFDRAKTGDIIQ
RPOC2_GRATL      --------------ITVRLGQPYLISEGSFLHVNNQALIQRGENIATLIFERVKTGDIVQ
RPOC2_CYAPA      --------------IRLRISRPYLISARAIIRVLTGDLVQSGESLALLVFERAKTGDIIQ
RPOC2_CYACA      --------------ITIRIAEPYLISPGTLIHVNHGELIRKGDYLALLVFDKIKTGDIIQ
RPOC2_EMIHU      --------------ILIRLSQPYLISAGTILHATSNNLVKAGDILATLVYETIKTTDIVQ
RPOC2_PHATC      KFVEYPFTKSTKSIGLYSITEDYFEQDVNSVFCKNSEFIEEGETLGLLNLEKEITGDIVQ
RPOC2_THAPS      KFLKYPFNK---SIGIHSLTEDYFEQEVNNVYCKNGEFIEKGEVIGLLNFEKEITGDIVQ
RPOC2_TRICV      TFMLSKFYKF--TGGIHSITEDYFDEEVNSVFCKNGEFVKNGQTIGLLNFEKEITGDIVQ
RPOC2_CHLVU      --------------ITVRKALPFLGSRRGLVHVAQNDLLQKNHILMTLRSKQLQTEDIVQ
RPOC2_OSTTA      --------------VLFRSVQPYLLVPGSNVVVKHGSLVQENSVLGTLMTSQSTAGDIVQ
RPOC2_BIGNA      --------------LVLRKGTPLLSPITGIFYVWNGDFVSQGSPIMTLLYNKLKTGDIVQ
RPOC2_CHLAT      --------------VTIRIARPYLVSSEAVLHVNHGDLVKSGDTLVMLIFEQAKTGDIVQ
RPOC2_MESVI      --------------VTLRLARPYLVSSEAVLYVDDGDFVKSGDTLVMLIFEQSKTGDIVQ
RPOC2_NEPOL      --------------VTLRIGQPYRVGWQSRLMVTRDQIVKAEKVLAHLLYFKTKTGDIVQ
                                                       .     .  :      : ** :

RPOC2_STAPU      GLPKAEQLLEARVGNQVVI-----------------------------------------
RPOC2_ZYGCR      GLPKAEQLLEARSFNEVVL-----------------------------------------
RPOC2_CHAVU      GLPKIEQLLEARRENVVEL-----------------------------------------
RPOC2_ANEMR      GLPKVEQLLEARSTNSVSI-----------------------------------------
RPOC2_MARPO      GLPKVEQLLEARPINSVSI-----------------------------------------
RPOC2_PHYPA      GLPKVEQLLEARLTNPVSI-----------------------------------------
RPOC2_ANTAG      GLPKVEQLLEARPINSTSI-----------------------------------------
RPOC2_ANGEV      GLPKVEQLLEARSINSVSL-----------------------------------------
RPOC2_PSINU      GLPKVEQLLEARSVNAVSR-----------------------------------------
RPOC2_PINKO      GLPKVEQLSEARLNNSISM-----------------------------------------
RPOC2_PINTH      GLPKVEQLSEARLNNSISM-----------------------------------------
RPOC2_CYCTA      GLPKVEQLSEARSINSISM-----------------------------------------
RPOC2_CRYJA      GLPKVEQLSEARSNTSISK-----------------------------------------
RPOC2_AGRST      GLPKVEQIFEARSIDSLSP-----------------------------------------
RPOC2_LOLPR      GLPKVEQIFEARSIDSLSP-----------------------------------------
RPOC2_HORVU      GLPKVEQIFEARSIDSLSP-----------------------------------------
RPOC2_WHEAT      GLPKVEQIFEARSIDSLSP-----------------------------------------
RPOC2_SACHY      GLPKVEQIFEARSIDSLSP-----------------------------------------
RPOC2_SACOF      GLPKVEQIFEARSIDSLSP-----------------------------------------
RPOC2_SORBI      GLPKVEQIFEARSIDSLSP-----------------------------------------
RPOC2_MAIZE      GLPKVEQIFEARSIDSLSP-----------------------------------------
RPOC2_ORYNI      GLPKVEQIFEARSIDSLSP-----------------------------------------
RPOC2_ORYSI      GLPKVEQIFEARSIDSLSP-----------------------------------------
RPOC2_ORYSA      GLPKVEQIFEARSIDSLSP-----------------------------------------
RPOC2_ORYSJ      GLPKVEQIFEARSIDSLSP-----------------------------------------
RPOC2_DIOEL      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_PHAAO      GLPKVEQILEVRSIDSISM-----------------------------------------
RPOC2_LEMMI      GLPKVEQVLEVRSIDSIST-----------------------------------------
RPOC2_ACOCL      GLPKVEQVLEVRSIDSIST-----------------------------------------
RPOC2_AMBTC      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_NYMAL      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_ILLOL      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_CALFG      GLPKVEQVLEARSIDSISM-----------------------------------------
RPOC2_LIRTU      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_DRIGR      GLPKVEQVLEVRSVDSISM-----------------------------------------
RPOC2_CHLSC      GLPKVEQVLEVRSIDSISI-----------------------------------------
RPOC2_CERDE      GLPKVEQVLEVRSIDSISL-----------------------------------------
RPOC2_PIPCE      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_BUXMI      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_PLAOC      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_NANDO      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_RANMC      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_SOLBU      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_SOLTU      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_SOLLC      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_ATRBE      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_NICSY      GLPKVEQVLEVRSVDSISM-----------------------------------------
RPOC2_TOBAC      GLPKVEQVLEVRSVDSISM-----------------------------------------
RPOC2_NICTO      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_COFAR      GLPKVEQILEVRSIDSISM-----------------------------------------
RPOC2_JASNU      GLPKVEEVFEVRSIDSISM-----------------------------------------
RPOC2_CUSEX      GLPKVEQVLEVRSVDSISM-----------------------------------------
RPOC2_CUSRE      GLPKVEQVLEVRSVDSISM-----------------------------------------
RPOC2_IPOPU      GLPKVEQVLEVRSVDSISM-----------------------------------------
RPOC2_DAUCA      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_PANGI      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_GUIAB      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_HELAN      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_LACSA      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_SILLA      GLPKVEQVLEVRSVESISM-----------------------------------------
RPOC2_SPIOL      GLPKVEQVLEVRSIDSISI-----------------------------------------
RPOC2_FAGEA      GLPKVEQVLEVRSLESISM-----------------------------------------
RPOC2_SOYBN      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_PHAVU      GLPKVEQVLEVRSIDSISI-----------------------------------------
RPOC2_LOTJA      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_PELHO      GLPKVDAMFEVRSKNSISM-----------------------------------------
RPOC2_OENAR      GLPKVEQVLEVRSVDSISV-----------------------------------------
RPOC2_OENPA      GLPKVEQVLEVRSVDSISV-----------------------------------------
RPOC2_OENEH      GLPKVEQVLEVRSVDSISV-----------------------------------------
RPOC2_OENGL      GLPKVEQVLEVRSVDSISV-----------------------------------------
RPOC2_OENBI      GLPKVEQVLEVRSVDSISV-----------------------------------------
RPOC2_EUCGG      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_AETCO      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_AETGR      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_ARATH      GLPKVEQVLEVRSIDSISL-----------------------------------------
RPOC2_CAPBU      GLPKVEQVLEVRSIDSISL-----------------------------------------
RPOC2_CRUWA      GLPKVEQVLEVRSIDSISL-----------------------------------------
RPOC2_OLIPU      GLPKVEQVLEVRSIDSISL-----------------------------------------
RPOC2_BARVE      GLPKVEQVLEVRAIDSISL-----------------------------------------
RPOC2_NASOF      GLPKVEQVLEVRSIDSISL-----------------------------------------
RPOC2_LEPVR      GLPKVEQVLEVRSIDSISL-----------------------------------------
RPOC2_LOBMA      GLPKVEQVLEVRSIDSISL-----------------------------------------
RPOC2_ARAHI      GLPKVEQVLEVRSIDSISL-----------------------------------------
RPOC2_DRANE      GLPKVEQVLEVRSIDSISL-----------------------------------------
RPOC2_SINAL      GLPKVEQVLEVRSIDSISL-----------------------------------------
RPOC2_CARPA      GLPKVEQVLEVRSIDSISL-----------------------------------------
RPOC2_GOSBA      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_GOSHI      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_CITSI      GLPKVEQVLEVRSLDSISM-----------------------------------------
RPOC2_CUCSA      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_MORIN      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_POPAL      GLPKVEQVLEVRSIDSISI-----------------------------------------
RPOC2_POPTR      GLPKVEQVLEVRSIDSISI-----------------------------------------
RPOC2_MANES      GLPKVEQVLEVRSIDSISI-----------------------------------------
RPOC2_VITVI      GLPKVEQVLEVRSIDSISM-----------------------------------------
RPOC2_WELMI      GLPKVEQLAEAQSNNPVVQ-----------------------------------------
RPOC2_ADICA      GLPKVEQLLESRSIASISA-----------------------------------------
RPOC2_CHAGL      GLPKVEQLLEARPLNNLSS-----------------------------------------
RPOC2_ACAM1      GLPRIEELLEARKPKEMCTLAQRSGTCQVIYND--DDSIEVKIVEQDGTITDYPIGPGQN
RPOC2_THEEB      GLPRIEELLEARHPKEKCVLAVRPGTCQVTYNS--DDSVEIKVIEEDGTIQEYPVLPGQN
RPOC2_NOSS1      GLPRIEELLEARKPKEACILAKRGGEVKVVYGD-GDEAIAIKVIESNGVVTDYPLGPGQN
RPOC2_TRIV2      GLPRIEELLEARKPKEACILAKRGGEVKVVYGD-GDEAIAIKVIESNGVVTDYPLGPGQN
RPOC2_NOSP7      GLPRIEELLEARKPKEACILCRRGGEVKVVYAESGDEAIAIKVVESNGVVTDYPLGPGQN
RPOC2_SYNE7      GLPRIEELLEARKPKEACILARRPGVAHINYSD--DDAIDIQVIEADGTQADYPVGPGQP
RPOC2_SYNP6      GLPRIEELLEARKPKEACILARRPGVAHINYSD--DDAIDIQVIEADGTQADYPVGPGQP
RPOC2_TRIEI      GLPRIEELLEARKPKESCILVKYPGQAQVNVND---DNVEVSVVSSDGTITDYPLGHGQN
RPOC2_CROS5      GLPRIEELLEARKPKEACVLSRKPGVCQVEYLE--DESVDVKVIEDDGTVSEYPILLNQN
RPOC2_SYNY3      GLPRIEELLEARKPKEACVLARAPGVCQVEYLE--DESVDIKVVEDDGTVSEYPLLPGQN
RPOC2_MICAN      GLPRIEELLEARKPKEACVLARKPGVCQVEYQD--SEIVDIKVVEDDGTISEYPLLGSQN
RPOC2_SYNP2      GLPRIEELLEARKPKEAAVLARRPGTCQVEYLD--DETVDVKVIEDDGVISEYPVSLNQS
RPOC2_SYNJB      GLPRIEELLEARKPKEMCVLAKRPGTVQLSWRG--EE-PDLKVIEADGTVRDYSVLPGQS
RPOC2_SYNJA      GLPRIEELLEARKPKEMCVLAKRPGTVQLSWRG--EE-PDLRVIEADGTVTEYSVMPGQN
RPOC2_GLOVI      GLPRVEELLEGRKPKEMCVLVERPGKVQITQMP--DESYQVSVVEDDGGVTNYPII-GQS
RPOC2_PROMA      GLPRIEELLEARRPRDSAILCKRRGIVEINQGD-DDDSVVVKVIESDDLIEEYPILLGKN
RPOC2_PROM4      GLPRIEELLEARRPRESAILCKKPGIVEIKQEE-DDESVVVKVIESDDSLSEYSILLGRN
RPOC2_PROM1      GLPRIEELLEARRPRDSAILCKKSGTVDIKKGD-DDDSVVVSIIEDNDVISEYPILLGRN
RPOC2_PROMT      GLPRIEELLEARRPRDSAILCKKSGTVDIKKGD-DDDSVVVSIIEDNDVISEYPILLGRN
RPOC2_PROM3      GLPRIEELLEARRPRESAVLCKKPGTVEIKQGE-DDESITVTVIEADDAIGEYPILLGRN
RPOC2_PROMM      GLPRIEELLEARRPRESAVLCKKPGTVEIKQGE-DDESITVTVIEADDAIGEYPILLGRN
RPOC2_SYNS3      GLPRIEELLEARRPRESSILCKKPGTVEIKQGE-DDEFTTVTVIESDDAIAEYPILLGRN
RPOC2_SYNPW      GLPRIEELLEARRPRESAILCKKPGTVEIKQGE-DDENTTVTVIEADDAVSEYPILLGRN
RPOC2_SYNSC      GLPRIEELLEARRPRESTILCKKPGTVEIKQGE-DDESLAVNVIESDDAIGEYPILLGRN
RPOC2_SYNPX      GLPRIEELLEARRPRESAVLCKKPGTVEIKQGD-DDESLTVTVIEADDAIGEYPILLGRN
RPOC2_SYNS9      GLPRIEELLEARRPRDSAILCRKPGTVEIKQGE-DDDSLSVNVIESDDAIGEYPILLGRN
RPOC2_PROMS      GLPRIEELLEARRPRDAAILCKKSGIVQIKQGN-DEESVSLSVIEKDDLVNEYQLLVGKN
RPOC2_PROM0      GLPRIEELLEARRPRDSAILSKKSGIVQIKKGN-DEESVSLSVIEKDDFVNEYQLLIGKN
RPOC2_PROM2      GLPRIEELLEARRPRDSATLCKKSGIVQIKKGN-DEESVSLSVIEKDDLVNEYQLLIGKN
RPOC2_PROM9      GLPRIEELLEARRPRDSAILCNKSGVVQIKQGN-DEESVSLSVIEKDDLVNEYQLLPGKN
RPOC2_PROM5      GLPRIEELLEARRPRDSSTLCKRSGVVQIKEGN-DDESVSLSVIERDDSINEYQLLIGQN
RPOC2_PROMP      GLPRIEELLEARRPRDSSILCKKSGVVQIKEGT-DEESVSLSVIERDDSISEYQLLMGQN
RPOC2_SYNR3      GLPRIEELLEARRPRESAVLCRKAGTIKVEQPE-GEDNPTVSVNEGEELHTEYPILLGRT
RPOC2_PAUCH      GLPRIEELLEARRPRDSAVLCKQPGVLTLRHDE-ETDSSIAVIKSANGEETEYPILLGRN
RPOC2_GUITH      GLPRIEEILEARKPKEPCKLSQKPGKINTTNSN--DETEVIQLIDTDGYTTDYIINNNQK
RPOC2_RHDSA      GLPRIEEILEARKPKEPSKLSQRPGKITLNYDS--EDNKCIRILSSNGEYNEYIMSGIQK
RPOC2_PORPU      GLPRIEEILEARKK----------------------------------------------
RPOC2_PYRYE      GLPRIEEILEARKK----------------------------------------------
RPOC2_GRATL      GLPRIEEILEARKK----------------------------------------------
RPOC2_CYAPA      GLPRIEELLEARKPKDNCVLSTHPGFTQLYYSE----TIELKIKSLDKINTLLELQPGVF
RPOC2_CYACA      GLPRIEEILEARKPRETCHLAKFDGKIYVHYND--KGESLISLESQKKEKYVYILRLNQR
RPOC2_EMIHU      GLPKVEELLEARKVLHNALLAPCPGYAYVRFNK--HGESTVQLIGLDNEVQTLALKPGIK
RPOC2_PHATC      GLPRIEEILEARKKNSNIKRIPTSQKKGLLVQK--------SSLDTNFEFRKLGTNIKEN
RPOC2_THAPS      GLPRIEELLEARKKKPTNKHLATNQKKSLLIQK--------TSIDSSFEFQKLGTTIKEN
RPOC2_TRICV      GLPRVEQLLEARKKKQITKNLPINKKKGLLTQT--------TSIDSYFEFKKLGTSIKEN
RPOC2_CHLVU      GIPKIEQLFEARETKD--------------------------------------------
RPOC2_OSTTA      GLPKVDELLEAREPQ---------------------------------------------
RPOC2_BIGNA      GIPKIEHFFEARKGN---------------------------------------------
RPOC2_CHLAT      GLPRIEELLEARRTKG--------------------------------------------
RPOC2_MESVI      GLPRIEELLEARRTKG--------------------------------------------
RPOC2_NEPOL      GLPKIEEILEARRKKG--------------------------------------------
                 *:*: : . * :                                                

RPOC2_STAPU      -------------NLYMRFEILVARIKEQLRNYIGSLTQMDLMLSQISVNRASKALEYSQ
RPOC2_ZYGCR      -------------KLENDFVMLTERIARQLRS-----------LSRSYMLSTKESTKHSQ
RPOC2_CHAVU      -------------IVNRYFLDCTNLLTEELGMLLG--------SLWGFQFSAWASMERSK
RPOC2_ANEMR      -------------DLGSSFRDWSNDMKRFIGNLWG------------FFLSARISMEQGQ
RPOC2_MARPO      -------------NLENGFEDWNNDMIKFIGNLWG------------FFLSTKISMEQGQ
RPOC2_PHYPA      -------------NLEKGFGEWNKDMTNFFGSLWG------------YFLSAQISMEQSQ
RPOC2_ANTAG      -------------NLENGFENWNRDMTKSLGSLWG------------FLLSAKTTMNQSQ
RPOC2_ANGEV      -------------DLEKNFLFWNNTMIRLVGNFWS------------HFLGVKTSIEQCQ
RPOC2_PSINU      -------------NIEDNFKKCNRVIAKFIESPWS------------FFFSAKISTEQSR
RPOC2_PINKO      -------------NLKESFENWTGDMTRFLGSLWG------------LFISARITMEQSQ
RPOC2_PINTH      -------------NLKESFENWTGDMTRFLGSLWG------------LFISARITMEQSQ
RPOC2_CYCTA      -------------NLEKSFEDWNRDMTRSLGSPWG------------SFISSKITMEQSR
RPOC2_CRYJA      -------------NRKKRFQKLNRYLAIFFGNFWG------------SFTSVRMTMEDSQ
RPOC2_AGRST      -------------NLERRIEDWNERIPRILGVPWG------------FLIGAELTIAQSR
RPOC2_LOLPR      -------------NLERRIEDWNERIPRILGIPWG------------FLIGAELTIAQSR
RPOC2_HORVU      -------------NLERRIEDWNERIPRILGVPWG------------FLIGAELTIAQSR
RPOC2_WHEAT      -------------NLERRIEDWNERIPRILGVPWG------------FLIGAELTIAQSR
RPOC2_SACHY      -------------NLERRIEDWNERIPRILGVPWG------------FLIGAELTIAQSR
RPOC2_SACOF      -------------NLERRIEDWNERIPRILGVPWG------------FLIGAELTIAQSR
RPOC2_SORBI      -------------NLERRIEDWNERIPRILGVPWG------------FLIGAELTIAQSR
RPOC2_MAIZE      -------------NLERRIEDWNERIPRILGVPWG------------FLIGAELTIAQSR
RPOC2_ORYNI      -------------NLERRIEDWNERIPRILGGPWG------------FLIGAELTIAQSR
RPOC2_ORYSI      -------------NLERRIEDWNERIPRILGGPWG------------FLIGAELTIAQSR
RPOC2_ORYSA      -------------NLERRIEDWNERIPRILGGPWG------------FLIGAELTIAQSR
RPOC2_ORYSJ      -------------NLERRIEDWNERIPRILGGPWG------------FLIGAELTIAQSR
RPOC2_DIOEL      -------------NLEKRVNSWNECISRILGRPWG------------FMIGSELTIAQSR
RPOC2_PHAAO      -------------NLERRVEGWDERIRRILGIPWG------------FLIGAELTIAQSR
RPOC2_LEMMI      -------------NLEKRVKAWNERISRILGNPWG------------FLISTELTIAQSR
RPOC2_ACOCL      -------------NLEKRVEGWNEHITKILGIPWG------------FLIGAELTIAQSR
RPOC2_AMBTC      -------------NLEKRVEGWNERITGFLGIPWE------------FFISAQLTIVQSR
RPOC2_NYMAL      -------------NLEKRVEGWNEHITGILGIPWG------------FLIGAELTIAQSR
RPOC2_ILLOL      -------------NLEKRFEGWGERMTGILGIPWG------------FLIGAELTIAQSH
RPOC2_CALFG      -------------NLEKRVEGWNERITKILGIPWG------------FLIGAELTIAQSR
RPOC2_LIRTU      -------------NLEKRIEGWNEHITRILGIPWG------------FLIGAELTIAQSR
RPOC2_DRIGR      -------------NLEKRVEGWNEHIKRILGIPWG------------FLIGAELTIAQSR
RPOC2_CHLSC      -------------NLEKRVEGWNERITRIIGIPWG------------FLIGAELTIAQSR
RPOC2_CERDE      -------------NLEKRVEGWNERVTRILGIPWG------------FLIGAELTIAQSC
RPOC2_PIPCE      -------------NLEKRVEGWNENITKILGIPWG------------FLIGAELTIVQSR
RPOC2_BUXMI      -------------NLEKRVEGWNERIPRILGIPWG------------FLIGAELTIAQSR
RPOC2_PLAOC      -------------TLENRVEGWNERITRILGIPWE------------YLIGAELTIAQSR
RPOC2_NANDO      -------------NLEKRVEGWNERITRILGIPWG------------FLIGAELTIAQSR
RPOC2_RANMC      -------------NLENRVEGWNERITRTLGIPWG------------FLIGAELTIAQSR
RPOC2_SOLBU      -------------NLEKRVESWNKCIPRILGIPWG------------FLIGAELTIAQSR
RPOC2_SOLTU      -------------NLEKRVESWNKCIPRILGIPWG------------FLIGAELTIAQSR
RPOC2_SOLLC      -------------NLEKRVEGWNKCIPRILGIPWG------------FLIGAELTIAQSR
RPOC2_ATRBE      -------------NLEKRVEGWNKCITRILGIPWG------------FLIGAELTIAQSR
RPOC2_NICSY      -------------NLEKRIEGWNKCITRILGIPWG------------FLIGAELTIAQSR
RPOC2_TOBAC      -------------NLEKRIEGWNKCITRILGIPWG------------FLIGAELTIAQSR
RPOC2_NICTO      -------------NLEKRIEGWNKCITRILGIPWG------------FLIGAELTIAQSR
RPOC2_COFAR      -------------NLQKRIEGWNKCITRILGTPWG------------FLISAELTIVQSQ
RPOC2_JASNU      -------------NLEKRFKGWNKRITRILGMPWG------------FLIGAELTIVQSR
RPOC2_CUSEX      -------------NLEGRVEGWSKCITGILGIPWG------------FFIGAELTIVQSR
RPOC2_CUSRE      -------------NLEGRVEGWGKCITGILGIPWG------------FLIGAELTIVQSR
RPOC2_IPOPU      -------------NLERRVEGWNKCLTRILGIPWG------------FLIGAELTIAQSR
RPOC2_DAUCA      -------------NLEKRVEGWHECITRTLGIPWG------------FLIGAELTIVQSR
RPOC2_PANGI      -------------NLEKRVEGWNECITRNLGIPWG------------FLIGAELTIVQSR
RPOC2_GUIAB      -------------NLEKRIEGWNKCITRILGIPWA------------FFIGAELTIVQSR
RPOC2_HELAN      -------------NLEKRIEGWNKCITRILGIPWA------------FFIGAKLTIVQSR
RPOC2_LACSA      -------------NLEKRIEGWNKSITRILGIPWA------------FLIGAELTIVQSR
RPOC2_SILLA      -------------NLEKRINGWNERIKKILGIPWG------------FLVGAELTIAQSR
RPOC2_SPIOL      -------------NLEKRIDSWNERITRILGSPWG------------FLIGAELTIAQSR
RPOC2_FAGEA      -------------NLERRIDAWNERITGILGLPWG------------FVVGAELTIVQSR
RPOC2_SOYBN      -------------NLEKRVDTWNGRITKILGIPWG------------FLIGAELTIAQSR
RPOC2_PHAVU      -------------NLEKRVGTWNGRITRILGIPWG------------FFISAELTIAQSR
RPOC2_LOTJA      -------------NLEKRIDAWNERITGILGIPWR------------FLIGAELTIAQSR
RPOC2_PELHO      -------------RLKARDEYWNEYITRNLGIYWG------------LLIGAKLTIAQSS
RPOC2_OENAR      -------------NLEKRVENWNEHITRILGFPWG------------FLIGAELTIVQSR
RPOC2_OENPA      -------------NLEKRVENWNEHITRILGFPWG------------FLIGAELTIVQSR
RPOC2_OENEH      -------------NLEKRVENWNEHITRILGFPWG------------FLIGAELTIVQSR
RPOC2_OENGL      -------------NLEKRVENWNEHITRILGFPWG------------FLIGAELTIVQSR
RPOC2_OENBI      -------------NLEKRVENWNEHITRILGFPWG------------FLIGAELTIVQSR
RPOC2_EUCGG      -------------NLEKRIEGWNEHIKKILGIPWG------------FLIGAELTIVQSR
RPOC2_AETCO      -------------NLEKRIKGWNKYITGILGIPWG------------FLVGAELTIVQSR
RPOC2_AETGR      -------------NLEKRIKGWNKYITRILGIPWG------------FLVGAELTIVQSR
RPOC2_ARATH      -------------NLEKRIKGWNKCITRILGIPWG------------FLIGAELTIVQSR
RPOC2_CAPBU      -------------NLEKRIKGWNKCITRILGIPWG------------FLIGAELTIVQSR
RPOC2_CRUWA      -------------NLEKRIKGWNKCITRILGIPWG------------FLIGAELTIVQSR
RPOC2_OLIPU      -------------NLEKRIKGWNKCITRILGIPWG------------FLIGAELTIVQSR
RPOC2_BARVE      -------------NLEKRIKGWNKCITRILGIPWG------------FLIGAELTIVQSR
RPOC2_NASOF      -------------NLEKRIKGWNKSITRILGIPWG------------FLIGAELTIVQSR
RPOC2_LEPVR      -------------NLEKRIKGWNKCITRILGIPWG------------FLIGAELTIVQSR
RPOC2_LOBMA      -------------NLEKRIKGWNKCITRILGIPWG------------FLIGAELTIVQSR
RPOC2_ARAHI      -------------NLEKRIKGWNKCITRILGIPWG------------FLIGAELTIVQSR
RPOC2_DRANE      -------------NLEKRIKGWNKCITRILGIPWG------------FLIGAELTIVQSR
RPOC2_SINAL      -------------NLEKRIKGWNRCITRILGIPWG------------FLIGAELTIVQSR
RPOC2_CARPA      -------------NLEKRVEGWNKRITRILGIPWG------------FLIGAELTIVQSR
RPOC2_GOSBA      -------------NLEKRIEGWNECITRILGIPWG------------FVIGAELTIVQSR
RPOC2_GOSHI      -------------NLEKRIEGWNECITRILGIPWG------------FVIGAELTIVQSR
RPOC2_CITSI      -------------NLEKRVEGWNASITRILGIPWG------------FLIGAELTIVQSR
RPOC2_CUCSA      -------------SLEKRIEGWNERITRILGIPWG------------FLIGAELTIVQSR
RPOC2_MORIN      -------------NLEKRVEGWNERITRILGIPWG------------FLIGAELTIVQSR
RPOC2_POPAL      -------------NLEKRVENWNECITRIVGIPWG------------FLIGAELTIVQSR
RPOC2_POPTR      -------------NLEKRVENWNECITRIVGIPWG------------FLIGAELTIVQSR
RPOC2_MANES      -------------NLEKRVEGWNECITRILGIPWG------------FLIGTELTIVQSR
RPOC2_VITVI      -------------NLEKRVEGWNEHITRILGIPWG------------FFIGAELTIAQSR
RPOC2_WELMI      -------------NIEENFRIWNQDMTRTFGSFWG------------LFISTKITMEQGR
RPOC2_ADICA      -------------GIGDLFEKWCQNITKLIGNPWS------------HLLGAGRSMEHCQ
RPOC2_CHAGL      -------------NLDFGFLDWNTDISRLLGNPWG------------FFLSSLIIIRQSQ
RPOC2_ACAM1      PIVLDGQTVEAGEAVTDGPLNPHDILEIYFRFHRE---------TKGVYESALLSLQKVQ
RPOC2_THEEB      PLVVDGQKVNLADPLTDGPVDPHDILSIYFEYYK----------PQGLLKAAQTSLEKVQ
RPOC2_NOSS1      LAMPDGSVVPAGQPLSDGPSNPHEILEVFFSLGS----------EDGVYACASHALQKVQ
RPOC2_TRIV2      LAMPDGSVVPAGQPLSDGPSNPHEILEVFFSLGS----------EDGVYACASHALQKVQ
RPOC2_NOSP7      LIVPDGSIVLAGQPLTDGPSNPHEILEIFFSLGS----------EDGIYACASLALQKVQ
RPOC2_SYNE7      LIISDGETVDAGQALTDGPANPHDLLEIYYDYFREQ--------LGEDYEAALESLRRVQ
RPOC2_SYNP6      LIISDGETVDAGQALTDGPANPHDLLEIYYDYFREQ--------LGEDYEAALESLRRVQ
RPOC2_TRIEI      VIVADGQNVNVGEALTDGPQNPHEILETFFNYYRE---------HESAYEACLRSFEACQ
RPOC2_CROS5      VIVSDNQRVDVGEHLTDGPANPHELLEVFFDYYVD---------KKGVYEAALIGLQAAQ
RPOC2_SYNY3      AMVTDGQRIDVGHALTDGYNNPHEILDVFFSYYVD---------KDGCYQAALRGLQAAQ
RPOC2_MICAN      PLVSDNQRIDVGQALTDGQANPHEILEVFFNYYVD---------SLGSYEAALKALEKTQ
RPOC2_SYNP2      VMVVDGQRVGPAEPLTDGLNNPHEILEIFFDYYAE---------SKGIYEAALIGLRESQ
RPOC2_SYNJB      LIVVDGQPVGVGDPLTDGPANPHDLLEIYYEYHRQ---------TLGDDQAARLALREVQ
RPOC2_SYNJA      LIVVDGQPVQVGDPLTDGPANPHDLLEIYFEYHRQ---------TLGDDQAARLALREVQ
RPOC2_GLOVI      LVVVDGQQVQTGESITDGPSNPHDILRIFTAREGL---------QKG--------IESVQ
RPOC2_PROMA      VMISDGQEVKAGELLTDGPVNPHELLECFFGDLRD---------RKPLMEAAQEAIAKLQ
RPOC2_PROM4      VMVSDGQEVHAGEFLTDGPVNPHELLECFFGDLRD---------RKPLLEAAQESIAKLQ
RPOC2_PROM1      VMVRNSQQVIAGEFLTDGPVNPHELLECFFTDLRD---------KKPLMDAAQEAIAKLQ
RPOC2_PROMT      VMVRNSQQVIAGEFLTDGPVNPHELLECFFTDLRD---------KKPLMDAAQEAIAKLQ
RPOC2_PROM3      VMVSNGQQVHAGELLTDGPINPHELLDCFFEDLRG---------RKPLMDAAQEAIAKLQ
RPOC2_PROMM      VMVSNGQQVHAGELLTDGPINPHELLDCFFEDLRG---------RKPLMDAAQEAIAKLQ
RPOC2_SYNS3      VMVSDGQQVNAGELLTDGPINPHELLECFFEDLRS---------RKPLMDAAQEAIAKLQ
RPOC2_SYNPW      VMVSDSQQVTAGELLTDGPINPHELLECFFEDLRS---------RKPLMDAAQEAIAKLQ
RPOC2_SYNSC      IMVSDGQQVTAGELLTDGPINPHELLECYFEDLRS---------RKPLMEAAQEAIANLQ
RPOC2_SYNPX      VMVSDGQQVTAGELLTDGPINPHELLECFFEDLRS---------RKPLMDAAQEAIANLQ
RPOC2_SYNS9      VMVNDGQQVTAGELLTDGPINPHELLECFFEDFRS---------RKPLMDAAQEAIANLQ
RPOC2_PROMS      LMVSDGQQVAGGEPLTDGPLNPHELLDCYFNDLKD---------QKPLLDAARESISKLQ
RPOC2_PROM0      IMVSDGQQVTGGESLTDGPINPHELLDCYFNDLKD---------QKPLIEAARESISKLQ
RPOC2_PROM2      IMVSDGQQVTGGESLTDGPINPHELLDCYFNDLKD---------QKPLIDAARESISKLQ
RPOC2_PROM9      IMVSDGQQVTGGEVLTDGPINPHELLDCYFSDIRD---------QKPLIDAARESISKLQ
RPOC2_PROM5      IMVSDGQQVKGGELLTDGPINPHELLDCLFTDIKD---------QKPLMDAARESISKLQ
RPOC2_PROMP      IMVSDGQQVTGGELLTDGPINPHDLLDCLFTDLKD---------QKPLMEAAQESISKLQ
RPOC2_SYNR3      VMVSDGQEVKAGDLLTDGPINPHELLEVIFEDLRG---------PLPTMDAANQAIGRLQ
RPOC2_PAUCH      LMVSVGQHIKAGELLTDGPINPHELLEYLFADLRS---------RKPLMEAAREAIAKVQ
RPOC2_GUITH      LIISNGENVLLAEPLTDGAPNPHEMLNLYFNFYTSI---------ITLYESAKLSLQKVQ
RPOC2_RHDSA      IIVSNGENILLAEPITDGAPNPHEMLGLFFNFYKER---------MPLYEAAKLALQKVQ
RPOC2_PORPU      ---------------TDVLLNPHDILDASFNLYIEC--------GLALYEAARLSFQEIQ
RPOC2_PYRYE      ---------------TDVLLNPHDILDASFDLYIEC--------GLALYEAARLSFQEIQ
RPOC2_GRATL      ---------------SDSFFNPHVVLDSKFRQYVNQ--------GLNLYDATRLSLLILQ
RPOC2_CYAPA      PTVTNNQFIEAGAPLSEGDISVHEILEIFFNLYFKNRVN-----CLSLADAIHLSLQKIQ
RPOC2_CYACA      VLVQSGTEVTIGEPITDGLINPHEMLEIFFEYFLT---------QTSPIQATKASFEKIR
RPOC2_EMIHU      TKFNSGDFVEVSSALTDGLISPHTKLETLFSYFKN---------RYTSFEACKLSFKLLQ
RPOC2_PHATC      EKVNPHKLLKVYFNYYGWIKPFICDQKEEIKYARL----------IKNYEGSYKSFKKVQ
RPOC2_THAPS      DKINPHNLLKIYFNYYGIKKQFFSNKEMFALSYRL----------TDNYEASYRTFKKIQ
RPOC2_TRICV      EKINPHNLLKVYFNYYGLIKTFFCENSYTKDSYRL----------FNNYEASYRSFKKVQ
RPOC2_CHLVU      --------------GEIIRYNMHFRLNSFFSLAKRV---------KPFLEAFDLSLLYIQ
RPOC2_OSTTA      ---------------HKVLTSMHAKLSTLFSQYGKI---------YGLREGCELSFQKIR
RPOC2_BIGNA      --------------VDLIQTNLYIKLLAFFKKYNKT---------LSEYRAVKRSILKIQ
RPOC2_CHLAT      --------------LKPLPNNLHDRLESLF-FQCRK--------KYGNHRAARKSLEEIQ
RPOC2_MESVI      --------------LKPLPNNLHDLLQSFF-DEATE--------KYGIQKAAKKSFEKLQ
RPOC2_NEPOL      --------------NEIIRSNLQDFVQQFYQDNLDE--------GFSRKYASTRTMRAMQ
                                                                             

RPOC2_STAPU      LETVDQVQKVYLSQGVYISDKHFEVIVRQMSSKIAIVENTDFTAFSPKAVIRTAFP----
RPOC2_ZYGCR      IDLVNRIQTVYLSQGVRIVDKHIEIIVRQMSSKVMLVENGDPLAVSSGGLICLPLPPIGS
RPOC2_CHAVU      LDLVFEIQQVYRSQGVYICDKHIEIIVRQMTSKIIILGDG--------------------
RPOC2_ANEMR      MILVDQIQKVYKSQGVQISNKHIEIIVRQMTSRFLTS-----------------------
RPOC2_MARPO      INLVDQIQKVYQSQGVQISNKHIEIIVRQMTSKVITL-----------------------
RPOC2_PHYPA      VNLVNQIQKVYRSQGVNISDKHIEIIVRQMTSKVFTL-----------------------
RPOC2_ANTAG      INLVDQIQEVYQSQGVYISDKHIEIVVRQMTSKVLTL-----------------------
RPOC2_ANGEV      LFLVNKVQKVYRSQGVQISDKHIEIIVRQMTSKVITL-----------------------
RPOC2_PSINU      KDLVDQIQGVYQSQGVQISDKHIEIIVRQMTSKVLTL-----------------------
RPOC2_PINKO      IHLVNQIQKVYRSQGVRIGDKHIEIIVRQMTSKVLIS-----------------------
RPOC2_PINTH      IHLVNQIQKVYRSQGVRIGDKHIEVIVRQMTSKVLIS-----------------------
RPOC2_CYCTA      IHLVNQIQRVYRSQGVQISDKHIEIIVRQMTSKVLIS-----------------------
RPOC2_CRYJA      NQLVDEIQKVYRSQGVQISDKHIEIIVRQITSKVLVVDVDRSENKNW-------------
RPOC2_AGRST      ISLVNKIQKVYRSQGVQIHNRHIEIIIRQVTSKVRVS-----------------------
RPOC2_LOLPR      ISLVNKIQKVYRSQGVQIHNRHIEIIIRQVTSKVRVS-----------------------
RPOC2_HORVU      ISLVNKIQKVYRSQGVQIHNRHIEIIIRQVTSKVRVS-----------------------
RPOC2_WHEAT      ISLVNKIQKVYRSQGVQIHNRHIEIIIRQVTSKVRVS-----------------------
RPOC2_SACHY      ISLVNKIQKVYRSQGVQIHNRHIEIIIRQVTSKVRVS-----------------------
RPOC2_SACOF      ISLVNKIQKVYRSQGVQIHNRHIEIIIRQVTSKVRVS-----------------------
RPOC2_SORBI      ISLVNKIQKVYRSQGVQIHNRHIEIIIRQVTSKVRVS-----------------------
RPOC2_MAIZE      ISLVNKIQKVYRSQGVQIHNRHIEIIIRQVTSKVRVS-----------------------
RPOC2_ORYNI      ISLVNKIQKVYRSQGVQIHNRHIEIIIRQVTSKVRVS-----------------------
RPOC2_ORYSI      ISLVNKIQKVYRSQGVQIHNRHIEIIIRQVTSKVRVS-----------------------
RPOC2_ORYSA      ISLVNKIQKVYRSQGVQIHNRHIEIIIRQVTSKVRVS-----------------------
RPOC2_ORYSJ      ISLVNKIQKVYRSQGVQIHNRHIEIIIRQVTSKVRVS-----------------------
RPOC2_DIOEL      ISLVNRIQKVYRSQGVQIHNRHIEIIVRQVTSRVLVS-----------------------
RPOC2_PHAAO      ISLVNKIQKVYRSQGVQIHNRHLEIIVRQVTSRVLVS-----------------------
RPOC2_LEMMI      ISLVNKIQKVYRSQGVQIHNRHLEIIVRQVTSKVLVS-----------------------
RPOC2_ACOCL      ISLVNKIQKVYRSQGVQIHNKHIEIIVRQITSKVLVS-----------------------
RPOC2_AMBTC      ISLVNKIQKVYRSQGVQIHNRHIETIVRQITSKVLVS-----------------------
RPOC2_NYMAL      VSLVNKIQKVYRSQGVQIHNKHIEIIVRQITSKVLVS-----------------------
RPOC2_ILLOL      FSLVNKIQRVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_CALFG      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSRVLVS-----------------------
RPOC2_LIRTU      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_DRIGR      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_CHLSC      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_CERDE      ISLVNKIQKVYRSQGVQIHNRHIEIVVRQITSKVLVS-----------------------
RPOC2_PIPCE      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_BUXMI      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_PLAOC      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_NANDO      VSLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_RANMC      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_SOLBU      ISLVNKIQQVYRSQGVQIHNRHIEIIVRQITSKVLIS-----------------------
RPOC2_SOLTU      ISLVNKIQQVYRSQGVQIHNRHIEIIVRQITSKVLIS-----------------------
RPOC2_SOLLC      ISLVNKIQQVYRSQGVQIHNRHIEIIVRQITSKVLIS-----------------------
RPOC2_ATRBE      ISLVNKIQQVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_NICSY      ISLVNKIQQVYRSQGVQIHNRHLEIIVRQITSKVLVS-----------------------
RPOC2_TOBAC      ISLVNKIQQVYRSQGVQIHNRHLEIIVRQITSKVLVS-----------------------
RPOC2_NICTO      ISLVNKIQQVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_COFAR      ISLVNKIQKVYRSQGVQIHNKHIEIIVRQITSKVLIS-----------------------
RPOC2_JASNU      ISLVNKIQRVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_CUSEX      ISLVNKIQKVYRAQGVHIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_CUSRE      ISLVNKIQKVYRFQGVHIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_IPOPU      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSNVLVS-----------------------
RPOC2_DAUCA      IALVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_PANGI      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_GUIAB      ISLVNKVQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_HELAN      ISLVNKVQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_LACSA      ISLVNKVQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_SILLA      ISLVNKIQKVYRSQGVQIHDRHIEIIVRQITSKVLVS-----------------------
RPOC2_SPIOL      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_FAGEA      ISLVNKIQKVYRSQGVQIHNRHLEIIVHQITSKVLVS-----------------------
RPOC2_SOYBN      ISLVNKIQKVYRSQGVHIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_PHAVU      ISLVNQIQKVYRSQGVHIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_LOTJA      ISLVNKIQRVYRSQGVHIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_PELHO      LSLVNEIQKVYRSQGVQIDNRHIELIVRQITSKVLIS-----------------------
RPOC2_OENAR      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_OENPA      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_OENEH      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_OENGL      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_OENBI      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_EUCGG      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_AETCO      LSLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_AETGR      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_ARATH      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_CAPBU      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_CRUWA      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_OLIPU      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_BARVE      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_NASOF      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_LEPVR      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_LOBMA      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_ARAHI      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_DRANE      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_SINAL      ISLVNKIKQVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_CARPA      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_GOSBA      LSLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_GOSHI      LSLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_CITSI      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_CUCSA      ISLVNKIQKVYRSQGVEIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_MORIN      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_POPAL      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_POPTR      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_MANES      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_VITVI      ISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVS-----------------------
RPOC2_WELMI      IHFVDQIQKVYQSQGVHICEKHIELIIRQMTSRVLVS-----------------------
RPOC2_ADICA      LILIDQIRKVYESQGVRICDKHLEIIVRQLTSRVVAS-----------------------
RPOC2_CHAGL      LELVNQIQKVYQSQGVQISDKHLEIIVRQMTSRVLTT-----------------------
RPOC2_ACAM1      NFLVNGVQSVYQSQGIDIADKHIEVVVRQMTSKVRID-----------------------
RPOC2_THEEB      SFLVNEVQSVYLSQGIEIADKHIEVIVRQMTSKVRID-----------------------
RPOC2_NOSS1      TFLVNEVQMVYQSQGIDIADKHIEVIVRQMTNKVRID-----------------------
RPOC2_TRIV2      TFLVNEVQMVYQSQGIDIADKHIEVIVRQMTNKVRID-----------------------
RPOC2_NOSP7      TFLVNEVQMVYQSQGIDISDKHIEVIVRQMTNKVRID-----------------------
RPOC2_SYNE7      ALLVNEVQSVYQSQGIDISDKHIEVIVRQMTSKVRID-----------------------
RPOC2_SYNP6      ALLVNEVQSVYQSQGIDISDKHIEVIVRQMTSKVRID-----------------------
RPOC2_TRIEI      RFLVNQVQAVYQSQGIDISDKHIEVIVRQMTAKVRID-----------------------
RPOC2_CROS5      KFLVDQVQSVYQSQGIDISDKHIEVIVRQMTAKVRVD-----------------------
RPOC2_SYNY3      KFLVNEVQTVYQSQGVDISDKHIEVIVRQMTAKVRID-----------------------
RPOC2_MICAN      MFLVDQVQSVYQSQGIDIADKHIEVIVRQMTSKVRID-----------------------
RPOC2_SYNP2      RFLVEEVQRVYQSQGIDISDKHIEVIVRQMTAKVRID-----------------------
RPOC2_SYNJB      RFFVNEVQNVYRSQGVEISDKHIEIVVRQMTSKVRVD-----------------------
RPOC2_SYNJA      RFLVNEVQNVYRSQGVEIADKHIEIVVRQMTSKVRVD-----------------------
RPOC2_GLOVI      RYLVNEVQQVYRSQGVEIHDKHIEIIVRQMTSKVRVE-----------------------
RPOC2_PROMA      HRLVTEVQNVYKSQGVAIDDKHIEVIVRQMTSKVRIE-----------------------
RPOC2_PROM4      HRLVTEVQNVYKSQGVSIDDKHIEVIVRQMTSKVRIE-----------------------
RPOC2_PROM1      HRMVSEVQNVYKSQGVAIDDKHIEVIVRQMTSKVRIE-----------------------
RPOC2_PROMT      HRMVSEVQNVYKSQGVAIDDKHIEVIVRQMTSKVRIE-----------------------
RPOC2_PROM3      HRLVTEVQNVYKSQGVSIDDKHIEVIVRQMTSKVRIE-----------------------
RPOC2_PROMM      HRLVTEVQNVYKSQGVSIDDKHIEVIVRQMTSKVRIE-----------------------
RPOC2_SYNS3      HRLVTEVQNVYKSQGVSIHDKHIEVIVRQMTSKVRIE-----------------------
RPOC2_SYNPW      HRLVTEVQNVYKSQGVSIDDKHIEVIVRQMTSKVRVE-----------------------
RPOC2_SYNSC      HRLVTEVQNVYKSQGVSIDDKHIEVIVRQMTSKVRVE-----------------------
RPOC2_SYNPX      HRLVTEVQNVYKSQGVSIDDKHIEVIVRQMTSKVRVE-----------------------
RPOC2_SYNS9      HRLVTEVQNVYKSQGVSIDDKHIEVIVRQMTSKVRVE-----------------------
RPOC2_PROMS      RSMVSEVQNVYKSQGVAIDDKHIEVIVRQMTSKVRIE-----------------------
RPOC2_PROM0      RSMVSEVQNVYKSQGVAIDDKHIEVIVRQMTSKVRIE-----------------------
RPOC2_PROM2      RSMVSEVQNVYKSQGVAIDDKHIEVIVRQMTSKVRIE-----------------------
RPOC2_PROM9      RSLVNEVQNVYKSQGVAIDDKHIEVIVRQMTSKVRIE-----------------------
RPOC2_PROM5      RRMVNEVQNVYKSQGVAIDDKHIEVIVRQMTSKVRIE-----------------------
RPOC2_PROMP      RKMVNEVQNVYKSQGVAISDKHIEVIVRQMTSKVRIE-----------------------
RPOC2_SYNR3      TALVQEVQNVYKSQGVTIDDKHLEVIVRQMTSKVRIE-----------------------
RPOC2_PAUCH      SRLVTEVQNVYKSQGVTIHNKHIEVIVRQMTSKVRIE-----------------------
RPOC2_GUITH      TYLVDEVQKVYQSQNVDISDKHIEVIVRQMTSKVKVE-----------------------
RPOC2_RHDSA      IYLVNEVQNVYQSQNVDISDKHIEVIVRQMTSKVKVE-----------------------
RPOC2_PORPU      LLLVKEVQLVYQSQGVNISDKHIEVIVRQMTSKVKIE-----------------------
RPOC2_PYRYE      LLLVKEVQLVYQSQGVNISDKHVEVIVRQMTSKVKIE-----------------------
RPOC2_GRATL      LYLVKELQLVYQSQGVEIADKHIEVIVRQMTSKVKIE-----------------------
RPOC2_CYAPA      QFLVSEVQSVYQSQGIDISDKHIEIIIKQMTNKVKIE-----------------------
RPOC2_CYACA      LELLKEIQQVYQSQKIEINDKHIEVIIRQMTSKVLIQ-----------------------
RPOC2_EMIHU      LFLIGEIQRTYRSQGVDIADKHVELIVKQMTSKVCIE-----------------------
RPOC2_PHATC      SFILDSVQAVYQSQGVIINDKHLEVIIKQMTTKVLIT-----------------------
RPOC2_THAPS      LLILNAVQSVYESQGVSIANKHLEVIIKQMTTKVLIT-----------------------
RPOC2_TRICV      SLILNSVQSVYKSQGVSIADKHLEVIIKQMTTKVLIT-----------------------
RPOC2_CHLVU      RFLVKTLLEAYSNQGVNIAEKHVEVVVRQMTARVRIT-----------------------
RPOC2_OSTTA      QFLVQEVQDVYQSQGVYIGDKHVEIIVRQMTTHVVVV-----------------------
RPOC2_BIGNA      KIIIDGVCRVYCSQGILVSRKHFEVIVKQMTSKVKIV-----------------------
RPOC2_CHLAT      LFLVNEIQSVYKSQGVSISDKHIEVIVRQMTSKVVIE-----------------------
RPOC2_MESVI      LFLVNEVQSVYKAQGVHISDKHIEVIVRQMTSKVMIE-----------------------
RPOC2_NEPOL      VLILRRVQLVYRSQGVQISDKHLEIISLRMTSRVLVE-----------------------
                    :  :  .*  * : :  :*.* :  ::: ..                          

RPOC2_STAPU      -------------YDVLGVFFPGEILDISKAQKMNRVL----YKPLPCKPVLLGITQASL
RPOC2_ZYGCR      FLPENWIEIPLSYVIDNHTFLPRELVELTRAQKINYVI----QNPVAYKPVLLGITKASL
RPOC2_CHAVU      ---------------MTDGFLPGELVEIPRARKTNRAM----KSIMFYKPILVGITRASL
RPOC2_ANEMR      ------------EDGIIDISSPGELIEFSQARRMNRVL----EEVISYEPILLGITEASL
RPOC2_MARPO      ------------EDGMTNVFLPGELIEFSRTQKMNRAL----EEAVPYKPILLGITKASL
RPOC2_PHYPA      ------------EDGMTNGFLPGELIEFARAKRMNRAL----EEVIPYKPVLLGITKASL
RPOC2_ANTAG      ------------EDGMANGFLPGELIESSRAQRMNRVL----EESVLYKPILLGITKASL
RPOC2_ANGEV      ------------EDGMANVFSPGELIELSRAQRMNRAL----KESISHKPIVLGMTKASL
RPOC2_PSINU      ------------EDGIATVFLPGELIELPRAQRMNRAL----KQLIYYKPILLGITKASL
RPOC2_PINKO      ------------EDGTANVFSPGELIGLSRAQRMDRAL----EETIYYQTMLLGITRASL
RPOC2_PINTH      ------------EDGTANVFSPGELIVLSRAQRMDRAL----EEAIYYQTMLLGITRASL
RPOC2_CYCTA      ------------GDGMADVFLPGELIELSRAQRMDRAL----KEATYYRTMLLGATRASL
RPOC2_CRYJA      ------------ENGLGSLFLPGELVGLSRVQRMDRAL----EKRINYRTILLGMTNASL
RPOC2_AGRST      ------------EDGMSNVFSPGELIGLLRAERAGRAL----DESIYYRAILLGITRASL
RPOC2_LOLPR      ------------EDGMSNVFSPGELIGLLRAERAGRAL----DESIYYRAILLGITRASL
RPOC2_HORVU      ------------EDGMSNVFSPGELIGLLRAERAGRAL----DESIYYRAILLGITRASL
RPOC2_WHEAT      ------------EDGMSNVFSPGELIGLLRAERAGRAL----DESIYYRAILLGITRASL
RPOC2_SACHY      ------------EDGMSNVFLPGELIGLLRAERAGRAL----DESIYYRAILLGITRASL
RPOC2_SACOF      ------------EDGMSNVFLPGELIGLLRAERAGRAL----DESIYYRAILLGITRASL
RPOC2_SORBI      ------------EDGMSNVFLPGELIGLLRAERAGRAL----DESIYYRAILLGITRASL
RPOC2_MAIZE      ------------EDGMSNVFLPGELIGLLRAERAGRAL----DESIYYRAILLGITRASL
RPOC2_ORYNI      ------------EDGMSNVFSPGELIGLLRAERAGRAL----DESIYYRAILLGITRVSL
RPOC2_ORYSI      ------------EDGMSNVFSPGELIGLLRAERAGRAL----DESIYYRAILLGITRVSL
RPOC2_ORYSA      ------------EDGMSNVFSPGELIGLLRAERAGRAL----DESIYYRAILLGITRVSL
RPOC2_ORYSJ      ------------EDGMSNVFSPGELIGLLRAERAGRAL----DESIYYRAILLGITRVSL
RPOC2_DIOEL      ------------EDGMSNVFSPGELIGLLRAERAGRAL----DEAICYRAILLGITRASL
RPOC2_PHAAO      ------------EDGMSNVFLPGEFIGLLRAERAGRVL----AESICYRAILLGITKSSL
RPOC2_LEMMI      ------------EDGMSNVFLPGELIGLLRAERAGRAL----DEAISYRAILLGITRASL
RPOC2_ACOCL      ------------EDGMSNVFSPGELIGLLRAERTGRAL----EEAICYRAILLGITRASL
RPOC2_AMBTC      ------------EDGMSNVFSPRELIGLLRAERIGRAL----EDDICYRAILLGITRASL
RPOC2_NYMAL      ------------EDGMSNVFSPGELIGLLRAERAGRAL----EEAICYRAVLLGITRASL
RPOC2_ILLOL      ------------EDGMSNVFSPGELIGLLRAERTGRAL----EEAICYRAVLLGITRASL
RPOC2_CALFG      ------------EDGMSNVFSPGELIGLLRAERTGRAL----EEAICYRAILLGITRASL
RPOC2_LIRTU      ------------EDGMSNVFSPGELIGLLRAERTGRAL----EEGICYRAILLGITRASL
RPOC2_DRIGR      ------------EDGMSNVFSPGELIGLLRAERTGRSL----EEAICYRAILWGITRASL
RPOC2_CHLSC      ------------EDGMSNVFSPGELIGLLRAERTGRAL----EEAICYRAILLGITRTSL
RPOC2_CERDE      ------------EDGMSNVFSPGELIGLLRAERTGRAL----EEAIRYRAILVGITRASL
RPOC2_PIPCE      ------------EDGMSNAFSPGELIGLLRAERTGRAL----EETICYRAILLGLTRASL
RPOC2_BUXMI      ------------EEGMSNVFSPGELIGLLRAERTGRAL----EEAICYRAVLLGITRASL
RPOC2_PLAOC      ------------EDGMSNVFSPGELIGLFRAERTGRAL----EEAICYRAVLLGITRASL
RPOC2_NANDO      ------------EDGMSNVFSPGELIGLLRAERTGRAL----EEAICYRAVLLGITRASL
RPOC2_RANMC      ------------EDGMSNVFSPGELIGLLRAERTGRAL----EEAICYRAVLLGITRASL
RPOC2_SOLBU      ------------EDGMSNVFSPGELIGLLRAERMGRAL----EEAICYRVVLLGITRASL
RPOC2_SOLTU      ------------EDGMSNVFSPGELIGLLRAERMGRAL----EEAICYRVVLLGITRASL
RPOC2_SOLLC      ------------EDGMSNVFSPGELIGLLRAERMGRAL----EEAICYRVVLLGITRASL
RPOC2_ATRBE      ------------EDGMSNVFSPGELIGLLRAERMGRAL----EEAICYRVVLLGITRASL
RPOC2_NICSY      ------------EDGMSNVFSPGELIGLLRAERMGRAL----EEAICYRVVLLGITRASL
RPOC2_TOBAC      ------------EDGMSNVFSPGELIGLLRAERMGRAL----EEAICYRVVLLGITRASL
RPOC2_NICTO      ------------EDGMSNVFSPGELIGLLRAERMGRAL----EEAICYRVVLLGITRASL
RPOC2_COFAR      ------------EDGMSNVFSPGELIGLLRAERMGRAL----EEAICYRAVLLGITRASL
RPOC2_JASNU      ------------EDGMSNVFSPGELIGLLRAERMGRAL----EEAVYYRAILLGITRASL
RPOC2_CUSEX      ------------EDGMSNVFSPGELIGLLRAERTGRAL----EEPIHYRSVFLGITKASL
RPOC2_CUSRE      ------------EDGMSNVFLPGELIGLLRAERMGRAL----EEPIHYRSVFLGITKASL
RPOC2_IPOPU      ------------EDGMSNVFSPGELIRLLRAKRMGRAL----EEAICYRALLLGITKASL
RPOC2_DAUCA      ------------EDGMSNVFLPGELIGLLRAERMGRAL----EEAICYRAVLLGITKASL
RPOC2_PANGI      ------------EDGMSNVFLPGEFIGLLRAERMGRAL----EEAICYQAVLLGITKASL
RPOC2_GUIAB      ------------EDEMSNVFSPGELIGLLRAERMGRAL----EEAICYQAVLLGITRASM
RPOC2_HELAN      ------------EDEMSNVFSPGELIGLLRAERMGRAL----EEAICYQAVLLGITRASM
RPOC2_LACSA      ------------EDEMSNVFSPGELIGLLRAERMGRAL----EEAICYQAVLLGITRASM
RPOC2_SILLA      ------------EDGMSNIFLPGELIGLFRAERTGRAL----EEAICYRTILLGITRASL
RPOC2_SPIOL      ------------EDGMSNVFLPGELIGLFRAERTGRAL----EEAICYRATLLGITRASL
RPOC2_FAGEA      ------------EDGMSNVFLPGELIGLLRAERTGRAL----EEVISYRAVLVGITRASL
RPOC2_SOYBN      ------------EDGMSNVFLPGELIGLLRAERAGRSL----EEAICYRVLLLGITKTSL
RPOC2_PHAVU      ------------EDGMSNVFLPGELIGLLRAERAGRSL----EESICYRVLLLGITKTSL
RPOC2_LOTJA      ------------EDGMSNVFSPGELIGLLRAQRTGRAL----EESICYRTLLLGITKTSL
RPOC2_PELHO      ------------EDGMSNLFLPGELIGLLQAERTGRAL----EKGICYRAILVGITKASL
RPOC2_OENAR      ------------EDGMSNVFLPRELIGLLRAERTGRAL----EESICYKAFLLGITRTSL
RPOC2_OENPA      ------------EDGMSNVFLPRELIGLLRAERTGRAL----EESICYKAFLLGITRTSL
RPOC2_OENEH      ------------EDGMSNVFLPRELIGLLRAERTGRAL----EESICYKAFLLGITRTSL
RPOC2_OENGL      ------------EDGMSNVFLPRELIGLLRAERTGRAL----EESICYKAFLLGITRTSL
RPOC2_OENBI      ------------EDGMSNVFLPRELIGLLRAERTGRAL----EESICYKAFLLGITRTSL
RPOC2_EUCGG      ------------EDGMSNVFLPGELIGLLRAARTGRAL----EESICYRAILLGITRASL
RPOC2_AETCO      ------------EEGMSNVFLPGELIGLLRAERTGRAL----EEAISYRAILLGITRASL
RPOC2_AETGR      ------------EEGMSNVFLPGELIGLLRAERTGRAL----EEAICYRAILLGITRASL
RPOC2_ARATH      ------------EEGMSNVFLPGELIGLLRAERTGRAL----EEAICYRAVLLGITRASL
RPOC2_CAPBU      ------------EEGMSNVFLPGELIGLLRAERTGRAL----EEAICYRAVLLGITRASL
RPOC2_CRUWA      ------------EEGMSNVFLPGELIGLLRAERTGRAL----EEAICYRAVLLGITRASL
RPOC2_OLIPU      ------------EEGMSNVFLPGELIGLLRAERTGRAL----EESICYRAVLLGITRASL
RPOC2_BARVE      ------------EEGMSNVFLPGELIGLLRAERTGRAL----EEAICYRAVLLGITRASL
RPOC2_NASOF      ------------EEGMSNVFLPGELIGLLRAERTGRAL----EEAICYRAVLLGITRASL
RPOC2_LEPVR      ------------EEGMSNVFLPGELIGLLRAERTGRAL----EEAICYRAVLLGITRASL
RPOC2_LOBMA      ------------EEGMSNVFLPGELIGLLQAERTGRAL----EEAICYRAILLGITRASL
RPOC2_ARAHI      ------------EEGMSNVFLPGELIGLLRAERTGRAL----EEAICYRAILLGITRASL
RPOC2_DRANE      ------------EEGMSNVFLPGELIGLLRAERTGRAL----EEAICYRAILLGITRASL
RPOC2_SINAL      ------------EEGMSNVFLPGELIGLLRAERTGRAL----EEAICYRAVLLGITRASL
RPOC2_CARPA      ------------EEGMSNVFLPGELIGLLRAERTGRAL----EEAICYRAILLGITRASL
RPOC2_GOSBA      ------------EDGMSNVFLPGELIGLLRAERTGRAL----EEAICYRAVLLGITRASL
RPOC2_GOSHI      ------------EDGMSNVFLPGELIGLLRAERTGRAL----EEAICYRAVLLGITRASL
RPOC2_CITSI      ------------EDGMSNIFLPGELIGLLRAERMGRAL----EEVICYRAILLGITRASL
RPOC2_CUCSA      ------------EDGMSNVFSPGELIGLLRAERTGRAL----EEAICYRAVLLGITKASL
RPOC2_MORIN      ------------EDGMSNVFLPGELIGLFRAERTGRAL----KEAICYQAILLGITKASL
RPOC2_POPAL      ------------EDGMSNVFSPGELIGLLRAERAMRAL----EEAICYRTVFLGITRASL
RPOC2_POPTR      ------------EDGMSNVFSPGELIGLLRAERAMRAL----EEAICYRTVFLGITRASL
RPOC2_MANES      ------------EDGMSNVFSPGELIGLLRAERTGRAL----EEAICYGAILLGITRASL
RPOC2_VITVI      ------------EDGMSNVFSPGELIGLLRAERTGRAF----EEAICYRTILLGITRASL
RPOC2_WELMI      ------------DDVIFNVFLPGELIGLSRAQRIDRAF----DEAIHYKTKLLGITKASF
RPOC2_ADICA      ------------EDGVTNVFLPGELVELSQAERINRVL----KKSIFYEPIVLGMTRASL
RPOC2_CHAGL      ------------EENGPNAFLPGELVDLFKAQRMNQIL----ENSLAYKPILLGITRASL
RPOC2_ACAM1      -------------DGGDTTMLPGELIDLYQVEQVNAAMSITGGAPAEYTPVLLGITKASL
RPOC2_THEEB      -------------DAGDTILLSGELMTLRQAEQANEPMALTGGAPAQYTPVLLGITKASL
RPOC2_NOSS1      -------------DGGDTTMLPGELVELRQVEQVNEAMAITGGARAQYTPVLLGITKASL
RPOC2_TRIV2      -------------DGGDTTMLPGELVELRQVEQVNEAMAITGGARAQYTPVLLGITKASL
RPOC2_NOSP7      -------------DGGDTTMLPGELVELRQVEQVNEAMAITGGARAQYTPVLLGITKASL
RPOC2_SYNE7      -------------DGGDTIMLPGELHELREVYNSNNTMALTGMAPAQFTPVLLGITKASL
RPOC2_SYNP6      -------------DGGDTIMLPGELHELREVYNSNNTMALTGMAPAQFTPVLLGITKASL
RPOC2_TRIEI      -------------DGGDTTMLPGELIELRQVEQVNEAMSITGGATAQYTPMLLGITKASL
RPOC2_CROS5      -------------DGGDTTMLPGELVELRQIEQVNEAMAITGGAPARYTPVLLGITKASL
RPOC2_SYNY3      -------------DGGDTTMLPGELVELRQVEQVNEAMGITGSAPARYTPVLLGITKASL
RPOC2_MICAN      -------------DGGDTSMLPGELLELRQVETVNEAMSITGGAAAKYTPVLLGITKASL
RPOC2_SYNP2      -------------DGGDTTMLPGELIELRQVEQVNEAMSITGGAPARYTPVLLGITKASL
RPOC2_SYNJB      -------------DGGDTILLPGELVELREIQQINATMAITGGAPAKYTPVLLGITKASL
RPOC2_SYNJA      -------------DSGDTVLLPGELVELREIQQTNATMAITGGAPAKYTPVLLGITKASL
RPOC2_GLOVI      -------------DGGDTTFLPGELVELRQIEQVNEAMAVTGGAPADCTPVLLGITKASL
RPOC2_PROMA      -------------DAGDTTLLPGELIEIRQVEDTNQAISITGGAPAEFTPVLLGITKASL
RPOC2_PROM4      -------------DAGDTTLLPGELIEIRQVEDTNQAISVTGGAPAEFTPVLLGITKASL
RPOC2_PROM1      -------------DAGDTTFLPGELIELRQVEDTNQAISITGGAPSEFTPVLLGITKASL
RPOC2_PROMT      -------------DAGDTTFLPGELIELRQVEDTNQAISITGGAPSEFTPVLLGITKASL
RPOC2_PROM3      -------------DAGDTTLLPGELIELRQVEDTNQAMAITGGAPSEFTPVLLGITKASL
RPOC2_PROMM      -------------DAGDTTLLPGELIELRQVEDTNQAMAITGGAPSEFTPVLLGITKASL
RPOC2_SYNS3      -------------DAGDTTLLPGELIELRQVENTNQAMSITGGAPAEFTPVLLGITKASL
RPOC2_SYNPW      -------------DAGDTTLLPGELIELRQVEDTNQAMSITGGAPAEFTPVLLGITKASL
RPOC2_SYNSC      -------------DAGDTTLLPGELIELRQVEDTNQAMAITGGAPAEFTPVLLGITKASL
RPOC2_SYNPX      -------------DAGDTTLLPGELIELRQVEDTNQAMAITGGAPAEFTPVLLGITKASL
RPOC2_SYNS9      -------------DAGDTTLLPGELIELRQVEDTNQAMAITGGAPSEFTPVLLGITKASL
RPOC2_PROMS      -------------DAGDTTLLPGELIELRQVEDTNQAMAITGGAPAEFTPVLLGITKASL
RPOC2_PROM0      -------------DAGDTTLLPGELIELRQVEDTNQAMAITGGAPAEFTPVLLGITKASL
RPOC2_PROM2      -------------DAGDTTLLPGELIELRQVEDTNQAMAITGGAPAEFTPVLLGITKASL
RPOC2_PROM9      -------------DAGDTTLLPGELIELRQVEDTNQAMAITGGAPAEFTPVLLGITKASL
RPOC2_PROM5      -------------DAGDTTLLPGELIELRQVEDTNQAMSITGGAPAEFTPVLLGITKASL
RPOC2_PROMP      -------------DAGDTTLLPGELIELRQVEDTNQAMSITGGAPAEFTPVLLGITKASL
RPOC2_SYNR3      -------------DAGDTTLLPGELIELRQVDQVNQAMAITGGAPAEFTPVLLGITKASL
RPOC2_PAUCH      -------------DAGETTLLPGELIELRHVEKVNKAMFMTSSSPAVFIPELLGITKASL
RPOC2_GUITH      -------------DGGDTTLLPGELVELQQIENINEAMMLTKGVPATYCPILLGITKASL
RPOC2_RHDSA      -------------DGGDTTLLPGELVELQQIENINEAMTLTKGLPARYSPVLLGITKSSL
RPOC2_PORPU      -------------NGEETGYLPGELVELQKIEQTNKSMTSRNKLNASYRPILLGITQASL
RPOC2_PYRYE      -------------NGEETGYLPGELVELQKIEQTNKAITLRNKINASYRPVLLGITQASL
RPOC2_GRATL      -------------NGGDTDHLPGEIIELQKIEMLNKALRLASKEEALYYPILLGITKASL
RPOC2_CYAPA      -------------EGGDTTLLPNELIEFQQIEKMNEKFSTSNGQLASYTPILLGITKSSL
RPOC2_CYACA      -------------ERGDTTLFPGELVTINQIEKINSAIIAVNKKEAKYKPVLLGITKASL
RPOC2_EMIHU      -------------DSGTTTFLPGEVLNFQKMADIALVAENKGEIPPSYVPLLLGITKASL
RPOC2_PHATC      -------------YEGNTPLLRREVIDLYHIQYINQIIQSQGKQSACYVPLLLGITKAAL
RPOC2_THAPS      -------------HEGHTPLLPREVVDLYHIQYINKIIEAHNKRPAYYVPLLLGITKAAL
RPOC2_TRICV      -------------HQGNTSLLPREVIDLYHIEYINKIARIHKKHPALYVPLLLGITKAAL
RPOC2_CHLVU      -------------FGKDTSLLPGEFIQLRLLEEINRSLVEAKKEPALYEPVILGLTKSVL
RPOC2_OSTTA      -------------DAGKTGLLPGDIVDIRRIEQLEHTGFFAGVK---YRPMLLGITRAAL
RPOC2_BIGNA      -------------NGGETGLLEGEFINFQKLEKINTNLYHRRVV---YEPLVLGITKVSL
RPOC2_CHLAT      -------------EGGDTTLLPGELIELHRIENINKNV----SIHAQYKPVVLGITKASL
RPOC2_MESVI      -------------EGGDTTLLPGELIELHRIENMNRNV----SVHAKYKPIVLGITKASL
RPOC2_NEPOL      -------------KAYGTGILPGEIIEKRRADMLNQG-----RTRIRYCPIVLGITKASL
                                        :.                          . * *.  :

RPOC2_STAPU      NANSFLSEASFERTITVLSRSALQGRMDWLKGLKENVLLSKMIPAGTGLKQAPVLLSPNG
RPOC2_ZYGCR      NTNSFISEASFQQTARVLSKSAIKNRVDWIRGLQENVLFGRMIPAGTGCREISSQLQYG-
RPOC2_CHAVU      NTRSFISEASFQETTRVLTKAAIKGRTDWLKGLKENVILGRLIPAGTGSEEIILQRLMN-
RPOC2_ANEMR      STRSFISEASFQETTRVLARAALKGRIDWLRGLKENVIVGEIIPAGTGS-EEVIWQ----
RPOC2_MARPO      NTQSFISEASFQETTRVLAKAALKGRIDWLKGLKENVILGGLVPAGTGS-QEVIWQ----
RPOC2_PHYPA      NTQSFISEASFQETTRVLAKAALRGRIDWLKGLKENVILGGIIPTGTGC-EEVLWQ----
RPOC2_ANTAG      NTQSFISEASFQETTRVLAKAALRGRIDWLKGLKENVIFGGVISAGTGC-QEVVWQ----
RPOC2_ANGEV      NTTSFISEASFQETTRVLARAALQGRIDWLKGLKENVVPGSVVPTGTGS-REVICQ----
RPOC2_PSINU      NTTSFLSEASFQETTRVLARAAIRGRIDWLKGLKENVIIGGIVPTGTGS-REVTCQ----
RPOC2_PINKO      NTQSFISEASFQETARVLAKAALQGRIDWLKGLKENVILGGMIPAGTG------QH----
RPOC2_PINTH      NTQSFISEASFQETARVLAKAALQGRIDWLKGLKENVILGGMIPAGTG------QH----
RPOC2_CYCTA      DTQSFISEAGFQETARVLARAALQGRIDWLKGLKENVILGGIVPAGTGF----KQS----
RPOC2_CRYJA      NTQSFLSEASFQETAQVLAKSALQGRIDWLKGLKENVILGGMIPVGTG------------
RPOC2_AGRST      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGIIPVGTGF-LKFVH-----
RPOC2_LOLPR      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGIIPVGTGF-QKFVH-----
RPOC2_HORVU      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGIIPVGTGF-QKFVH-----
RPOC2_WHEAT      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGIIPVGTGF-QKFVH-----
RPOC2_SACHY      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGIIPVGTGF-QKFVH-----
RPOC2_SACOF      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGIIPVGTGF-QKFVH-----
RPOC2_SORBI      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGIIPVGTGF-QKFVH-----
RPOC2_MAIZE      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGIIPVGTGF-QKFVH-----
RPOC2_ORYNI      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGIIPVGTGF-QKFVH-----
RPOC2_ORYSI      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGIIPVGTGF-QKFVH-----
RPOC2_ORYSA      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGIIPVGTGF-QKFVH-----
RPOC2_ORYSJ      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGIIPVGTGF-QKFVH-----
RPOC2_DIOEL      NTQSFISEASFQETTRVLAKAALRGRIDWLKGLKENVVLGGIIPVGTGF-QKLVH-----
RPOC2_PHAAO      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGIIPVGTGF-NKLVH-----
RPOC2_LEMMI      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGIIPVGTGF-KKLVH-----
RPOC2_ACOCL      NTQSFISEASFQETARVLAKAALRGRVDWLKGLKENVVLGAMIPVGTGF-KALVH-----
RPOC2_AMBTC      NTQSFISEASFQETTRVLAKAALRSRIDWLKGLKENVVLGGMIPVGTGF-KGFVH-----
RPOC2_NYMAL      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPVGTGF-KRFVH-----
RPOC2_ILLOL      NTQSFISEASFQETTRVLAKAALRGRIDWLKGLKENVVLGGMIPVGTGF-KGLVH-----
RPOC2_CALFG      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMMPVGTGF-KGLVR-----
RPOC2_LIRTU      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPVGTGF-KGLVH-----
RPOC2_DRIGR      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPVGTGF-KGLVH-----
RPOC2_CHLSC      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPVGTGF-KGLVH-----
RPOC2_CERDE      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPVGTGF-KGLVH-----
RPOC2_PIPCE      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPVGTGF-KGFVR-----
RPOC2_BUXMI      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGLIPVGTGF-KVLVHR----
RPOC2_PLAOC      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPVGTGF-KGLVHR----
RPOC2_NANDO      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPVGTGF-KGLVHR----
RPOC2_RANMC      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPVGTGF-KGLVHR----
RPOC2_SOLBU      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGVIPVGTGF-KGLVH-----
RPOC2_SOLTU      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGVIPVGTGF-KGLVH-----
RPOC2_SOLLC      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGVIPVGTGF-KGLVH-----
RPOC2_ATRBE      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGVIPVGTGF-KGLVH-----
RPOC2_NICSY      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGVIPVGTGF-KGLVH-----
RPOC2_TOBAC      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGVIPVGTGF-KGLVH-----
RPOC2_NICTO      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGVIPVGTGF-KGLVH-----
RPOC2_COFAR      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPVGTGF-KGLVK-----
RPOC2_JASNU      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPLGTGF-KGLVP-----
RPOC2_CUSEX      NTQSFISEASFQETARVLSKAALGGRIDWLKGLKENVVLGGVIPAGTGF-RGLVD-----
RPOC2_CUSRE      NTQSFISEASFQETARVLSKAALGGRIDWLKGLKENVVLGGVIPAGTGF-RGLVD-----
RPOC2_IPOPU      NTQSFISEASFQETARVLAKAALQGRIDWLKGLKENVVLGGVIPAGTGF-RGLVH-----
RPOC2_DAUCA      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPVGTGF-EGLVH-----
RPOC2_PANGI      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPVGTGF-KGLVP-----
RPOC2_GUIAB      NTQSFISEASFQETARVLAKAALLGRIDWLKGLKENVVLGGMIPVGSGF-KTPSSE----
RPOC2_HELAN      NTQSFISEASFQETARVLAKAALLGRIDWLKGLKENVVLGGMIPVGSGF-KTPSSE----
RPOC2_LACSA      NTQSFISEASFQETARVLAKAALLGRIDWLKGLKENVVLGGMIPVGSGF-KTPSSE----
RPOC2_SILLA      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPVGTGF-KGFVH-----
RPOC2_SPIOL      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPVGTGF-KGFVH-----
RPOC2_FAGEA      NTHSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGKIPVGTGF-KGLVH-----
RPOC2_SOYBN      NTQSFISEASFQETARVLSKAALRGRIDWLKGLKENVVLGGMIPVGTGF-KRIMN-----
RPOC2_PHAVU      NTQSFISEASFQETARVLSKAALRGRIDWLKGLKENVVLGGMMPVGTGF-KRIIY-----
RPOC2_LOTJA      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENLVLGGIIPVGTGF-KKIGD-----
RPOC2_PELHO      NTQSFISEASFQQTARVLAKAALRGRIDWLKGLKENVVLGGMSPAGTGF-RGLVH-----
RPOC2_OENAR      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVIGGMIPVGTGF-KGLVH-----
RPOC2_OENPA      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVIGGMIPVGTGF-KGLVH-----
RPOC2_OENEH      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVIGGMIPVGTGF-KGLVH-----
RPOC2_OENGL      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVIGGMIPVGTGF-KGLVH-----
RPOC2_OENBI      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVIGGMIPVGTGF-KGLVH-----
RPOC2_EUCGG      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVIGGMIPVGTGF-KGLVH-----
RPOC2_AETCO      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGGIPAGTGFNKGLVH-----
RPOC2_AETGR      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGGIPAGTGFNKGLVH-----
RPOC2_ARATH      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGVIPAGTGFNKGLVH-----
RPOC2_CAPBU      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGVIPAGTGFNKGLVH-----
RPOC2_CRUWA      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGVIPAGTGFNKGLVH-----
RPOC2_OLIPU      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGVIPAGTGFNKGLVH-----
RPOC2_BARVE      NTQSFISEASFQETSRVLAKAALRGRIDWLKGLKENVVLGGVIPAGTGFNKGLVH-----
RPOC2_NASOF      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGVIPAGTGFNKGLVH-----
RPOC2_LEPVR      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGVIPAGTGFNKGLVH-----
RPOC2_LOBMA      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGVIPAGTGFNKGLVH-----
RPOC2_ARAHI      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPAGTGFNKGLVH-----
RPOC2_DRANE      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPAGTGFNKGLVH-----
RPOC2_SINAL      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGVIPPGPGSQRIGAL-----
RPOC2_CARPA      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPAGTGF-KGLVH-----
RPOC2_GOSBA      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPAGTGF-KGLVH-----
RPOC2_GOSHI      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPAGTGF-KGLVH-----
RPOC2_CITSI      NTQSFISEASFQETTRVLAKAALRGRIDWLKGLKENVVLGGIIPVGTGF-KGLVH-----
RPOC2_CUCSA      NTQSFISEASFQETARVLAKAALRGRIDWLRGLKENVVLGGMIPVGTGF-RELAH-----
RPOC2_MORIN      NTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPVGTGF-KGLVH-----
RPOC2_POPAL      STQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPVGTGF-KGLAH-----
RPOC2_POPTR      STQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGMIPVGTGF-KGLAH-----
RPOC2_MANES      NTQSFISEASFQETTRVLAKAALRGRIDWLKGLKENVVLGGMIPVGTGF-KGLVQ-----
RPOC2_VITVI      NTQSFISEASFQETARVLAKAALWGRIDWLKGLKENVVLGGMIPVGTGF-KGLVH-----
RPOC2_WELMI      DTPSFISEASFQETARVLAKAAIQGRIDWLKGLKENVILSNIIPAGTGKKTNYSLF----
RPOC2_ADICA      STTSFLAEASFQETTRVLAKAALRGRIDWLKGLKENVVIGDSVPVGTGS-PEIYCQ----
RPOC2_CHAGL      NTYSFISEASFQETTKVLTKAALQGRIDWLQGLKENVILGGIIPAGTGYQKILNKKNSN-
RPOC2_ACAM1      NTDSFISAASFQETTRVLTEAAIQGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_THEEB      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_NOSS1      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_TRIV2      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_NOSP7      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_SYNE7      NTNSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_SYNP6      NTNSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_TRIEI      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_CROS5      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_SYNY3      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_MICAN      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_SYNP2      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_SYNJB      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_SYNJA      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_GLOVI      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_PROMA      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_PROM4      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_PROM1      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_PROMT      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_PROM3      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_PROMM      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_SYNS3      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_SYNPW      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_SYNSC      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_SYNPX      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_SYNS9      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_PROMS      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_PROM0      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_PROM2      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_PROM9      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_PROM5      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_PROMP      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_SYNR3      NTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTG------------
RPOC2_PAUCH      NTDSFISAASFQETTRVLTEAAIEGKTDYLRGLKENVIIGRLIPAGTG------------
RPOC2_GUITH      NTDSFISAASFQETTRVLTEAAIEGKADWLRGLKENVIIGRLIPAGTG------------
RPOC2_RHDSA      NTDSFISAASFQETTRVLTEAAIEGKADWLRGLKENVIIGRLIPAGTG------------
RPOC2_PORPU      NTESFISAASFQETTKVLTEAAISGKLDWLRGLKENVIIGRLIPAGTG------------
RPOC2_PYRYE      NTESFISAASFQETTKVLTEAAISGKLDWLRGLKENVIIGRLIPAGTG------------
RPOC2_GRATL      NTESFISAASFQETTKVLTDAAISCKLDWLRGLKENVIIGRLIPAGTG------------
RPOC2_CYAPA      NTQSFISAASFQETTRVLAKAAVEGKIDQLRGLKENVIIGNLIPAGTG------------
RPOC2_CYACA      NTDSFISAASFQETTRILTEAAIEGKVDWLKGLKENVIIGRLIPGGTG------------
RPOC2_EMIHU      NSDSFISAASFQETTRVLTEAAIEGRKDWLTGLKENVIIGRLIPAGTG------------
RPOC2_PHATC      NNPSFISAASFQETTRVLTKAAIEGRIDWLRGLKENIIIGHLIPAGTG------------
RPOC2_THAPS      NNPSFISAASFQETTRVLTKAAIEGRVDWLRGLKENIIIGHLIPSGTG------------
RPOC2_TRICV      NNPSFISAASFQETTRVLTKAAIEGRVDWLRGLKENIIIGHLMPAGTG------------
RPOC2_CHLVU      QSESFLLAASFQQVSKVLVRSALATKTDFLRGLMKPLYVASLSQREQE------------
RPOC2_OSTTA      MAESFISAASFQETKRVLSKAALEGQIDWLTGLKENVILGRLIPAGTG------------
RPOC2_BIGNA      RTESFISSASFQETTKVLSQAALEKRIDFLNGLKENVILGKLIPGGTG------------
RPOC2_CHLAT      NTESFISAASFQETTRVLTKAAIEGKTDWLKGLKENVIIGRLIPAGTG------------
RPOC2_MESVI      NTESFISAASFQETTRVLTKAAIEGKTDWLRGLKENVIIGRLIPAGTG------------
RPOC2_NEPOL      TTKGFISSASFQETTRVLTQAVLQGKSDWLLGLKENVILGRLIPAGVGIYGHWVGPHEFN
                    .*:  *.*:..  :*  :.:  : * : ** : :  .                    

RPOC2_STAPU      TGTLFSNNEQNIFQKKN-----VTSLSKSKGQKVQIRKIFSFQKSPQRLSFLYQETSSSN
RPOC2_ZYGCR      ----------NIFQKK----------WAQHTKWKLFVNSFGLNLSCLQIYLHFQAYCLES
RPOC2_CHAVU      ---------------------------LQKIEKLRKGKSKKYTTSKLDSLLFSKCKSAFL
RPOC2_ANEMR      ----------------------RTLEREED-IFLS-NREFCFGENIEN--PFWHSDTFFV
RPOC2_MARPO      ----------------------ITLEKKKE-IYLK-KKKEFFTKKINN--VFLYQDTFSI
RPOC2_PHYPA      ----------------------ITLEKQKN-ILLKKNKSKLFHNKVKD--IFLYKKLSIS
RPOC2_ANTAG      ----------------------VILEKRKE-TYSKRKKNKLFSGRVRD--VFSYYQRILF
RPOC2_ANGEV      ----------------------IDIEKRKELGLLKTKNNKIFIRKIRD--IFFYHEKVSI
RPOC2_PSINU      ----------------------MDLEKHKKGSNLKIKNTHSFSCEIKD--LLFNHGKVSL
RPOC2_PINKO      ----------------------IHRSGKRNGIDPRIGNRNLFSNKVKD--ILFHHDKVSF
RPOC2_PINTH      ----------------------IHRSGKRNGIDPRIGNRNLFSNKVKD--ILFHHDKVDF
RPOC2_CYCTA      ----------------------IYHSGERNEIDPRTGK----------------------
RPOC2_CRYJA      ----------------------FNRLVKRSKMNSRTSQKSLFINKVED--FFFEHQDQAL
RPOC2_AGRST      ----------------------RSPQDKNLYFEIQKQN--LFASEMRD--FLFLHTELVS
RPOC2_LOLPR      ----------------------RSPQDKNLYFEIQKQN--LFASEMRD--FLFLHTELVS
RPOC2_HORVU      ----------------------RSPQDKNLYFEIKKKN--LFASEMRD--FLFLHTELVS
RPOC2_WHEAT      ----------------------RSPQDKNLYFEIKKKN--LFASEMRD--FLFLHTELVS
RPOC2_SACHY      ----------------------RSPQDKNLYFEIQKKN--LFASEMRD--ILFLHTELVS
RPOC2_SACOF      ----------------------RSPQDKNLYFEIQKKN--LFASEMRD--ILFLHTELVS
RPOC2_SORBI      ----------------------RSPQDKNLYFEIKKKN--LFASEMRD--ILFLHTELVS
RPOC2_MAIZE      ----------------------RSPQDKNLYLEIQKKN--LFASEMRD--ILFLHTELVS
RPOC2_ORYNI      ----------------------RYPQDKNLYFEIQKKK--LFASEMRD--ILFLHTELVS
RPOC2_ORYSI      ----------------------RYPQDKNLYFEIQKKK--LFASEMRD--ILFLHTELVS
RPOC2_ORYSA      ----------------------RYPQNKNLYFEIQKKK--LFASEMRD--ILFLHTELVS
RPOC2_ORYSJ      ----------------------RYPQNKNLYFEIQKKK--LFASEMRD--ILFLHTELVS
RPOC2_DIOEL      ----------------------RSRQDKNIHLEIKKNNL--FDLEM--RDILLHHR--EL
RPOC2_PHAAO      ----------------------RSKQDKNIHLKIKRKNL--FELEM--SDILLHHR--EL
RPOC2_LEMMI      ----------------------HSRQHKNIHLEIKNKNL--FEGKM--RDILFHHR--EF
RPOC2_ACOCL      ----------------------RSRKPNNIHLEIKKNNL--FEGQVG-DDILFYHR--EL
RPOC2_AMBTC      ----------------------HSREHNNISLEIKKKNL--FDGKM--RDILFYHR--EF
RPOC2_NYMAL      ----------------------RSREYNNIPLEIQKKNF--FGGEM--RDILFHHR--EL
RPOC2_ILLOL      ----------------------HSREHNNIPFEIQKKSR--FEGEM--RDILFPHR--EL
RPOC2_CALFG      ----------------------RSRQHNNIPLEIKKKNL--FEGEM--RDILFHHR--EL
RPOC2_LIRTU      ----------------------RSRQHNNIPLEIKKKNL--FEGEM--RDILFHHR--EL
RPOC2_DRIGR      ----------------------RSRQDNNIPLEIKKKNL--FEGEI--RDILFHHR--EL
RPOC2_CHLSC      ----------------------RSRQHNNSPLEIKKKNL--FEGEM--RDILFHHR--EL
RPOC2_CERDE      ----------------------HSRQHNNIPLEIKKRNLFEFEGEM--GDILFHHR--QS
RPOC2_PIPCE      ----------------------RSRQHNNISLEKKRNNL--VKGEI--GNILFHHR--EL
RPOC2_BUXMI      ----------------------SRQHNNIP---LETKKKNIFEGEMRD--ILFHHRKFKL
RPOC2_PLAOC      ----------------------SREHNNIP---LEIKKKNLFEGEMRD--TLFHHR--EL
RPOC2_NANDO      ----------------------SSQHSNIS---LEIQNTNLFEGGMRD--ILFHHR--EL
RPOC2_RANMC      -------------------------LSNIS---LEIEKKNLFKGGMRD--ILFHHK--EL
RPOC2_SOLBU      ----------------------PSKQHNN--IPLETKKTNLFEGEMRD--ILFHHR--KL
RPOC2_SOLTU      ----------------------PSKQHNN--IPLETKKTNLFEGEMRD--ILFHHR--KL
RPOC2_SOLLC      ----------------------PSKQHNN--IPLETKKTNLFEGEMRD--ILFHHR--KL
RPOC2_ATRBE      ----------------------PSKQHNN--IPLETKKKNLFEGEMRD--ILFHHR--KL
RPOC2_NICSY      ----------------------PSKQHNN--IPLETKKKNLFEGEMRD--ILFHHK--KL
RPOC2_TOBAC      ----------------------PSKQHNN--IPLETKKKNLFEGEMRD--ILFHHK--KL
RPOC2_NICTO      ----------------------PSKQHNN--IPLETKKKNLFEGEMRD--ILFHHR--KL
RPOC2_COFAR      ----------------------PSKQHNK--ALLETKKKNLFEGEMRD--ILFHHR--NF
RPOC2_JASNU      ----------------------PSKQDNN--SSLETKKKNLFEGEMRD--IFFHHR--KL
RPOC2_CUSEX      ----------------------PSKQYK-----TIPLKTNLFEGGMRD--LLVHHR--KL
RPOC2_CUSRE      ----------------------PSKQYNK---NNIPLKNNLFEGGMTD--LLVHHR--KL
RPOC2_IPOPU      ----------------------PSKQYNN--LSLETTKKNLFEGGVRD--ILSHHR--KL
RPOC2_DAUCA      ----------------------SSRQHTN--LSLETKNNNIFEGEMRD--ILFHHR--KF
RPOC2_PANGI      ----------------------PSRQHKN--IPLETKNKNLFEGEMRD--ILFHHR--KF
RPOC2_GUIAB      ----------------------PNNIPNN--IAFELKKENLLEGEMKD--ILFYHR--KF
RPOC2_HELAN      ----------------------PNNIPNN--IAFELKKKNLLEGEMKD--ILFYHR--K-
RPOC2_LACSA      ----------------------PNNIPNN--IAFELQKKNLLEGEMKD--ILFYHR--KL
RPOC2_SILLA      ----------------------RSNQHKSISIPLKIKNKNRLEGEMRD--ILFYHR--EL
RPOC2_SPIOL      ----------------------HSSQHKD--IPLKTKKQNLFEGEMGD--ILFYHR--EL
RPOC2_FAGEA      ----------------------PSSQHKS--IPLKNKKKNLFEGEIND--ILFYYR--EF
RPOC2_SOYBN      ----------------------RSKQRQYNKMTSETKKKNLFEGEMRD--ILFHHR--EF
RPOC2_PHAVU      ----------------------RSKQRQYNKITSETKKR-------ID--MIYQSN--LG
RPOC2_LOTJA      ----------------------RSSARQDTKITLETIKI------------IRGRN----
RPOC2_PELHO      ----------------------PSS-KKYKTLSLETQRKILFDGKVRD--LLFHHK--RI
RPOC2_OENAR      ----------------------CSKQHKSIP-----KNKHFFEGEIRD--ILFHHR--EL
RPOC2_OENPA      ----------------------CSKQHKSIP-----KNKHFFEGEIRD--ILFHHR--EL
RPOC2_OENEH      ----------------------CSKQHKSIP-----KNKHFFEGEIRD--ILFHHR--EL
RPOC2_OENGL      ----------------------CSKQHKSIP-----KNKHFFEGEIRD--ILFHHR--EL
RPOC2_OENBI      ----------------------CSKQHKSIP-----KNKHFFEGEIRD--ILFHHR--EL
RPOC2_EUCGG      ----------------------RSRQHKNIPL--KTKKKNFFEGEIGD--ILFHHR--EL
RPOC2_AETCO      ----------------------CSRQHTNILLEKKTKNFCLFEEDMRD--ILFYHR--EF
RPOC2_AETGR      ----------------------CSRQHTNILLEKKTKNLCLFEEDMRD--ILFYHR--EF
RPOC2_ARATH      ----------------------CSRQHTNIILEKKTKNLALFEGDMRD--ILFYHR--EF
RPOC2_CAPBU      ----------------------CSRQHTNILLEKKTKNLALFEGDMRD--ILFYHR--EF
RPOC2_CRUWA      ----------------------CSRQHTNILLEKKTKNFSLFEGDMRD--ILFYHR--EF
RPOC2_OLIPU      ----------------------CSRQHTNILLEKKTKNLSLFEGDMRD--ILFYHR--EF
RPOC2_BARVE      ----------------------CSRQYTNILLEKKKKNLSLFEGDMRD--ILFYHR--EF
RPOC2_NASOF      ----------------------CSRQHTNILLEKKTKNLSLFERDMRD--ILFYHR--EF
RPOC2_LEPVR      ----------------------CSRQHTNILLEKKTKNLSLFEGDMRD--ILFYHR--EF
RPOC2_LOBMA      ----------------------CSRQHTNILLEKKTKNFSLFEGNMRD--ILFYHR--EF
RPOC2_ARAHI      ----------------------CSRQHTNTLLEKKTKNLSLFEGDMRD--ILFYHR--EF
RPOC2_DRANE      ----------------------CSRQHTNTLLEKRTKNLSLFEGDMKD--ILFYHR--EF
RPOC2_SINAL      ----------------------STATYQHSFGKNKN---YLIRGRYER--YFILPQ--GI
RPOC2_CARPA      ----------------------CSRQHTSILLETKKKNLYLFEGEMRD--IFFHHR--EL
RPOC2_GOSBA      ----------------------RSRQHNNILLETKKKN--FFGGEMRD--IFFHHR--EL
RPOC2_GOSHI      ----------------------RSRQHNNILLETKKKN--FFGGEMRD--IFFHHR--EL
RPOC2_CITSI      ----------------------CSRQHNNILLERQKGN--LFGGEMRD--IFLHHR--EL
RPOC2_CUCSA      ----------------------RSRQHNNIPLETPPK--KIFEGEMRD--ILFHHK--EL
RPOC2_MORIN      ----------------------RSKQHNNIPLETKKK--NLFECEMRD--ILFHHK--EL
RPOC2_POPAL      ----------------------RSSQHKIIPFKIKKK--NLFAGEMRD--ILFHHR--EL
RPOC2_POPTR      ----------------------RSSQHKIIPFKTKKK--NLFEGEMRD--ILFHHR--EL
RPOC2_MANES      ----------------------GSRQHKNIPLKTKKK--NLFEGEFRDRDILFHHR--EL
RPOC2_VITVI      ----------------------RSRQHNNIPLEMETKKNNLFEREMRD--ILFHHR--EL
RPOC2_WELMI      ----------------------ARRRRRKQNTKTRKNNLFSLNEK---------------
RPOC2_ADICA      ----------------------LNINKEKESRLASGGSKKLTKWETGSSLSGYHKK--RD
RPOC2_CHAGL      ----------------------FLENKKEVSIFVQKQKNIKFNILPSNTEVNKKESIQNL
RPOC2_ACAM1      -----------------------FNSYDD--GGLGEPDPSFEGMPFTDDDD---------
RPOC2_THEEB      -----------------------FNSYEE--SSNGDEEWEEGEDRLGQTHV---------
RPOC2_NOSS1      -----------------------YNTYDE--PGMLEDYSTLETTSVLDE-----------
RPOC2_TRIV2      -----------------------YNTYDE--PGMLEDYSTLETTSVLDE-----------
RPOC2_NOSP7      -----------------------YNTYEE--PGAIDDYAAEISSSVLDE-----------
RPOC2_SYNE7      -----------------------FKAYEE--SLLTDVDGGYEDRVYDDD-----------
RPOC2_SYNP6      -----------------------FKAYEE--SLLTDVDGGYEDRVYDDD-----------
RPOC2_TRIEI      -----------------------FNAYED--ALSAEINRLEQNWDDDLDIF---------
RPOC2_CROS5      -----------------------FNAHEEMVMGTLDNGEDSLNNRYGQGERDNNNSDKKP
RPOC2_SYNY3      -----------------------FSSHEE-VLGLIETQDD--IQGYMIEPIELPTTKKKA
RPOC2_MICAN      -----------------------FNSHEN-TAGISDYTPPEEEYNYNNRSYYAPPGGLGL
RPOC2_SYNP2      -----------------------FASQND----FVDEGTSRSPNGYSNVVTNDNG-----
RPOC2_SYNJB      -----------------------FTTYEE-------IAAEPEPDEEEEE-----------
RPOC2_SYNJA      -----------------------FSTYEE-------MAPEPEP-EEEEE-----------
RPOC2_GLOVI      -----------------------FNAYEE-------AEEVIEDDELIDD-----------
RPOC2_PROMA      -----------------------FSGFVEELRAEAGPHPDILAEDPAGYRRIQNLRPDYT
RPOC2_PROM4      -----------------------FSGFVEELRAEAGPHPDILAEDPAGYRRMQNLRPDYT
RPOC2_PROM1      -----------------------FSGFVEELNAEAGPHPDILAEDPAGYRRIQNLRPDYT
RPOC2_PROMT      -----------------------FSGFVEELNAEAGPHPDILAEDPAGYRRIQNLRPDYT
RPOC2_PROM3      -----------------------FSGFQEELRAEAGPHPDILAEDPAGYRRMQNLRPDYT
RPOC2_PROMM      -----------------------FSGFQEELRAEAGPHPDILAEDPAGYRRMQNLRPDYT
RPOC2_SYNS3      -----------------------FSGFEEELRAEAGPHPDILSEDPAGYRRMQNLRPDYT
RPOC2_SYNPW      -----------------------FSGFEEELKAEAGPHPDILAEDPAGYRRMQNLRPDYT
RPOC2_SYNSC      -----------------------FSGFEEELQKEAGPHPDILSEDPAGYRRMQNLRPDYT
RPOC2_SYNPX      -----------------------FSGFEEELQKEAGPHPDILSEDPAGYRRMQNLRPDYT
RPOC2_SYNS9      -----------------------FSGFEEELQKEAGPHPDILSEDPAGYRRMQNLRPDYT
RPOC2_PROMS      -----------------------FSGFVEELSSEAGPHPDILAEESGGYRRAQNLRPDYT
RPOC2_PROM0      -----------------------FSGFVEELSSEAGPHPDILAEESGGYRRAQNLRPDYT
RPOC2_PROM2      -----------------------FSGFVEELSSEAGPHPDILAEESGGYRRAQNLRPDYT
RPOC2_PROM9      -----------------------FSGFVEELASEAGPHPDILAEESGGYRRAQNLRPDYT
RPOC2_PROM5      -----------------------FSGFVEELASEAGPHPDILAEESGGYRRAQNLRPDYT
RPOC2_PROMP      -----------------------FSGFVEELASEAGPHPDILAEESGGYRRTQNLRPDYT
RPOC2_SYNR3      -----------------------FSGFDEQLKAEALPHPDILGEENAGYRRATNLRPDYT
RPOC2_PAUCH      -----------------------FSGFEEELRSEAGPHPDILDEDPAGYRRMQNLRPDYT
RPOC2_GUITH      -----------------------FNAYNEQHKSSKSMKLTGIPDTYYLS-SSLE------
RPOC2_RHDSA      -----------------------FNSYNDISKSFVLEKKNQMPDSYEQN-QNEEQ-----
RPOC2_PORPU      -----------------------FNMYDSHNDVAN-KKDINKNISTDNSPPSVRD-----
RPOC2_PYRYE      -----------------------FNMYDNCNGSSLEKKNLTANTNDESTISSVRD-----
RPOC2_GRATL      -----------------------FNIYNNMQLNYQDEKYSYTKNLLSLPQNTKNL-----
RPOC2_CYAPA      -----------------------FSAYND--------NAVFQNEDIESI-----------
RPOC2_CYACA      -----------------------LISLDNKDSIKMRLALRHKKNFLNKT-----------
RPOC2_EMIHU      -----------------------FNYLENQERLAREKGEIDATFHREAK-----------
RPOC2_PHATC      -----------------------SQNYRNCFKKESLVRSKLPKSFDTILTR---------
RPOC2_THAPS      -----------------------YQSYSNCFNQ--LAQSKTKINLEKIKIKI--------
RPOC2_TRICV      -----------------------SPVYTNCFKK----------SFENNLN----------
RPOC2_CHLVU      -----------------------L------------------------------------
RPOC2_OSTTA      -----------------------LY-----------------------------------
RPOC2_BIGNA      -----------------------LIVKIITNKI---------------------------
RPOC2_CHLAT      -----------------------FNEHERISSNMSNIYN--DLGYVINP-----------
RPOC2_MESVI      -----------------------FNVHDKMYSRDLSLSNSYNLAYSSNS-----------
RPOC2_NEPOL      IKQMLKLWVLPPIITGQSTMRAMFHSTTRYWQDLEAVMESPNKLYPVTPYKCYPDTQHLA
                                                                             

RPOC2_STAPU      IRRKIQPTVCLCKPFITKRNWLHISLKQLTEQSLNYETKKFCLQELTNNFIPRKKENIFY
RPOC2_ZYGCR      TNEQPQSNLHVHNSRIFPFTTICSILKS--------------------------------
RPOC2_CHAVU      KRHPLNPYCRETFHFILKQQITNSF-----------------------------------
RPOC2_ANEMR      FPTMETVRNILRESASANGRNI--------------------------------------
RPOC2_MARPO      FPTTEIIHNVLKESISQNNKNNFSI-----------------------------------
RPOC2_PHYPA      FTSEKIHKNY--------------------------------------------------
RPOC2_ANTAG      FPTMKIIHKTLKKPLSEINLDPNYRK----------------------------------
RPOC2_ANGEV      SKNPKYIHMRLKKPVLKEINI---------------------------------------
RPOC2_PSINU      TFKRSNIHRELKKPLSENDSD---------------------------------------
RPOC2_PINKO      FSIQEN---YHNILKQPLKES---------------------------------------
RPOC2_PINTH      FSFQDNSYKYHNILKQQLK-----------------------------------------
RPOC2_CYCTA      ------------------------------------------------------------
RPOC2_CRYJA      ILSLKQKETSKNKKETSKNKKETSKNKKETSKNKKETSKNKKETSKNKKEASKNKK----
RPOC2_AGRST      SDSDVANNFYE------TSEPPFTPIYTI-------------------------------
RPOC2_LOLPR      SDSDITNNFYE------TLEPPFTPIYTS-------------------------------
RPOC2_HORVU      SDSDVTNNFYE------T------------------------------------------
RPOC2_WHEAT      SDSDVTNNFYE------T------------------------------------------
RPOC2_SACHY      SDSDVTNNFYE------TSETPFTPIYTI-------------------------------
RPOC2_SACOF      SDSDVTNNFYE------TSETPFTPIYTI-------------------------------
RPOC2_SORBI      SDSDVTNNFYE------TSETPFTPIYTI-------------------------------
RPOC2_MAIZE      SDSDVTNNFYE------TSETPFTPIYTI-------------------------------
RPOC2_ORYNI      SDSDVTNNFYE------TSESPFTPFI---------------------------------
RPOC2_ORYSI      SDSDVTNNFYE------TSESPFTPFI---------------------------------
RPOC2_ORYSA      SDSDVTNNFYE------TSESPFTPFI---------------------------------
RPOC2_ORYSJ      SDSDVTNNFYE------TSESPFTPFI---------------------------------
RPOC2_DIOEL      FCSCIQD--NLYE----TSEQSFTNS----------------------------------
RPOC2_PHAAO      FCSCAQE--LSMR----HQTNLLRNVS---------------------------------
RPOC2_LEMMI      LSSCIPN--NFQ------------------------------------------------
RPOC2_ACOCL      FGSCGPN--NFHD----TSEQSFMKFHDS-------------------------------
RPOC2_AMBTC      CGSCIPK--NFHD----TSEQ---------------------------------------
RPOC2_NYMAL      FCSCIPKPKSFHN----TSEQPFYAMGSNPIVHKSGFIIS--------------------
RPOC2_ILLOL      FCSCLET--NFHD----TSEQSFMGLNDS-------------------------------
RPOC2_CALFG      FDSCIPN--NFPD----TLE----------------------------------------
RPOC2_LIRTU      LSSCIPK--NFHD----TSEQSFTGFNDS-------------------------------
RPOC2_DRIGR      FGSCIPN--NFHN----TPEQ---------------------------------------
RPOC2_CHLSC      FGSCIPN--HFHD----TSEQSFTFTGFHDS-----------------------------
RPOC2_CERDE      FGSCIQK--TFHE----TSEQSFGFGRFNDS-----------------------------
RPOC2_PIPCE      FSSCISK--NKKK----FS-----------------------------------------
RPOC2_BUXMI      LNYCIPKNFHDTPEQ------SFTGFNDS-------------------------------
RPOC2_PLAOC      FDSCIPKNFHDTSKQ------SFTGFNDF-------------------------------
RPOC2_NANDO      FYSCIPKNFHDTSEQ------KFTGFIDS-------------------------------
RPOC2_RANMC      FDSCIPRNFPDTSEQL-FTKQSFTRFTD--------------------------------
RPOC2_SOLBU      FDSCLSKKFHD------IPEQSFIGFNDS-------------------------------
RPOC2_SOLTU      FDSCLSKKFHD------IPEQSFIGFNDS-------------------------------
RPOC2_SOLLC      FDSCLSKKFHD------IPEQSFIGFNDS-------------------------------
RPOC2_ATRBE      FDSCLSKKFHD------IPEQSFIGFNDS-------------------------------
RPOC2_NICSY      FDSCLSKNFHD------IPEQSFIGFNDS-------------------------------
RPOC2_TOBAC      FDSCLSKNFHD------IPEQSFIGFNDS-------------------------------
RPOC2_NICTO      FDSCLSKNFHD------IPEQSFIGFNDS-------------------------------
RPOC2_COFAR      FDSFLLKKFHD------PSEQSFIGFNDS-------------------------------
RPOC2_JASNU      FDSCRSKNFHD------TSEQSLLGFHDS-------------------------------
RPOC2_CUSEX      FDSFLNTSPS--------------------------------------------------
RPOC2_CUSRE      FDSFLNTLIY-------HHHRIDRFYNDS-------------------------------
RPOC2_IPOPU      LDSSLSKKFHNTSHNTIHQTIIYRIYNDS-------------------------------
RPOC2_DAUCA      FDSCFSKNFHD------TSEQSFIGIGFNDS-----------------------------
RPOC2_PANGI      FDSCLSKNFHD------TPEQSFIG--FNDS-----------------------------
RPOC2_GUIAB      FDSCLSKNFHD------TQEQSFF------------------------------------
RPOC2_HELAN      ------------------------------------------------------------
RPOC2_LACSA      FDSCLSNNFHD------TQEQSFF------------------------------------
RPOC2_SILLA      LDSCFLKNLGD------RSKQQ--------------------------------------
RPOC2_SPIOL      FESCLSKN----------------------------------------------------
RPOC2_FAGEA      FNIEFLCFKNY------Q------------------------------------------
RPOC2_SOYBN      FFFVSKNLCDT------SQQSSI-------------------------------------
RPOC2_PHAVU      FKNS--------------------------------------------------------
RPOC2_LOTJA      ------------------------------------------------------------
RPOC2_PELHO      V-----------------------------------------------------------
RPOC2_OENAR      FDSCISKNFHD------TPEQSFRVFNDS-------------------------------
RPOC2_OENPA      FDSCISKNFHD------TPEQSFRVFNDS-------------------------------
RPOC2_OENEH      FDSCISKNFHD------TPEQSFRVFNDS-------------------------------
RPOC2_OENGL      FDSCISKNFHD------TPEQSFRVFNDS-------------------------------
RPOC2_OENBI      FDSCISKNFHD------TPEQSFRVFNDS-------------------------------
RPOC2_EUCGG      FDSSISKKFHD------TSEQSFRGFNDS-------------------------------
RPOC2_AETCO      FDSSISK-----------FERSFLGFNDS-------------------------------
RPOC2_AETGR      FDSSISK-----------LERSFLGFNYS-------------------------------
RPOC2_ARATH      CDSSISK-----------SDFSRI------------------------------------
RPOC2_CAPBU      CESSISK-----------SDFSRI------------------------------------
RPOC2_CRUWA      CDSSISK-----------SDFSRI------------------------------------
RPOC2_OLIPU      CDSAISK-----------SAFSRI------------------------------------
RPOC2_BARVE      CDSSISK-----------SDFSRI------------------------------------
RPOC2_NASOF      CDSSISK-----------SDFSRI------------------------------------
RPOC2_LEPVR      CDSSISK-----------------------------------------------------
RPOC2_LOBMA      FDSSI-------------------------------------------------------
RPOC2_ARAHI      FDSSI-------------------------------------------------------
RPOC2_DRANE      FDSSISI-----------SKSSFSRI----------------------------------
RPOC2_SINAL      LCLFYQI-----------QNLPFLELH---------------------------------
RPOC2_CARPA      FDSCISKNLHN------TSERSFIGLNDS-------------------------------
RPOC2_GOSBA      FDSCFSNNLHD------TSGRSFIGIEFNDS-----------------------------
RPOC2_GOSHI      FDSCISNNLHD------TSGRSFIGIEFNDS-----------------------------
RPOC2_CITSI      FDSCISTTFHD------TSEHNCLEGLMSPRSEFF-------------------------
RPOC2_CUCSA      FDFFISTNLHD------TSEQEFLGFNDS-------------------------------
RPOC2_MORIN      FDFCISTNIHD------TSEHLFLGFNDS-------------------------------
RPOC2_POPAL      FDSCISKNFYN------ISEQSFIGFNDS-------------------------------
RPOC2_POPTR      FDSCISKNFYN------ISEQSFIGFNDS-------------------------------
RPOC2_MANES      FDSCISKNLYD------TSEQSFIGFNDS-------------------------------
RPOC2_VITVI      FDSCSSKNFHD------TSEQSFMGFNDS-------------------------------
RPOC2_WELMI      ------------------------------------------------------------
RPOC2_ADICA      FNPSFFIRKELNRSFTRLHLDMW-------------------------------------
RPOC2_CHAGL      LKKLHITYTFQ-------------------------------------------------
RPOC2_ACAM1      --------VIDDRTARNYNINDVKPFSGERPAYDPSKPGEQ--QRSMLGIDPAAVGD--D
RPOC2_THEEB      --------ISPEPESPKMTVNVTADLGEDVLIDDETAPHVI--EKITGGARDFEFAS--S
RPOC2_NOSS1      ---------TDDPLDMVLDDRTARAYNLDSPGLAETGFNNR---RSILDD-DELIAD--E
RPOC2_TRIV2      ---------TDDPLDMVLDDRTARAYNLDSPGLAETGFSNR---RSILDD-DELIAD--E
RPOC2_NOSP7      ---------VDDPLDMVLDDRTARTYNLDSPTLGESGFGSRRAERSVLDDEDELIAD--E
RPOC2_SYNE7      ------------LADVVIDDRAARSYTLNEGRDFSRSMTFAEGESMILDDGEELIDD--S
RPOC2_SYNP6      ------------LADVVIDDRAARSYTLNEGRDFSRSMTFAEGESMILDDGEELIDD--S
RPOC2_TRIEI      --------EEGDLQSVVLDDQTARSLEFENSLNLSSANQNFVDSQGKPQSQSSFIDD--S
RPOC2_CROS5      PNRLIGATLDEVDENMILDDNIARAYTEADPPWSVE--------------SKQEKDDDDD
RPOC2_SYNY3      SATKVKTKKVEADDDL-LDDTRARAYAGTQLSQDDE--------------EFEETYDTDE
RPOC2_MICAN      PP-RPGFGDSSEDSDMILDDQTARAYAEGDVVDLEDDEMAFLSSRGSSRFSRQPISDRWS
RPOC2_SYNP2      -AGLSSRTYDDLDGSEILDDQTARAFTEGKSNRKDIIS-----GDELISDDTPIPSDVQG
RPOC2_SYNJB      --------------PAVLPELPPRLILEDDQLIDDSTPAFD-------------------
RPOC2_SYNJA      --------------PVVLPELPPRLILDDDQLIDDSTPVDE-------------------
RPOC2_GLOVI      --------------TLGLRTVGVAFAGDDD------------------------------
RPOC2_PROMA      VEMPSSP--AAANLTSVLDDPSDADLEATRNRHGIDPSTSNFAAFARPSGDD-NFQEDQS
RPOC2_PROM4      VEMPVS---TAAKSTSVLDDPSEEDLEATRSRHGIDPTTSNFAAFARPSGDD-PSQEDQK
RPOC2_PROM1      VDMPSS---PVAKNTAVLDDPSDEDLEATRSRHGIDPTTSNFAAFARPTGDDELSAEDQM
RPOC2_PROMT      VDMPSS---PVAKNTAVLDDPSEEDLEATRSRHGIDPTTSNFAAFARPVGDDELSAEDQM
RPOC2_PROM3      VDMPAA---PAASSTAVLADPSAADLEATRSRHGIDPAASNFAAFVRPTGEN-ELEEEQL
RPOC2_PROMM      VDMPAA---PAASSTAVLADPSDADLEATRSRHGIDPAASNFAAFVRPTGEN-ELEEEQL
RPOC2_SYNS3      VDMPAA---PAAKSTALLDDPSAADLEATRSRHGIEAEASNFAAFTRPDADN-ELAEEQV
RPOC2_SYNPW      VDMPAA---PAGDATAVLDDPSDADMEATRSRHGIEA-GSNFAAFARPDADN-ELKEEQV
RPOC2_SYNSC      VDMP-----PAASASAVLDDPSDADLEATRTRHNIDPSASNFAAFTRPDADN-ELKEEQV
RPOC2_SYNPX      VEMP-----PAASSTAVLDDPSDADLEATRTRHNIDPSASNFAAFARPDADN-ELKEEQV
RPOC2_SYNS9      VDMP-----PAASSSALLADPSDADLEATRTRHNIDPSASTNAAFTRPDVDN-ELKEEQV
RPOC2_PROMS      VDMPQS---PAVSSSAILDDPSDEDLETTRNRHGIDPSSSNFAAFARPNAEN-QFSEDQL
RPOC2_PROM0      VDMPQS---PSVSSTAILDDPSDEDLETTRNRHGIDPSSSNFAAFARPNAEN-QFSEDQL
RPOC2_PROM2      VDMPQS---PAVSSTAILDDPSDEDLETTRNRHGIDPSSSNFAAFARPNAEN-QFSEDQL
RPOC2_PROM9      VDMPQS---PAVSSTAILDDPSDEDLETTRNRHGIDPSSSNFAAFARPSAEN-QFSEDQL
RPOC2_PROM5      VDMPQS---PTVSSTAILDDPSDEDLETTRNRHGIDPSSSNFAAFARPNAEN-QFSEDQL
RPOC2_PROMP      VDMPQT---PIVSSTAILDDPSDEDLETTRNRHGIDPTSSNFAAFARPNAEN-QFSEDQL
RPOC2_SYNR3      VEMPLP-----QSNTAVLDDPSDTELEATRSRHGIED-RTNLAAFARPAAGE-ELAEEHV
RPOC2_PAUCH      VDMPAA---ASASPAALLDDPSDDELEATRSRHGIEVTTSNTAAFTRPVIVN-KIMEDQI
RPOC2_GUITH      ------------VEDSKLSTIIEDNNLEQYNSIDSFDNIEKENPNN--------------
RPOC2_RHDSA      -----------NIEDIILDDNIARNYALIENPINNFDTIEQNINQSKDI-----------
RPOC2_PORPU      -----------DLDDIILDDRTARNYFNNKTVD---------------------------
RPOC2_PYRYE      -----------DLDDIILDDRTARNYFSNKSVE---------------------------
RPOC2_GRATL      -----------NFEDIIVDDRNAHMYSRNNNL----------------------------
RPOC2_CYAPA      -----------EVKTSVLNSPAESDTNSDLDDIILNKD----------------------
RPOC2_CYACA      -----------------FKKKNNKFLNKTY------------------------------
RPOC2_EMIHU      -----------PLSENILDLRLVKKE----------------------------------
RPOC2_PHATC      ------------------------------------------------------------
RPOC2_THAPS      ------------------------------------------------------------
RPOC2_TRICV      ------------------------------------------------------------
RPOC2_CHLVU      ------------------------------------------------------------
RPOC2_OSTTA      ------------------------------------------------------------
RPOC2_BIGNA      ------------------------------------------------------------
RPOC2_CHLAT      ----------IYEKEKNKVEEADFEDIIFEDNRTPKGFRLKDEAS---------------
RPOC2_MESVI      ----------QHKRIEQKNAEYNFEDIIFD------------------------------
RPOC2_NEPOL      GLSIWMPEFEFRRFETFTEEEMVAAESLFTAHPNCHARRINNKQLNSLI-----------
                                                                             

RPOC2_STAPU      LKKKTIKTT---------------------------------------------------
RPOC2_ZYGCR      ------------------------------------------------------------
RPOC2_CHAVU      ------------------------------------------------------------
RPOC2_ANEMR      ------------------------------------------------------------
RPOC2_MARPO      ------------------------------------------------------------
RPOC2_PHYPA      ------------------------------------------------------------
RPOC2_ANTAG      ------------------------------------------------------------
RPOC2_ANGEV      ------------------------------------------------------------
RPOC2_PSINU      ------------------------------------------------------------
RPOC2_PINKO      ------------------------------------------------------------
RPOC2_PINTH      ------------------------------------------------------------
RPOC2_CYCTA      ------------------------------------------------------------
RPOC2_CRYJA      ------------------------------------------------------------
RPOC2_AGRST      ------------------------------------------------------------
RPOC2_LOLPR      ------------------------------------------------------------
RPOC2_HORVU      ------------------------------------------------------------
RPOC2_WHEAT      ------------------------------------------------------------
RPOC2_SACHY      ------------------------------------------------------------
RPOC2_SACOF      ------------------------------------------------------------
RPOC2_SORBI      ------------------------------------------------------------
RPOC2_MAIZE      ------------------------------------------------------------
RPOC2_ORYNI      ------------------------------------------------------------
RPOC2_ORYSI      ------------------------------------------------------------
RPOC2_ORYSA      ------------------------------------------------------------
RPOC2_ORYSJ      ------------------------------------------------------------
RPOC2_DIOEL      ------------------------------------------------------------
RPOC2_PHAAO      ------------------------------------------------------------
RPOC2_LEMMI      ------------------------------------------------------------
RPOC2_ACOCL      ------------------------------------------------------------
RPOC2_AMBTC      ------------------------------------------------------------
RPOC2_NYMAL      ------------------------------------------------------------
RPOC2_ILLOL      ------------------------------------------------------------
RPOC2_CALFG      ------------------------------------------------------------
RPOC2_LIRTU      ------------------------------------------------------------
RPOC2_DRIGR      ------------------------------------------------------------
RPOC2_CHLSC      ------------------------------------------------------------
RPOC2_CERDE      ------------------------------------------------------------
RPOC2_PIPCE      ------------------------------------------------------------
RPOC2_BUXMI      ------------------------------------------------------------
RPOC2_PLAOC      ------------------------------------------------------------
RPOC2_NANDO      ------------------------------------------------------------
RPOC2_RANMC      ------------------------------------------------------------
RPOC2_SOLBU      ------------------------------------------------------------
RPOC2_SOLTU      ------------------------------------------------------------
RPOC2_SOLLC      ------------------------------------------------------------
RPOC2_ATRBE      ------------------------------------------------------------
RPOC2_NICSY      ------------------------------------------------------------
RPOC2_TOBAC      ------------------------------------------------------------
RPOC2_NICTO      ------------------------------------------------------------
RPOC2_COFAR      ------------------------------------------------------------
RPOC2_JASNU      ------------------------------------------------------------
RPOC2_CUSEX      ------------------------------------------------------------
RPOC2_CUSRE      ------------------------------------------------------------
RPOC2_IPOPU      ------------------------------------------------------------
RPOC2_DAUCA      ------------------------------------------------------------
RPOC2_PANGI      ------------------------------------------------------------
RPOC2_GUIAB      ------------------------------------------------------------
RPOC2_HELAN      ------------------------------------------------------------
RPOC2_LACSA      ------------------------------------------------------------
RPOC2_SILLA      ------------------------------------------------------------
RPOC2_SPIOL      ------------------------------------------------------------
RPOC2_FAGEA      ------------------------------------------------------------
RPOC2_SOYBN      ------------------------------------------------------------
RPOC2_PHAVU      ------------------------------------------------------------
RPOC2_LOTJA      ------------------------------------------------------------
RPOC2_PELHO      ------------------------------------------------------------
RPOC2_OENAR      ------------------------------------------------------------
RPOC2_OENPA      ------------------------------------------------------------
RPOC2_OENEH      ------------------------------------------------------------
RPOC2_OENGL      ------------------------------------------------------------
RPOC2_OENBI      ------------------------------------------------------------
RPOC2_EUCGG      ------------------------------------------------------------
RPOC2_AETCO      ------------------------------------------------------------
RPOC2_AETGR      ------------------------------------------------------------
RPOC2_ARATH      ------------------------------------------------------------
RPOC2_CAPBU      ------------------------------------------------------------
RPOC2_CRUWA      ------------------------------------------------------------
RPOC2_OLIPU      ------------------------------------------------------------
RPOC2_BARVE      ------------------------------------------------------------
RPOC2_NASOF      ------------------------------------------------------------
RPOC2_LEPVR      ------------------------------------------------------------
RPOC2_LOBMA      ------------------------------------------------------------
RPOC2_ARAHI      ------------------------------------------------------------
RPOC2_DRANE      ------------------------------------------------------------
RPOC2_SINAL      ------------------------------------------------------------
RPOC2_CARPA      ------------------------------------------------------------
RPOC2_GOSBA      ------------------------------------------------------------
RPOC2_GOSHI      ------------------------------------------------------------
RPOC2_CITSI      ------------------------------------------------------------
RPOC2_CUCSA      ------------------------------------------------------------
RPOC2_MORIN      ------------------------------------------------------------
RPOC2_POPAL      ------------------------------------------------------------
RPOC2_POPTR      ------------------------------------------------------------
RPOC2_MANES      ------------------------------------------------------------
RPOC2_VITVI      ------------------------------------------------------------
RPOC2_WELMI      ------------------------------------------------------------
RPOC2_ADICA      ------------------------------------------------------------
RPOC2_CHAGL      ------------------------------------------------------------
RPOC2_ACAM1      TLI-----------------------------------DDQVAEKLNANLEGDQ------
RPOC2_THEEB      DVE-----------------------------------EDELTEEDDDYGDEEEEDAF--
RPOC2_NOSS1      IHDLVEAEVEV-----------------------DDEVDDDYEDDDEDD-DDYED-----
RPOC2_TRIV2      IHDLVEAEVEV-----------------------DDEVDDDYEDDDEDD-DDYED-----
RPOC2_NOSP7      VVD-----------------------------------DDDFEEEEEDDEDDFDDE----
RPOC2_SYNE7      SAS-----------------------------------LRNLVDVDED------------
RPOC2_SYNP6      SAS-----------------------------------LRNLVDVDED------------
RPOC2_TRIEI      MSEFSPVKDKSGSVLDDSDFPPGNFDSDFPADNYDLEHEIDLEDDVYDGYDDFDENTPDL
RPOC2_CROS5      K-----------------------------------------------------------
RPOC2_SYNY3      D--------------------------------------DFDMDDDDDFGDDED------
RPOC2_MICAN      E--------------------------------------ADEEGEEDDFEEDYEEE----
RPOC2_SYNP2      K--------------------------------------APVIDDDAMIDDNWMKDQ---
RPOC2_SYNJB      ----------------------------------------ELEEDDDEEE----------
RPOC2_SYNJA      ----------------------------------------PTEDEGEEE-----------
RPOC2_GLOVI      ----------------------------------------FVEEEDED------------
RPOC2_PROMA      PDP------------------------------------AALEGLQEEGLLSDE------
RPOC2_PROM4      PDP------------------------------------IALEGLQEEGLLADE------
RPOC2_PROM1      PDP------------------------------------AALEGLQEEGLLSDE------
RPOC2_PROMT      PDP------------------------------------AALEGLQEEGLLSDE------
RPOC2_PROM3      PDP------------------------------------SALEGLQQEGLLTEE------
RPOC2_PROMM      PDP------------------------------------SALEGLQQEGLLTEE------
RPOC2_SYNS3      LDP------------------------------------AAVENLQEQGLLSDE------
RPOC2_SYNPW      VDA------------------------------------EAVEGLQEEGLLSDE------
RPOC2_SYNSC      VDA------------------------------------EAVEGLQEEGLLSDE------
RPOC2_SYNPX      VDA------------------------------------EAVEGLQEEGLLSDD------
RPOC2_SYNS9      VDA------------------------------------EAVEGLQEEGLLSDD------
RPOC2_PROMS      PDP------------------------------------AALEGLQEEGLLSDE------
RPOC2_PROM0      PDP------------------------------------AALEGLQEEGLLSDE------
RPOC2_PROM2      PDP------------------------------------AALEGLQEEGLLSDE------
RPOC2_PROM9      PDP------------------------------------AALEGLQEEGLLSDE------
RPOC2_PROM5      PDP------------------------------------AALEGLQEEGLLSDE------
RPOC2_PROMP      PDP------------------------------------AALEGLQEEGLLSDG------
RPOC2_SYNR3      PDP------------------------------------GALEGLQEEGLLSQDS-----
RPOC2_PAUCH      LDP------------------------------------DIIASLQEEGLLTRE------
RPOC2_GUITH      ------------------------------------------------------------
RPOC2_RHDSA      ------------------------------------------------------------
RPOC2_PORPU      ------------------------------------------------------------
RPOC2_PYRYE      ------------------------------------------------------------
RPOC2_GRATL      ------------------------------------------------------------
RPOC2_CYAPA      ------------------------------------------------------------
RPOC2_CYACA      ------------------------------------------------------------
RPOC2_EMIHU      ------------------------------------------------------------
RPOC2_PHATC      ------------------------------------------------------------
RPOC2_THAPS      ------------------------------------------------------------
RPOC2_TRICV      ------------------------------------------------------------
RPOC2_CHLVU      ------------------------------------------------------------
RPOC2_OSTTA      ------------------------------------------------------------
RPOC2_BIGNA      ------------------------------------------------------------
RPOC2_CHLAT      ------------------------------------------------------------
RPOC2_MESVI      ------------------------------------------------------------
RPOC2_NEPOL      ------------------------------------------------------------
                                                                             

RPOC2_STAPU      -
RPOC2_ZYGCR      -
RPOC2_CHAVU      -
RPOC2_ANEMR      -
RPOC2_MARPO      -
RPOC2_PHYPA      -
RPOC2_ANTAG      -
RPOC2_ANGEV      -
RPOC2_PSINU      -
RPOC2_PINKO      -
RPOC2_PINTH      -
RPOC2_CYCTA      -
RPOC2_CRYJA      -
RPOC2_AGRST      -
RPOC2_LOLPR      -
RPOC2_HORVU      -
RPOC2_WHEAT      -
RPOC2_SACHY      -
RPOC2_SACOF      -
RPOC2_SORBI      -
RPOC2_MAIZE      -
RPOC2_ORYNI      -
RPOC2_ORYSI      -
RPOC2_ORYSA      -
RPOC2_ORYSJ      -
RPOC2_DIOEL      -
RPOC2_PHAAO      -
RPOC2_LEMMI      -
RPOC2_ACOCL      -
RPOC2_AMBTC      -
RPOC2_NYMAL      -
RPOC2_ILLOL      -
RPOC2_CALFG      -
RPOC2_LIRTU      -
RPOC2_DRIGR      -
RPOC2_CHLSC      -
RPOC2_CERDE      -
RPOC2_PIPCE      -
RPOC2_BUXMI      -
RPOC2_PLAOC      -
RPOC2_NANDO      -
RPOC2_RANMC      -
RPOC2_SOLBU      -
RPOC2_SOLTU      -
RPOC2_SOLLC      -
RPOC2_ATRBE      -
RPOC2_NICSY      -
RPOC2_TOBAC      -
RPOC2_NICTO      -
RPOC2_COFAR      -
RPOC2_JASNU      -
RPOC2_CUSEX      -
RPOC2_CUSRE      -
RPOC2_IPOPU      -
RPOC2_DAUCA      -
RPOC2_PANGI      -
RPOC2_GUIAB      -
RPOC2_HELAN      -
RPOC2_LACSA      -
RPOC2_SILLA      -
RPOC2_SPIOL      -
RPOC2_FAGEA      -
RPOC2_SOYBN      -
RPOC2_PHAVU      -
RPOC2_LOTJA      -
RPOC2_PELHO      -
RPOC2_OENAR      -
RPOC2_OENPA      -
RPOC2_OENEH      -
RPOC2_OENGL      -
RPOC2_OENBI      -
RPOC2_EUCGG      -
RPOC2_AETCO      -
RPOC2_AETGR      -
RPOC2_ARATH      -
RPOC2_CAPBU      -
RPOC2_CRUWA      -
RPOC2_OLIPU      -
RPOC2_BARVE      -
RPOC2_NASOF      -
RPOC2_LEPVR      -
RPOC2_LOBMA      -
RPOC2_ARAHI      -
RPOC2_DRANE      -
RPOC2_SINAL      -
RPOC2_CARPA      -
RPOC2_GOSBA      -
RPOC2_GOSHI      -
RPOC2_CITSI      -
RPOC2_CUCSA      -
RPOC2_MORIN      -
RPOC2_POPAL      -
RPOC2_POPTR      -
RPOC2_MANES      -
RPOC2_VITVI      -
RPOC2_WELMI      -
RPOC2_ADICA      -
RPOC2_CHAGL      -
RPOC2_ACAM1      -
RPOC2_THEEB      -
RPOC2_NOSS1      -
RPOC2_TRIV2      -
RPOC2_NOSP7      -
RPOC2_SYNE7      -
RPOC2_SYNP6      -
RPOC2_TRIEI      I
RPOC2_CROS5      -
RPOC2_SYNY3      -
RPOC2_MICAN      -
RPOC2_SYNP2      -
RPOC2_SYNJB      -
RPOC2_SYNJA      -
RPOC2_GLOVI      -
RPOC2_PROMA      -
RPOC2_PROM4      -
RPOC2_PROM1      -
RPOC2_PROMT      -
RPOC2_PROM3      -
RPOC2_PROMM      -
RPOC2_SYNS3      -
RPOC2_SYNPW      -
RPOC2_SYNSC      -
RPOC2_SYNPX      -
RPOC2_SYNS9      -
RPOC2_PROMS      -
RPOC2_PROM0      -
RPOC2_PROM2      -
RPOC2_PROM9      -
RPOC2_PROM5      -
RPOC2_PROMP      -
RPOC2_SYNR3      -
RPOC2_PAUCH      -
RPOC2_GUITH      -
RPOC2_RHDSA      -
RPOC2_PORPU      -
RPOC2_PYRYE      -
RPOC2_GRATL      -
RPOC2_CYAPA      -
RPOC2_CYACA      -
RPOC2_EMIHU      -
RPOC2_PHATC      -
RPOC2_THAPS      -
RPOC2_TRICV      -
RPOC2_CHLVU      -
RPOC2_OSTTA      -
RPOC2_BIGNA      -
RPOC2_CHLAT      -
RPOC2_MESVI      -
RPOC2_NEPOL      -