CLUSTAL format seed alignment for MF_01327

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

THIE_PROMM        -MKSMPFAPIADLRVAQLIDANLDRAREGLRVVEDWCRFGLDREELVMTLKDWRQRLGRH
THIE_SYNPX        ----MGCESSLDPRVARLIDANLDRAREGLRVVEDWCRFGLERDDLVISLKDWRQRLGKL
THIE_SYNS3        -MELMVVEADAKLRVARLIDANLDRAREGLRVIEDWCRFGLDRDDLVLPLKDWRQRLGQQ
THIE_NOSS1        MVEPYSQQKQIQQVVYRILDANLDRAREGLRIIEEWCRFGLNSGQLAGECKYLRQEVAVW
THIE_SYNY3        ------MQQASPTAIARILDANLNRAREGLRTVEEWCRFALENRELAEECKQLRQALAPW
Q2JKL8_SYNJB      ---------MKPQAVARILDANLDRAREGLRVLEEWFRFGLEEGKLSAECKAMRQALARW
D3ENA9_ATETH      --------MNNNFLISQILDANLDRAREGIRVIEEWCRFGIKKGHLAKTCKDIRQELALW
THIE_THEEB        --MQNLAPASEGQRLRRILDANLDRAREGLRVIEEWCRFGREDAALSAECKDLRQTLGRY
THIE_GLOVI        ------MAVVEEQVVLRILDANLDRAREGVRVVEEWLRFGGGPGESLAECKALRQQLGRF
A5GUT1_SYNR3      ---MTISSEGVDPAVLRLLDANLDRAREGLRVAEDWARFGLDRRDLVEGLKDLRQQLGRC
A2BXY1_PROM5      -MEQPKINQPEDLRISQIIDANLDRAREGLRVLEDWARFGLGNEDFVIRIKNLRQILGKN
THIE_PROMP        -MKNPNIIQPEDLRISQIIDANLDRAREGLRVLEDWARFGLGNEDFVIRIKNFRQILGKN
THIE_PROMS        -MLNSNTKDHEDLRIYQIIDANLDRAREGLRVLEDWARFGLGKEKYVEKIKNFRQILGKN
A9BBN8_PROM4      ----MAVIPTPEKHVAQLIDANLDRAREGLRVIEDWCRYGLQRKDLIIIIKDYRHQLGRL
THIE_PROMA        ----MSVTPNPDQHVAQLIDANLDRAREGLRVIEDWCRFSLKNKDMVITLKNWRQQLGKE
A2C440_PROM1      -MKSIPVTPPSDNRIAQLIDANLDRAREGLRVMEDWCRFGLKRSDFSIQIKDWRQQLGVH
                                : :::****:*****:*  *:* *:.          *  *: :.  

THIE_PROMM        HHDSYKQARSTATDQGIGLSHPAQQERHEPWHVVAANCARVQEALRVLEEFARQPD----
THIE_SYNPX        HQERYKRARSTVTDPGAGMEHPAQLDRHSPRQVVEANCGRVQEALRVLEEYGRNVD----
THIE_SYNS3        HHDRYRRARSTATDVAAGLGHPAQTSRCSAPAIIKANASRVQEALRVLEEFGRNLD----
THIE_NOSS1        HTEELRAARDTAGDPGTDLSHPQEEQRSSIKALLQANFCRVEEALRVLEEYGKLYH----
THIE_SYNY3        HQDDLRAARDTPNDVGTQLTHAQEALRTDVRALLQANLCRVEEALRVLEEYGKLRD----
Q2JKL8_SYNJB      HSDPLRLARDTSADPGTQISHPQEEQRRDLRHLLQANCSRVQEALRVLEEYGKLAESHHW
D3ENA9_ATETH      HTYELRLSRNTENDPGIDLSHPKEEVKNNVEELLQANLCRVQEALRVLEEYGKLYD----
THIE_THEEB        HTEELRAARQTDQDPGTALSHPQERDRPTLNAVLTANFARVQEALRVIEEYGKLTD----
THIE_GLOVI        HTERLRAARDTPHDPGTGLEHPDEGVRSSPLDVVRVNFARIQEALRVLEEYAKLVQ----
A5GUT1_SYNR3      HLPRYRQARHTATDSAAGLAHPAQQQRSD-ATVVAANCARAQEALRVLEEFGRSCD----
A2BXY1_PROM5      HLEIYKKSRNHIEDQCKGLSHIEQIHRKSPSKIISSNSARVQEALRVIEEFSRNHN----
THIE_PROMP        HLEIYKLSRNHIEDQCKGLSHVEQINRNSSSKIISSNSARVQEALRVIEEFSRIHN----
THIE_PROMS        HLEVYKQSRNQIEDNCKGLTHQEQLNRKTSEQIISSNSARVQEALRVIEEFSRLHN----
A9BBN8_PROM4      HQKTYKQARSAQTDQGSGLTHEAQNDRISPLQIVSANCARVQEALRVIEEFARNID----
THIE_PROMA        HYEIYKNARSSSSDQSAGLSHPAQKERILPQQILSANFARIQEALRVIEEFSRISH----
A2C440_PROM1      HHNIYRKERLTSIDPAMGISHPLQTVRSTPEDVFIANSSRVQEALRVIEEFTRKTD----
                  *    :  *    *    : *  :  :     :.  *  * :*****:**: :  .    

THIE_PROMM        --PQLAASAAAIRYGLYDLEVTVLQANAGKKRRQQLQDCHLCLITTSQSDLNSNDLLRTV
THIE_SYNPX        --APLSAEAAAIRYGLYDLEVTCLTATSGNNRRNRLQDCQLCLITSP-----CPDLVDRV
THIE_SYNS3        --PDLASTAAEIRYGLYDLEVRILEACGRQHRQERLEGAKLCLITDPDRDNNLERLLHGV
THIE_NOSS1        --PKMGQACKQMRYRVYSLETNLMGH-QRHQLLRR---SRLYLVTSP-----SESLLPTV
THIE_SYNY3        --PAMGACCKQLRYRVYALESGLLGS-KLVQRLQQ---CSLYLVTSP-----QENLLATV
Q2JKL8_SYNJB      VAPGLAKLAKDMRYRLYVLESELLGG-SLRQRLLA---AHLYLVTSP-----VPHWLEVV
D3ENA9_ATETH      --SKMGKSFKKIRYEVYILESSLIRY-SNHKQLCK---ASIYLITSP-----IKNLFSVV
THIE_THEEB        --TELSETAKALRYRVYILEQALTLN-PLQARLRQLQGAKLYLVTAP-----SDRLLEIV
THIE_GLOVI        --PDLAAAAKEWRYRVYTLESTATGG-DLRTRLAA---ARLYLVTSP-----HPELIEIV
A5GUT1_SYNR3      --PELARVAEHCRYRLYDLETRLLADQSRRQRLAA---ERLYLITSP-----VPQLRSVV
A2BXY1_PROM5      --NKLSKIASDIRYEIYTLEIELLNLNTRKRAELIIRENNLYSITDH-----RDNLLQII
THIE_PROMP        --SKLSKIASEIRYEIYTLEIEILNFNTRKRAQSIISKNNLYSITDP-----RENLLEII
THIE_PROMS        --NELSKIASEIRYEIYTVEIDLLSFSKFKKSEKILKENDLYVITDQ-----KDNLLEII
A9BBN8_PROM4      --PELTKAASKIRYEIYDLEINIQEATSGKKRQKELSACKLCLITTP-----HQELIAKV
THIE_PROMA        --PKLSKISAQIRYEIYDLEVIILKISNLNMLDEKLKSCKLCLITRT-----HPELIKTV
A2C440_PROM1      --PNLCEIASKIRYETYEIEIKVLKSTEGVNKRETLKYCSVYLITSN-----RRDIEEVV
                      :       **  * :*                    :  :*              :

THIE_PROMM        NAALVAGIDMVQYRNKEASDLQRLTQAKELASLCRKHGALFIVNDRIDLALAVDADGVHL
THIE_SYNPX        KTALRSGVAMVQHRCKSGSDLERLAEARTLAALCRDHGALLIINDRIDLALAVDADGVHL
THIE_SYNS3        EAALMAGVSLVQYRRKQGNDKQRLLEAQALKTLCSRFEALFIVNDRIDLALLVDADGVHL
THIE_NOSS1        EAALKGGLTLLQYRDKDTDDFVRLELATKLRQLCHSYGALFIINDRVDLALAVDADGVHL
THIE_SYNY3        EAALQGGLKLVQYRDKDAEDQLRWQRAKDLRELCRQYEALFLVNDRVDLALAVDADGVHL
Q2JKL8_SYNJB      EKSLRGGVTLVQYRRKNLPDGEMLRDLKQLRQLCDRYQALMIVNDRVDLALVSQADGVHL
D3ENA9_ATETH      ESSLKGGLQILQYREKNISDSSYIKVARKLCELCHQYDALFIMNDRVDIALAINADGVHI
THIE_THEEB        EAALKGGLPLVQYRDKTSDDHTRLTTARQLQALCQRYGALFLVNDRVDIALGANADGVHL
THIE_GLOVI        EHALAVGLPLVQLREKEAPARAVLDIALRLRDVTLRHGALFIVNDRVDLALACGADGVHL
A5GUT1_SYNR3      EQALQAGVKLVQHRSKLTDDLPRYQEAVALRDLCAAHGALFIVNDRVDLALAVEADGVHL
A2BXY1_PROM5      EKILLGGVKIIQHRFKEGNDKNHLKEAIQVKNLCEKYNSLFIVNDRVDIAMASNADGVHL
THIE_PROMP        EKILLGGVKIIQHRFKEGNDKDHLKEAIEINKLCKKYNSLFIVNNRLDIALASKADGVHL
THIE_PROMS        EEILIAGVKIIQHRFKTGTDQDHLQEAIEIKNLCKRYNSLFIVNDRLDIALASNADGIHL
A9BBN8_PROM4      SAGLKAGVGMVQYRCKKGKDIDKFSEAEKLAVICKDYGALFIVNDRIDIALAVDADGIHI
THIE_PROMA        LLALKAGVTMIQYRCKETPDNQMIAEAKELASICKSYNSLFLINDRADIALAVDADGVHL
A2C440_PROM1      LHALKAGVKIVQYREKFLNDNEKISQAKCLASLCKKFNSLFIVNDRIDIALAVDADGIHL
                     *  *: ::* * *             :  :   . :*:::*:* *:*:   ***:*:

THIE_PROMM        GQDDLPTDVARRLIGSERLLGRSTQFLAQLQKAEAEGCDYLGVGPVNSTATKPERQPIGL
THIE_SYNPX        GQDDLPTDVARGLIGPGRLLGRSTHSLNQVAEAHREDCDYLGLGPVNNTAVKPERPAIGA
THIE_SYNS3        GQDDLPLSEARQLLGPERLLGRSTHRLEHLLEAQQAGADYLGVGPVFATKTKRDLSPAGL
THIE_NOSS1        GQQDMPIATARQLLGPQRLIGRSTTNADEMQKAIAEGADYIGVGPVYETPTKIGKAAAGL
THIE_SYNY3        GQQDLPIAVARQLLGPDKIIGRSTTNPEEMAKAIAEGADYIGVGPVYATPTKAGKKPAGL
Q2JKL8_SYNJB      GQTDLPVAQARHLLGSQRLIGLSTTNAEELAQALNSDVDYIGVGPVYPTPTKAEKPPAGL
D3ENA9_ATETH      GQEDISIKIAREIIGPQKIIGCSTTNPLEMEKAIEEGADYIGVGPIYPTPNKPEKETIQS
THIE_THEEB        GQMDIPMELARQILGRDRLVGRSTTNAQELERAIAEGADYVGVGPIFATPTKPGKAAVGF
THIE_GLOVI        GQEDLPLARARALMGPRLLIGQSTHAPAEAQQAVADGADYLGVGPVYATPTKQGRTPVGL
A5GUT1_SYNR3      GQGDLPPAQARRLLGPDRLIGRSTHAPAQLQQAMADGCDYAGVGPLQATPTKPGREPVGL
A2BXY1_PROM5      GQEDIDVKTARKLLGSSKIIGVSANNSTDINKAIKDGCDYIGIGPVFQSLTKKGKEPLGV
THIE_PROMP        GQDDLDIKTVRKLLGASKIIGVSANNSTDINKAVKDGCDYIGVGPVFPTLTKKNKEPLGE
THIE_PROMS        GQDDLDLKTTRKLFGYSKIIGISANNAIDISNALDEGCDYIGIGPVFETTTKKNKKPLGI
A9BBN8_PROM4      GQEDLPLDIARKLIGPEKLIGVSCHSLEEAQKADKNGSDYIGFGPIFRTTSKPEVAPLGL
THIE_PROMA        GQKDMPIQTARKIIGHQKIIGLSTHSLEEIQNATSQGCNYIGIGPIFKTKSKQNDLSLGI
A2C440_PROM1      GQEDMPTKIARQLLGAEKIIGRSTHCLEDIKNAEGEGCDYIGIGPIFPSETKKQLNPIGI
                  ** *:    .* ::*   ::* *     .  .*   . :* *.**:  :  *    .   

THIE_PROMM        AYVKEASKATQLPWFAIGGINISNLEALRQAGAK--RIAVIGAIMNSKDPAATSLQLLEA
THIE_SYNPX        ALVGEALAITHKPVFAIGGISQANLDALMAVGCR--RVAVIGAIMGSDNPEKASQNLLSS
THIE_SYNS3        SWVTEASRHAAVPWFAIGGIDIETIPSVRAAGAQ--RVAVVSAIMSSNDPEEASRTLLQT
THIE_NOSS1        GYVSYAAQHSSVPWFAIGGIDANNINDVIDAGAE--RVAVVRSLMQAEQPTLVTQYLISQ
THIE_SYNY3        EYVQYAVTNSPVPWFAIGGIDGENLGEVMEAGAT--QVAIVRAIMETTNPTQATAQLLTQ
Q2JKL8_SYNJB      EYVRLAAEKAHLPWFAIGGIDPHNLPEVRRAGAT--RVAVVRALMEAADPTQTARTMLAE
D3ENA9_ATETH      DYLDYVINKCTIPWFAIGGINIDNIKNITDLGVK--QVAVIRLIMEADNPEEMTKFLLKN
THIE_THEEB        DYLQYARKHAPMPQFAIGGIDLSNIEEVIKAGAT--QVAVVRAIMAAADPEATTRELLRR
THIE_GLOVI        EYVRHCRESIERPGFAIGGIDRSNLEAVIAAGAE--RIAVVRAIMAAEDPGRTTAWFLER
A5GUT1_SYNR3      DYLRQAAQIATIPHYAIGGVDVQLLPALLEAGGPHCRVAVVRAVMEAADPAAAARQLLEL
A2BXY1_PROM5      EKIKTLIKDINIPCFAIGGINKLNISCLKSHRIS--KVAVVSGLLNSEDPKEEAIIILKK
THIE_PROMP        EKIKALTKELNIPCFAIGGINKLNISSLKNHGIS--KVAIVSGLLNSEDPKDEAMIIIKE
THIE_PROMS        ENIKTLTKDLNIPWFAIGGIKSNNISYLKRNGFK--KVALVSELMNSEDPKEDAMMILKE
A9BBN8_PROM4      ECLKQISNSINQPCFAIGGINHLNRSKLLSTGVS--RIAVIDAIMKAEDPFQASKQLLEI
THIE_PROMA        DFFSKINLKTNLPWFAIGGINKDNIDKIKEVGIK--RVAVINAIMGAEDPYLASKELLGK
A2C440_PROM1      DNLKKGLSETILPAFAIGGINKSNITKLNQINNL--RIAVSNAIINSNDPFSTTEELIKF
                    .         * :****:.      :        ::*:   :: : :*   :  ::  

THIE_PROMM        LR------
THIE_SYNPX        LSRPTL--
THIE_SYNS3        LA------
THIE_NOSS1        LNRIKPES
THIE_SYNY3        LSRINP--
Q2JKL8_SYNJB      LQGIPALS
D3ENA9_ATETH      YLS-----
THIE_THEEB        LSQGEPS-
THIE_GLOVI        LNRG----
A5GUT1_SYNR3      LADG----
A2BXY1_PROM5      LSNENYS-
THIE_PROMP        LSHEN---
THIE_PROMS        LSHEN---
A9BBN8_PROM4      --------
THIE_PROMA        LKK-----
A2C440_PROM1      LICN----