CLUSTAL format seed alignment for MF_01325_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RL3_PROMP       -----MSIGILGKKLGMSQLFDKDGNAVPVTLIEAG-PCRVTQLKTQP-LDGYTAIQIGY
RK3_CYAPA       -----MSIGILGTKLGMTQIFDEAGNAIPVTIIQAG-PCPITQIKTTA-TDGYNAIQVGY
RK3_PORPU       -----MSVGILGTKVGMTQFFDETGLSIPVTVIQVG-PCVITQIKSMS-TDGYNAIQVGY
RK3_GUITH       -----MKIGLLGTKLGMTQIFDDNGSAIPVTILKVG-PCYVTNLKSDT-KDNYNAIQIGY
RK3_TRICV       -----MSLGLLGNKIGMTQIFDESGNIIPVTILKVG-PCVITQVKTDL-NDGYNAIQIGY
RL3_BUCBP       ------MMGLIGQKLGMTRIFTEEGTVYPVTIIKVK-ENRITQIKTIS-RDLYHAVQVTT
RL3_WIGBR       ------MQGLIGRKIGMTRTFNSDGSSIPVTVIKIS-DNKIVQIKKIE-KDGYSSIQVTT
RL3_ECOLI       ------MIGLVGKKVGMTRIFTEDGVSIPVTVIEVE-ANRVTQVKDLA-NDGYRAIQVTT
RL3_BLOFL       ------MDGLVGRKLGMTRIINEEGIMIAVTMIEIL-PHYVTQVKNKE-KDGYCAVQVTT
RL3_CHRVO       -----MSLGLVGRKVGMTRIFAEDGATIPVTVLDMS-SNRVTQIKTAE-TDGYNAVQVTY
RL3_NITEU       -----MKLGLIGKKIGMTRVFTESGNSIPVTVLDVS-GNRVVQVKTEE-KDGYSAVQLTQ
RL3_COXBU       -----MSIGLIGRKCGMTRIFTETGSSIPVTVVEVI-LNRITQVKTVE-TDGYRAFQVAY
RL3_XYLFT       --MGCYSMGFVGRKAGMSRVFLEDGCSIPVTLIEAT-ANRVVQIKTSD-VDGYDAVQVTV
RL3_CAUVC       MTLPTQRTGVIAKKLGMTRFFDEAGQHVPVTVLSLD-GCQVTGVRTVE-KDGYTALQLGA
RL3_RICPR       -----MRTGIIAQKVGMTSVFNDKGERISLTLVKVD-DCQVVGHKTLA-KHGYNALVIGV
RL3_PORGI       ------MPGLLGKKIGMTSVFSAEGKNLPCTVIEVG-PCVVTQVKTLE-KDGYSALQLGF
RL3_CHLTE       ------MGAILGKKIGMTRLYNDKREAVPCTVIQAG-PCYVTQVKSTE-KDGYEAYQLGF
RL3_FUSNN       ------MSGILGKKIGMTQIF-EDGKFVPVTVVEAG-PNFVLQKKTEE-KDGYVALQLGF
RL3_RHOBA       -----MSPSILGRKIGMTQIFLEDGTAVPVTVVQAG-PCHVLQVRSKD-RDGYEAVQMGF
RL3_STRCO       --MTKQIKGILGEKLGMTQVWDENNRVVPVTVVKAG-PNVVTQVRTND-VDGYESVQIAF
RL3_BIFLO       --MSNR-KALLGKKLGMSQVWDENGFFVPVTLVDVS-TNVVTAVKTEE-SDGYKAVQLGY
RL3_TROWT       -----MARALLGTKVGMTQIWS-GRRVVPVTAVAVT-TNVVSQVKAPE-KDGYSRLQIAT
RL3_DEIRA       ------MKGILGTKIGMTQIWK-NDRAIPVTVVLAG-PCPIVQRKTAQ-TDGYEAVQIGY
RL3_MYCPN       ----MEIRGIFGVKVGMSQVFTTNNERLPITVIYCE-PNQVAGVKTEA-KDKYSATLLSF
RL3_MYCGA       ------MKGIFGTKVGMTQVFEENGRLIPVTLVRVE-PNQVVSVKTKE-KDGYDAVQLGF
RL3_MYCPE       ------MKMILGRKIGMIQSFLEDGRRIPVTIIQAE-PNVVLENKTQE-KNGYVATKVGF
RL3_UREPA       ------MKSLLGTKVGMTQVFTETGKAVAATVIYVE-PNKVLAVKTNE-KDGYSAIQIGY
RL3_LACPL       ----MTTKGILGKKVGMTQVFTESGELVPVTVVEVQ-PNVVLQVKTVE-NDGYEAIQLGV
RL3_STAES       -----MTKGILGRKIGMTQVFGENGELIPVTVVEAS-QNVVLQKKTEE-VDGYNAIQVGF
RL3_MYCPU       ------MKGILGRKVGMTQIFSDNGIVIPVTLIEVK-PNIVSNVLTDE-KNGYKAIQLSL
RL3_SPIKU       ------MKGILGRKIGMTQIFATDGRLIPVTVVEVE-HNIVLRVLTKE-QNGYQALQLAV
RL3_CALS4       -----MKKGILGKKHGMTQIFDEKGEVIPVTVIEAG-PCVVVQKKTVE-KDGYNAIQVGF
RL3_GEOSL       -----MKKGLIAKKLGMTQIFAEDGKRIPVTVVQAG-PCVVLQKKTSA-TDGYDAIQVGF
RL3_BORBU       ------MLGLIGKKVGMTQIFQKNGIVVPVTVIEFQ-PNYIIGKKTVD-RDGYSALIAGS
RL3_TREPA       ------MVGLIGQKVGMTQIFDARGCVTPVTVIRVE-HNVVVGLKDVE-RFGYSAVILGT
RL3_CHLTR       ---MRSQLSLIGKKEGMMHVFDKNGNLVACSVISVD-ANVVAQLKTAS-SDGYNAVQMGA
RL3_LEPIN       -----MAKGLIGKKVGMSQIFDEQGNIIPVTVLEVG-PCAVSQVKSVE-NDGYEAIQLAF
RL3_AQUAE       -----MPLGLIGEKVGMTRVLLKDGTAIPVTVIKFP-VNYVVQVKSQNTKDGYNALQIGA
RL3_THEMA       -----MKM-IIGRKIGMTRVFVGNDS-VPVTVIKAG-PCVVVQKKTVE-KDGYNAVQLGF
RL3_GLOVI       -----MSLGILGRKLGMTQIFDEEGRAIPVTVVEAG-PCPVTQVKSEA-TDGYTAVQLGF
RK3_CYACA       --MKNVDFCTFGVKLGMTQILDNFGNLVPVTIVSQPKPCVITRVTTSLNSQQKLIIQIGC
                          .. * **           . : :       :                   

RL3_PROMP       GVSK-------------------DKHLSKPEKGHLLKS---GEILLKHLKEYRVEENS--
RK3_CYAPA       RETK-------------------EKNLTKAQLGHLQKT---NNSALRVLQEFSIESSD--
RK3_PORPU       KQVV-------------------EQKLSKPLLGHLKKS---QSPPLKYLREYLVESIE--
RK3_GUITH       QQVD-------------------AKKLTKPQLGHLQVN---NLPPLKHLKEYKVDATH--
RK3_TRICV       GTVS-------------------NKSLTQPELGHLQKS---NIQPLKYLKEFRVNNPE--
RL3_BUCBP       GIKK-------------------SNKLLKPEIGHFLKS---GVKIGKGLWEFKLTNSSIN
RL3_WIGBR       GVKK-------------------FSRENKSIIGHFKKN---KVELGRGLWEFKVDKNS--
RL3_ECOLI       GAKK-------------------ANRVTKPEAGHFAKA---GVEAGRGLWEFRLAEGE--
RL3_BLOFL       GNTR-------------------DKCLNKPKLGHLKKL---GINYGKGLWEFRLNDSN-R
RL3_CHRVO       GSKK-------------------ASRVNKADAGHFAKA---GVEAGLGLAEFALSADALS
RL3_NITEU       GYRR-------------------KNRITKALSGHFSQA---GVEAGTVIKEFRVDHDIGS
RL3_COXBU       GKKS-------------------SARVNKPLAGHYSKA---AVEAGNALREFRLGNEELT
RL3_XYLFT       GSRR-------------------SVLVNKPESGHFAKA---KVEAGRGLWEFRVEKTQLG
RL3_CAUVC       GAKK-------------------AKNTSNAMRGHFAKA---AVEPKRVVAEFRVEENA--
RL3_RICPR       KDQK-------------------ISKVTKPMKQVFANA---KIAPKTKLKEFRISEDN--
RL3_PORGI       VDAK-------------------EKHTTKPLAGHFKKA---NVAPKRHLAEFKN--FE-G
RL3_CHLTE       GERD-------------------EKKVSKPLAGHYKKA---GKNPGYILSEVSKSLIV-G
RL3_FUSNN       DEK-------------------KEKNTTKPLMGIFNKA---GVKPQRFVKELEV-ESV-D
RL3_RHOBA       EDKPRRLAKRSERGQVATIESKRSKKRSAAGIEAPAKA---DCEPQRFVREFRG-SS---
RL3_STRCO       GEID-------------------PRKVNKPLKGHFAKA---DVTPRRHLVEIRT-AAA-S
RL3_BIFLO       GAID-------------------PTKVTKPLAGHFAKA---GVTPRRHLVEVRT-DDV-D
RL3_TROWT       GAID-------------------PRRVNRPRKGHFAKA---GLTPRRFIREVDS-EG---
RL3_DEIRA       APKA-------------------ERKVNKPMQGHFAKA---GVAPTRILREFRG-FAP-D
RL3_MYCPN       DTVE-------------------NKKLNKPQQGFFEKN---NLKPTKHLQEIRNMTGF--
RL3_MYCGA       NQTD-------------------EKNLNKPQLGHFKKA---NTNNYKYLEEVRGMVGY--
RL3_MYCPE       QQIE-------------------EKKLNKPQKGYFKKI---KTDAFKHTKEFRNVSGY--
RL3_UREPA       ETVK-------------------EKALNKPLLGQFKKA---NSDPKRHIKEFRDVVA---
RL3_LACPL       DDK-------------------REVLTNKPAQGHAAKA---KTTPKRFIREIRNVELG--
RL3_STAES       EDKQAYKKGS-----------KSNKYANKPAEGHAKKA---DTAPKRFIREFRNVNVD--
RL3_MYCPU       EDK-------------------KKSRQRKPEIGHFAKA---NTTPKRFVKEIRDMQ----
RL3_SPIKU       EDK-------------------RISLVSKPDQGQFKKA---NTTPKRFVKEIRNMD----
RL3_CALS4       GDV-------------------SEKKLNKPLLGHFKKA---GVSPKRYLREFRLDDIS--
RL3_GEOSL       LSQ-------------------EARKVTKPMLGHIKAA---GQGAFAHIREFRLDDVD--
RL3_BORBU       VDLKSS-------------------KVSKPIKGQYKSL--KDIEPKRYVIELKGLD----
RL3_TREPA       GCMKKS-------------------RISKPYAGQFA----ERIPPVRVMREFRGFTL---
RL3_CHLTR       DVVQAPEK-------------TIEKRFSKALLGHFKKSGGRVCRVLKEVVVSEEAVQ---
RL3_LEPIN       QDIKEI-------------------QTSKAEKNHLAKA---GLGPKKVLKEFRSFGD---
RL3_AQUAE       YEAK-------------------EKHLTKPLIGHFKKH---GVPLLRRLWEFRVDNPE--
RL3_THEMA       --EK-------------------AKKVNKPLAGHFKKF---GVEPMKILREFRVENPD--
RL3_GLOVI       GTAR-------------------EKVLTRPEVGHCKKA--GLEAPVRHLREFRLPDSS--
RK3_CYACA       YSDF---------------------RANKPTIGYFKKQ---SVPNLRYLHEFQTYKNN--
                                             .                              

RL3_PROMP       SYEIGKEITV-TNFEVGQKVDISGKSMGRGFSGYQKRHGFSR-GPMSHGSK----NHRAP
RK3_CYAPA       SIEVEKPITV-ELFNDNDIVNIQGYSIGRGFSGYQKRHNFAR-GPMSHGSK----NHRLP
RK3_PORPU       DFEVSQVFST-NIFEVGQKVNVSSKSIGKGFSGYQKRHHFSR-GPMSHGSK----NHRQP
RK3_GUITH       TFTIAQQLDV-SIFELGQIVSVSGVSIGKGFAGTVKRHNFTR-GPMTHGSK----NHREP
RK3_TRICV       EFKVGQVVNV-ESLSTGQFIDVTGKSSGKGFSGLQKRHNFTR-GPMTHGSK----NHRAP
RL3_BUCBP       DFKIGQSLNL-ELFSNIKKVDIIGTSKGKGFCGTVKRWNFHT-QDATHGNS---LSHRAP
RL3_WIGBR       KFYVGQVLSI-NTFININKVNITGISKGKGFSGTMKRWNFHG-QDASHGNS---LSHRAP
RL3_ECOLI       EFTVGQSISV-ELFADVKKVDVTGTSKGKGFAGTVKRWNFRT-QDATHGNS---LSHRVP
RL3_BLOFL       LISVGDIFTL-KVLKCINKVDVTGISKGKGFAGAVKRWNFRT-QDASHGNS---LSHRAP
RL3_CHRVO       NFKPGDAIAV-EIFTVGQLVDVTGTSKGKGFSGVIKRHNFSS-NRASHGNS---RSHNTP
RL3_NITEU       DIKIGSEISV-ELFEVGSKVDVCGISIGKGYAGTIKRHNFSS-SRASHGNS---RSHNVP
RL3_COXBU       EAKAGDELKV-DIFKEGQVVDVRGLTRGKGFAGTVKRHNFRT-QDATHGNS---LSHRAP
RL3_XYLFT       SYSVGSEVGL-SIFAVGQKVDIQGITKGKGFQGTIKRHNFRM-GDATHGNS---LSHRAP
RL3_CAUVC       LIEVGAELTA-DHFVAGQKVDIQGVTVGKGFAGAMKRWNFGG-LRATHGVS---VSHRSH
RL3_RICPR       FIDIASILEV-DHFRVGQFVDITATTIGKGFAGSMKRHNFRG-LEASHGVS---ISHRSH
RL3_PORGI       EHKLGDVLNV-EFFSDADFVDVVGTSKGKGFQGVVKRHGFGGVGQATHGQH---NRLRAP
RL3_CHLTE       ELEAGATVPV-DVFKEGDKVNVLGVTKGKGFAGVVKRHNFGG-GSRTHGQS---DRLRAP
RL3_FUSNN       GYELGQEIKV-DVLTEVGYVDITGTSKGKGTSGVMKKHGFSG-NRASHGVS---RNHRLG
RL3_RHOBA       EANVGDTLTV-EQFNDVKKVDITGTSKGRGFAGVMKRHNFAG-QRATHGVK---KCHRHA
RL3_STRCO       EYTLGQEITA-EAFESGVKVDVTAKSKGKGFAGVMKRHNFKG-GKASHGAH---RVHRMP
RL3_BIFLO       QFEAGQELAA-DLFEEGAEVDVTGTTKGKGFAGTIKRWGFKS-YRRTHGSH---KNERRP
RL3_TROWT       --SLGDEFGP-EIFQEGQLVDVVGKSKGKGFSGTMKRHNFQG-VSATHGSH---RNHRKP
RL3_DEIRA       ----GDSVNV-DIFAEGEKIDATGTSKGKGTQGVMKRWNFAG-GPASHGSK---KWHRRP
RL3_MYCPN       --EMGQQITPQNLFQVGEYVDVSAISKGRGFTGAIKRWNFKI-GPLGHGAG---YPHRFQ
RL3_MYCGA       --KIGDLLKVEELFQEGQVVDVQARTKGRGFTGAIKRWNFKI-GSKGHGAG---YPHRFQ
RL3_MYCPE       --NVGDKILV-DIFNSGDKVDAQAITKGKGFTGAIKRWNFKV-GPLGHGAG---YPHRYQ
RL3_UREPA       --EVGAELTV-SEFEPGQLVNAQAYTKGHGFTGSIKRHNFSM-GPMGHGAG---YPHRYV
RL3_LACPL       DYTVGDEVKA-DIFAAGDAVDVTGITKGHGYQGNIHKDGQSR-GPMAHGSR----YHRRP
RL3_STAES       EYELGQEVSV-DTFETGDIIDVTGVSKGKGFQGAIKRHGQGR-GPMAHGSH----FHRAP
RL3_MYCPU       GFELGSNVDV-SIFTPGEFVDVTGISKGKGFAGTIKRHNQKI-GPKSHGGGGGSKPVRQT
RL3_SPIKU       GYNSGDIIKA-DIFTAGEFVDVTGTSKGKGFTGSIKRHNYSR-GPMGHGSG----YHRGV
RL3_CALS4       GYEVGTEIKV-DIFKPGDRVDVTGISKGKGFAGVIKRYGARR-GPMSHGSK----YHRRV
RL3_GEOSL       RYNVGDVISA-DAFEVGEYIDVTGTSIGKGFQGVIKRWGFRG-GRSSHGSC----FHRAP
RL3_BORBU       GYDAGDEIKV-DVFKSVKYVDVTGTTKGKGFQGAMKRHNFSG-GPSSHGSK----FHRHL
RL3_TREPA       DVSVGQVLDV-RVLESVRYLDVCALSKGKGFQGVVKRWGFSG-GRSSHGSK----FHREA
RL3_CHLTR       SVSLGDEFGL-EIFDGVSNVDICGISKGKGFQGVMKKFGFRG-GPKSHGSG----FHRHA
RL3_LEPIN       SPTAGSVLKIQDVFAVSDVVKVTGVSKGRGYQGVVKRHGHAG-GPGAHGSR----FHRHP
RL3_AQUAE       EFQSGQQLKVEDVFKPGDLVDVWGISKGRGFAGAMKRWDFAG-FPKSHGHR----YHRAV
RL3_THEMA       EYEPGQVIKV-DVFEKGEYVDVTGWTKGRGFAGAMKRWGFSG-GPKSHGSK----FHREL
RL3_GLOVI       QYTPGQQITV-DLFAAGQLVDVVGTSIGKGFAGGQKRHHFGR-GPMAHGSK----NHRAP
RK3_CYACA       EYQVGKSLDL--KELDQQLVQVSAYTIGKGFAGYQKKHKFSR-GAMSHGSK----SHRRP
                       .           :.  . : *:*  *  ::          **        .  

RL3_PROMP       GSTG---AGTTPGRIYPGKRMAGRYGGKKITTKGLLVVKIDDQKNLLVVKGSVPGKPGSI
RK3_CYAPA       GSIG---AGSTPGRVYPGTRMAGRKGDSKITIRGLKIVKVDSERSLLIVKGSVPGKPGGL
RK3_PORPU       GSIG---AGTTPGRVYPGKNMAGQMGNKKVTIKNLQIVSINIENDLLLLKGAVPGKQGAL
RK3_GUITH       GSIG---QGSTPAKVHKGKKMAGRLGGHQVTTKNLTVVHLDKDNNVLVLKGCVPGKRGNI
RK3_TRICV       GSIG---MGTTPGRVLPGKKMAGQLGNKVTKTKKLKIIQVNGNENILVVKGSVPGKPGNL
RL3_BUCBP       GSIG---QNQTPGRVFKGKKMAGHLGNHRVTVQNLDIVKIDLNQEIILVKGAVPGYSGGN
RL3_WIGBR       GSIG---QNQTPGKVFKGKKMSGHLGYNKNTVKNLFVVKIDLEHELLLIKGSVPGSKGSD
RL3_ECOLI       GSIG---QNQTPGKVFKGKKMAGQMGNERVTVQSLDVVRVDAERNLLLVKGAVPGATGSD
RL3_BLOFL       GSIG---QNQTPGKVFKGKKMAGHLGYEKATIQNLAVINIDIKNNLLLVKGAIPGVIGEN
RL3_CHRVO       GSIG---QAQDPGRVFPGKRMAGQYGNVKSTVQCLEIVRVDAERQLILVKGAVPGAKNGD
RL3_NITEU       GSIG---MAQDPGRVFPGKKMTGHLGNAQCTVQNIEVVRVDAGRGLLFLKGSVPGSKGNG
RL3_COXBU       GSIG---QCQTPGRVWKGKKMAGQLGNVYCTVQSQEIIKVDVERNLLLIKGALPGAPGGE
RL3_XYLFT       GSLG---QRQTPGRVFPGKKMSGHMGAVKQSVQNLEVIKIDVERCLIAVRGAIPGASGGD
RL3_CAUVC       GSTG---NRQDPGRTFPGKKMAGHLGQETVTTLNVTVWKVDVERGLILVKGAVPGHEGSY
RL3_RICPR       GSTG---QRQDPGKVFKGKKMAGHMGCNKVTIQNLKIFAVDTNRKLIMIQGSIPGHKNSY
RL3_PORGI       GAVG---ACSYPAKVFKGTRMAGQMGNERVTVQNLEVIKVMPEHNLLLVKGSVPGAKGSI
RL3_CHLTE       GSVG---GSSDPSRTFKGTRMAGRMGGKNKTVQNLVIVKVMPESNLIVVKGAVPGPKNSY
RL3_FUSNN       GSIG---MSSWPGKVLKGKKMAGQHGNATVTVQNLKVVKVDAEHNLLLIKGAVPGAKNSY
RL3_RHOBA       GGTG---MSASPSRTFKGKRMAGQYGNAKVTTRNLEVVRVDAENNLLMIRGAVPGPNGGF
RL3_STRCO       GSIG---GCATPGRVFKGMRMAGRMGNERVTTQNLTVHAVDAEKGLLLIKGAVPGPNGGL
RL3_BIFLO       GSVG---ACATPSRILKGKRMAGRMGHVTATTQNLTVVSADVENGILAIKGAIPGPKGGI
RL3_TROWT       GSVG---ASSTPSRVFKGTRMAGRLGSSRVTVHNLRLVKIDSENGLLLVEGAVPGSSGSP
RL3_DEIRA       GSIG---QRKTPGRVYKGKRMAGHMGMERVTVQNLEVVEIRAGENLILVKGAIPGANGGL
RL3_MYCPN       GSVQAGRGGASAQRVFKGKKMSGHYGHEKVTVQNLRIVGFDEANMLVLVSGAIAGPEGGV
RL3_MYCGA       GSVQAGRGGSQAQRVMKGKKMSGHYGNELVTIQNLSIVGFLPEVSSVMISGAIPGANNSK
RL3_MYCPE       GSISFGRGGSQGQRVPKGQKMSGHYGHELVTISNLTVVSIELEKNLILVKGSVPGPVNSL
RL3_UREPA       GSIAKGRGGSQAQRVFKGTKLPGHYGHELVTTKNLLVLDVKANENLILIKGAIPGPKGSI
RL3_LACPL       GS---MGAII--NRVFKGKKLPGRMGNHQRTMQNLQIVRADVENNVLLIKGNVPGANKSF
RL3_STAES       GSVG-MASDA--SKVFKGQKMPGRMGGNTVTVQNLEVVQVDTENSVILVKGNVPGPKKGL
RL3_MYCPU       GS---LGDISG-NKVVKGMTMPGHLGHEQVTIQNLEVIMTDVKNNILLVKGAVPGPKKGF
RL3_SPIKU       GS---MGAIAP-NRILKSKKMPGHIGTEKVTIQNLEIIAIDTEKNALLVKGSIPGPKKQF
RL3_CALS4       GS---MGATTDPGRTFKGKKMPGRMGSDRVTIQNLEVVKVDPELNLLVVKGSVPGPKGSL
RL3_GEOSL       GS---IGSSAYPSRVFKNKKMPGQLGNERVTVQRLQVVRVDAADNILLIKGAIPGAKNGI
RL3_BORBU       GG---TGQATTPARTFKGTKMAGRMAGNQQTIQNLEVVLIDEEKRALLVKGAVPGAKGSF
RL3_TREPA       GS---TGQCTSPGRTFKNVKMPGRMGAERVTVQNLRIERIDVGLGVVMVRGAVPGRNKAT
RL3_CHLTR       GS---TGMRSTPGRCFPGSKRPSHMGCDRVTVKNLEVVKVDLDRKVMLVKGAIPGFKGSV
RL3_LEPIN       GS---MGANSTPSRVFKGVKLPGRTGSQKTTVRNLKVVRINEEKNLLFVSGAVPGTANTV
RL3_AQUAE       GAIG---QRTDPGRVWKGKRMPGHYGAKPVRVQGLFVVDVLPEENAILVKGSVPGHNKGI
RL3_THEMA       GSVG---QHTEPAKIWKGKKMPGRYGNERVTVRNLQVVDIDPENDLLVVKGGVPGARGGL
RL3_GLOVI       GSIG---AGTTPGRVFPGKRMPGRMGNERVTVRKLTVVRVIPERNVILIQGGLPGVEGGL
RK3_CYACA       GSIG---AGTTPGRVFPGVKMAGRLGFSRRSIKNLLVLKVDLTNKLFLLKGSVPGKYGNL
                *.           :   .   ..: .          :         . : * :.*     

RL3_PROMP       VNIKPNNVVGNKGGAKS-------------------------------------------
RK3_CYAPA       LTITQVKKV---------------------------------------------------
RK3_PORPU       VKVSK-------------------------------------------------------
RK3_GUITH       LSIK--------------------------------------------------------
RK3_TRICV       VTIHVSN-----------------------------------------------------
RL3_BUCBP       IIIKPAIKTRGV------------------------------------------------
RL3_WIGBR       LIIKPVVKYFSDKVL---------------------------------------------
RL3_ECOLI       LIVKPAVKA---------------------------------------------------
RL3_BLOFL       VIVKRSVKIGYFKEMSSI------------------------------------------
RL3_CHRVO       VVVRPSVKAGA-------------------------------------------------
RL3_NITEU       VFIRPGVKQPSK------------------------------------------------
RL3_COXBU       VIITQSSKKRKEDK----------------------------------------------
RL3_XYLFT       VLIRSASKI---------------------------------------------------
RL3_CAUVC       VKVRDAVKKALPADAPRPGAFRKAGEAAPAAAETPAEEAPAAETEEGEG-----------
RL3_RICPR       LLVKDAIKKAAITIA---------------------------------------------
RL3_PORGI       LLIEK-------------------------------------------------------
RL3_CHLTE       VKIVSTTK----------------------------------------------------
RL3_FUSNN       LVIKPAVKKVIG------------------------------------------------
RL3_RHOBA       VSIRQTNKVG--------------------------------------------------
RL3_STRCO       VLVRTAAKGA--------------------------------------------------
RL3_BIFLO       VLVRSAVKGA--------------------------------------------------
RL3_TROWT       VIIRDAVKGVPIVS----------------------------------------------
RL3_DEIRA       VVLRSAAKASAAKGGK--------------------------------------------
RL3_MYCPN       VLIRTAKKKPGVVKPIELAVQTEKAPEAKPAKLSKKKQAKELAKAQAANQQTVEAKVDTP
RL3_MYCGA       VRITTSKKNPNTVLTYKLII---------------NKKASKPAGEQAQE-----------
RL3_MYCPE       VLLKTTVKSKKQVDPIKLSD-PEAIARAIKEKEEQARLALEAKKAEAHQKAEAEKEAKKQ
RL3_UREPA       VLLKSAKK----------------VGHIVSDPQVVNYLANKASSSEANE-----------
RL3_LACPL       VTVKTSVKSK--------------------------------------------------
RL3_STAES       VEITTSIKKGNK------------------------------------------------
RL3_MYCPU       VVIKECAKKIPSKEAVKLVDLEIVAKKNHLFEISKKYNINLKNDMSIEEMESLIEKAKEE
RL3_SPIKU       VVIKEAIKGLKPNTPTELLKRTVETKTPDPTVKEEKPVEGVVDAAVDTTLTAVTDAPASK
RL3_CALS4       LIIRDSVKSK--------------------------------------------------
RL3_GEOSL       VLVKDTVKPR--------------------------------------------------
RL3_BORBU       VVVKKSKK----------------------------------------------------
RL3_TREPA       VFLRTAVKRER-------------------------------------------------
RL3_CHLTR       VVVKRSCGVEG-------------------------------------------------
RL3_LEPIN       ITIEKI------------------------------------------------------
RL3_AQUAE       VVVEQSTIAYRKSQKLKQKRYQFIIENLAKEESQEVAES---------------------
RL3_THEMA       VLIRSAKAPKK-------------------------------------------------
RL3_GLOVI       LMISPAKSVGRAKG----------------------------------------------
RK3_CYACA       LLVSLKKTNYFLD-----------------------------------------------
                : :                                                         

RL3_PROMP       --------------------------------------------------
RK3_CYAPA       --------------------------------------------------
RK3_PORPU       --------------------------------------------------
RK3_GUITH       --------------------------------------------------
RK3_TRICV       --------------------------------------------------
RL3_BUCBP       --------------------------------------------------
RL3_WIGBR       --------------------------------------------------
RL3_ECOLI       --------------------------------------------------
RL3_BLOFL       --------------------------------------------------
RL3_CHRVO       --------------------------------------------------
RL3_NITEU       --------------------------------------------------
RL3_COXBU       --------------------------------------------------
RL3_XYLFT       --------------------------------------------------
RL3_CAUVC       --------------------------------------------------
RL3_RICPR       --------------------------------------------------
RL3_PORGI       --------------------------------------------------
RL3_CHLTE       --------------------------------------------------
RL3_FUSNN       --------------------------------------------------
RL3_RHOBA       --------------------------------------------------
RL3_STRCO       --------------------------------------------------
RL3_BIFLO       --------------------------------------------------
RL3_TROWT       --------------------------------------------------
RL3_DEIRA       --------------------------------------------------
RL3_MYCPN       VVEPKPTEVKKAAPVVEKKGEDK---------------------------
RL3_MYCGA       --------------------------------------------------
RL3_MYCPE       EMLAKQKAAEEKQKAEAEKNEQPTATAEEAPAKTDDNATEKKEENNGGNQ
RL3_UREPA       --------------------------------------------------
RL3_LACPL       --------------------------------------------------
RL3_STAES       --------------------------------------------------
RL3_MYCPU       QEGKGE--------------------------------------------
RL3_SPIKU       TE------------------------------------------------
RL3_CALS4       --------------------------------------------------
RL3_GEOSL       --------------------------------------------------
RL3_BORBU       --------------------------------------------------
RL3_TREPA       --------------------------------------------------
RL3_CHLTR       --------------------------------------------------
RL3_LEPIN       --------------------------------------------------
RL3_AQUAE       --------------------------------------------------
RL3_THEMA       --------------------------------------------------
RL3_GLOVI       --------------------------------------------------
RK3_CYACA       --------------------------------------------------