CLUSTAL format seed alignment for MF_01328_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RL4_TREDE       ------------------------------------------------------------
RL4_TREPA       ------------------------------------------------------------
RL4_BORBP       ------------------------------------------------------------
RL4_BRAPL       ------------------------------------------------------------
RL4_LEPIC       ------------------------------------------------------------
RL4_HELHP       ------------------------------------------------------------
RL4_WOLSU       ------------------------------------------------------------
RL4_HELPJ       ------------------------------------------------------------
RL4_SULDN       ------------------------------------------------------------
RL4_CAMJR       ------------------------------------------------------------
RL4_CHLTA       ------------------------------------------------------------
RL4_CHLMU       ------------------------------------------------------------
RL4_CHLAB       ------------------------------------------------------------
RL4_CHLFF       ------------------------------------------------------------
RL4_CHLCV       ------------------------------------------------------------
RL4_CHLPN       ------------------------------------------------------------
RL4_MYCMS       ------------------------------------------------------------
RL4_MESFL       ------------------------------------------------------------
RL4_SPIKU       ------------------------------------------------------------
RL4_MYCGA       ------------------------------------------------------------
RL4_UREPA       ------------------------------------------------------------
RL4_MYCPE       ------------------------------------------------------------
RL4_MYCGE       ------------------------------------------------------------
RL4_MYCPN       ------------------------------------------------------------
RL4_MYCH2       ------------------------------------------------------------
RL4_MYCPU       MVEVKKTTKTKSTEEKAPKITKATKEKTSDKTALKAKTPKTKVSDKAESTPKKASVKTSA
RL4_MYCS5       ------------------------------------------------------------
RL4_MYCMO       --MAEELKKTTKEKTPVKKSSKVSASKAPTKKVTKTTEVKKADKLEKVSKPKSESTKVSK
RL4_BACFN       ------------------------------------------------------------
RL4_BACTN       ------------------------------------------------------------
RL4_PORGI       ------------------------------------------------------------
RL4_SALRD       ------------------------------------------------------------
RL4_CHLCH       ------------------------------------------------------------
RL4_CHLTE       ------------------------------------------------------------
RL4_PELLD       ------------------------------------------------------------
RL4_TRIV2       ------------------------------------------------------------
RL4_SYNY3       ------------------------------------------------------------
RL4_THEEB       ------------------------------------------------------------
RL4_SYNE7       ------------------------------------------------------------
RL4_SYNJB       ------------------------------------------------------------
RL4_SYNJA       ------------------------------------------------------------
RL4_GLOVI       ------------------------------------------------------------
RL4_SYNSC       ------------------------------------------------------------
RL4_SYNPX       ------------------------------------------------------------
RL4_SYNS9       ------------------------------------------------------------
RL4_PROMM       ------------------------------------------------------------
RL4_PROMA       ------------------------------------------------------------
RL4_PROMT       ------------------------------------------------------------
RL4_PROM9       ------------------------------------------------------------
RL4_PROMP       ------------------------------------------------------------
RK4_PORPU       ------------------------------------------------------------
RK4_PYRYE       ------------------------------------------------------------
RK4_GRATL       ------------------------------------------------------------
RK4_TRICV       ------------------------------------------------------------
RK4_CYACA       ------------------------------------------------------------
RK4_CYAM1       ------------------------------------------------------------
RK4_GUITH       ------------------------------------------------------------
RL4_RHIEC       ------------------------------------------------------------
RL4_RHIME       ------------------------------------------------------------
RL4_AGRFC       ------------------------------------------------------------
RL4_BRUSU       ------------------------------------------------------------
RL4_RHILO       ------------------------------------------------------------
RL4_BARHE       ------------------------------------------------------------
RL4_BARQU       ------------------------------------------------------------
RL4_BRADU       ------------------------------------------------------------
RL4_RHOPB       ------------------------------------------------------------
RL4_RHOPA       ------------------------------------------------------------
RL4_RHOP2       ------------------------------------------------------------
RL4_NITWN       ------------------------------------------------------------
RL4_CAUVC       ------------------------------------------------------------
RL4_MAGSA       ------------------------------------------------------------
RL4_RHORT       ------------------------------------------------------------
RL4_JANSC       ------------------------------------------------------------
RL4_RUEPO       ------------------------------------------------------------
RL4_RHOS4       ------------------------------------------------------------
RL4_NOVAD       ------------------------------------------------------------
RL4_ZYMMO       ------------------------------------------------------------
RL4_GLUOX       ------------------------------------------------------------
RL4_RICPR       ------------------------------------------------------------
RL4_RICTY       ------------------------------------------------------------
RL4_RICFE       ------------------------------------------------------------
RL4_RICBR       ------------------------------------------------------------
RL4_ANAMM       ------------------------------------------------------------
RL4_ANAPZ       ------------------------------------------------------------
RL4_EHRCR       ------------------------------------------------------------
RL4_EHRRW       ------------------------------------------------------------
RL4_WOLPM       ------------------------------------------------------------
RL4_WOLTR       ------------------------------------------------------------
RL4_NEOSM       ------------------------------------------------------------
RL4_BDEBA       ------------------------------------------------------------
RL4_AQUAE       ------------------------------------------------------------
RL4_AQUPY       ------------------------------------------------------------
RL4_THET8       ------------------------------------------------------------
RL4_DEIRA       ------------------------------------------------------------
RL4_ANADE       ------------------------------------------------------------
RL4_SYNAS       ------------------------------------------------------------
RL4_GEOMG       ------------------------------------------------------------
RL4_GEOSL       ------------------------------------------------------------
RL4_PELCD       ------------------------------------------------------------
RL4_DESAG       ------------------------------------------------------------
RL4_DESVH       ------------------------------------------------------------
RL4_DESPS       ------------------------------------------------------------
RL4_ONYPE       ------------------------------------------------------------
RL4_FUSNN       ------------------------------------------------------------
RL4_BACLD       ------------------------------------------------------------
RL4_BACSU       ------------------------------------------------------------
RL4_BACCZ       ------------------------------------------------------------
RL4_BACSK       ------------------------------------------------------------
RL4_BACHD       ------------------------------------------------------------
RL4_GEOKA       ------------------------------------------------------------
RL4_LISMF       ------------------------------------------------------------
RL4_OCEIH       ------------------------------------------------------------
RL4_ENTFA       ------------------------------------------------------------
RL4_LACSS       ------------------------------------------------------------
RL4_LACPL       ------------------------------------------------------------
RL4_STRP3       ------------------------------------------------------------
RL4_STRT1       ------------------------------------------------------------
RL4_STRR6       ------------------------------------------------------------
RL4_LACLA       ------------------------------------------------------------
RL4_LACAC       ------------------------------------------------------------
RL4_LACJO       ------------------------------------------------------------
RL4_STAAR       ------------------------------------------------------------
RL4_STAS1       ------------------------------------------------------------
RL4_STAEQ       ------------------------------------------------------------
RL4_STAHJ       ------------------------------------------------------------
RL4_CARHZ       ------------------------------------------------------------
RL4_SYMTH       ------------------------------------------------------------
RL4_MOOTA       ------------------------------------------------------------
RL4_CLOPE       ------------------------------------------------------------
RL4_CLOTE       ------------------------------------------------------------
RL4_CLOAB       ------------------------------------------------------------
RL4_CALS4       ------------------------------------------------------------
RL4_THEMA       ------------------------------------------------------------
RL4_COREF       ------------------------------------------------------------
RL4_CORGL       ------------------------------------------------------------
RL4_CORDI       ------------------------------------------------------------
RL4_CORJK       ------------------------------------------------------------
RL4_NOCFA       ------------------------------------------------------------
RL4_MYCTU       ------------------------------------------------------------
RL4_MYCPA       ------------------------------------------------------------
RL4_MYCLE       ------------------------------------------------------------
RL4_MYCSM       ------------------------------------------------------------
RL4_STRAW       ------------------------------------------------------------
RL4_STRCO       ------------------------------------------------------------
RL4_FRACC       ------------------------------------------------------------
RL4_LEIXX       ------------------------------------------------------------
RL4_CUTAK       ------------------------------------------------------------
RL4_BIFLO       ------------------------------------------------------------
RL4_THEFY       ------------------------------------------------------------
RL4_TROWT       ------------------------------------------------------------
RL4_DEHMC       ------------------------------------------------------------
RL4_RHOBA       ------------------------------------------------------------
RL4_PSYCK       ------------------------------------------------------------
RL4_ACIAD       ------------------------------------------------------------
RL4_PSE14       ------------------------------------------------------------
RL4_PSEPK       ------------------------------------------------------------
RL4_PSEAE       ------------------------------------------------------------
RL4_HAHCH       ------------------------------------------------------------
RL4_HAEDU       ------------------------------------------------------------
RL4_HAEI8       ------------------------------------------------------------
RL4_ECOLI       ------------------------------------------------------------
RL4_PECAS       ------------------------------------------------------------
RL4_YERPS       ------------------------------------------------------------
RL4_PHOLL       ------------------------------------------------------------
RL4_MORMO       ------------------------------------------------------------
RL4_SHEON       ------------------------------------------------------------
RL4_VIBVY       ------------------------------------------------------------
RL4_VIBCH       ------------------------------------------------------------
RL4_PHOPR       ------------------------------------------------------------
RL4_COLP3       ------------------------------------------------------------
RL4_PSET1       ------------------------------------------------------------
RL4_IDILO       ------------------------------------------------------------
RL4_SACD2       ------------------------------------------------------------
RL4_HYDCU       ------------------------------------------------------------
RL4_COXBU       ------------------------------------------------------------
RL4_FRATT       ------------------------------------------------------------
RL4_XANOM       ------------------------------------------------------------
RL4_XYLFT       ------------------------------------------------------------
RL4_METCA       ------------------------------------------------------------
RL4_NITOC       ------------------------------------------------------------
RL4_AROAE       ------------------------------------------------------------
RL4_NITMU       ------------------------------------------------------------
RL4_DECAR       ------------------------------------------------------------
RL4_CUPPJ       ------------------------------------------------------------
RL4_RALSO       ------------------------------------------------------------
RL4_BURL3       ------------------------------------------------------------
RL4_BORA1       ------------------------------------------------------------
RL4_RHOFT       ------------------------------------------------------------
RL4_THIDA       ------------------------------------------------------------
RL4_NEIG1       ------------------------------------------------------------
RL4_CHRVO       ------------------------------------------------------------
RL4_NITEU       ------------------------------------------------------------
RL4_BLOFL       ------------------------------------------------------------
RL4_BLOPB       ------------------------------------------------------------
RL4_BUCAI       ------------------------------------------------------------
RL4_BUCAP       ------------------------------------------------------------
RL4_BUCBP       ------------------------------------------------------------
RL4_WIGBR       ------------------------------------------------------------
RL4_LEGPL       ------------------------------------------------------------
RL4_PELUB       ------------------------------------------------------------
                                                                            

RL4_TREDE       --------------------------MEKKVYSVDGKELRTINLDDKVFGLPV-----ND
RL4_TREPA       --------------------------MEKTVYSVEGVALRSVELDESVFGLSV-----NR
RL4_BORBP       --------------------------MERKVFSKDGKEIGTINLDDRVFNIEI-----SH
RL4_BRAPL       --------------------------MEVVILNENGDSVGNLEVVDEIFKSEV-----NN
RL4_LEPIC       --------------------------MKAQKYSKEGKLISEIELPSALFESKL-----SV
RL4_HELHP       -------------------------MSKAILLDKKLQQSNELALPERYAQIKEHN---LY
RL4_WOLSU       -------------------------MSKAIILNNELQKNGEVALPERFKEIHSHN---LY
RL4_HELPJ       -------------------------MSKAIVLDSHLKEKGSVELPKRYEGINSHN---LY
RL4_SULDN       --------------------------MSAIVLNEKMEKASELALPESFSGINPHN---LY
RL4_CAMJR       -------------------------MSKVVVLNDKLEKAGELDLPSKYAEVNPHN---LY
RL4_CHLTA       -------------------------MVLLSKFDFSGKESGKFELPDAFFTEGKE------
RL4_CHLMU       -------------------------MVLLSKFDFSGKESGKVELPDAFFAEGKE------
RL4_CHLAB       -------------------------MVLLSKFDFFGNKAGEVELPDAFFAQEGSG---L-
RL4_CHLFF       -------------------------MVLLSKFDFFGNKAGEVELPDAFFAQEGNG---L-
RL4_CHLCV       -------------------------MVLLSKFDFSGNKAGEVELPDAFFVQEGNG---L-
RL4_CHLPN       -------------------------MVLLSKFDFSGNKIGEVEVADSLFADEGDG---L-
RL4_MYCMS       --------------------------MKLQVLDIKGNEIKEIALNDYVWGIE-----PHQ
RL4_MESFL       --------------------------MELKVLNVQGQEVKTISLNDSVWNVA-----PHK
RL4_SPIKU       --------------------------MKLQVLDANGTSVKEISVNDAIWGIE-----PHQ
RL4_MYCGA       -------------------------MSKIKLF-DLSGKVQEEIELNQKLLVS----EVHK
RL4_UREPA       -------------------------MAKIKLL-SIDGNFAKELEVTSDLFVE----VPHK
RL4_MYCPE       -------------------------MSSVKLFKDLLGNTETVELKNKKLFISD--KKINH
RL4_MYCGE       -------------------------MAKLKVI-QFDGSFKGE-IQPANHLLL---KKAVI
RL4_MYCPN       -------------------------MAKLKLI-KIDGSFETEPVKLSPGLIA---KELKQ
RL4_MYCH2       --------------MNKISEISIQ---SQKTENL-VKFNANDDLPKSLFEQKE--P--HF
RL4_MYCPU       KAEKINVEKTEKVEKVNVEKVSIKRESSSKDVQK-ADFSNIKELNSKIFEFEK--N--YD
RL4_MYCS5       -----MAEVKNKKASVATPEKETVVVQKDKAAAL-VKPQFNAQVDKRML-VEE--V--HQ
RL4_MYCMO       VSVKSVKTESIKSEPVKTKKSKIKVLSSKTNEAKNILFKNTVSLPKGIFGLSE--EKINT
RL4_BACFN       -------------------------MEVNVYNIKGEDTGRKVTLNESIFGIEP-----ND
RL4_BACTN       -------------------------MEVNVYNIKGEDTGRKVTLNESIFGIEP-----ND
RL4_PORGI       -------------------------MELSVYNIKGEDTGKKVVLDDSIFAIEP-----ND
RL4_SALRD       -------------------------MDVEIYQEDGVESGETAALDPTVFDIEP-----ND
RL4_CHLCH       -------------------------MELKVLNTAGTETGEVVILRDDIFGIEI-----SE
RL4_CHLTE       -------------------------MELKVLNIQGAETGEVVTLNDEIFAVEV-----SE
RL4_PELLD       -------------------------MELKVLNTAGAETGEVVTLRDDIFGAEV-----SE
RL4_TRIV2       -------------------------MVESVVKNWQGEQVGQKTFELRVAKETT-----AA
RL4_SYNY3       -------------------------MVDCIVKNWQGEEVGNASLTLRVAKEEN-----AA
RL4_THEEB       -------------------------MVACVVKDWQGADSGEATLDLATAKPET-----AS
RL4_SYNE7       -------------------------MVDYVIQDWQGQTAGNITVELRVAKEES-----AA
RL4_SYNJB       -------------------------MASCVVKNWQGETVGSAELSLKVARPET-----AA
RL4_SYNJA       -------------------------MASCVVKNWQGETVGSAELSLKVARPET-----AS
RL4_GLOVI       -------------------------MATCSIKDWQGNATGEVDLDLPVASAAT-----AS
RL4_SYNSC       -------------------------MASCVVRDWQGKEAGKATLDLKVAKETT-----AV
RL4_SYNPX       -------------------------MADCVIRDWQGKEAGKATLDLKVAKETT-----AN
RL4_SYNS9       -------------------------MASCVVRDWQGKEAGKATLDLKVAKEAS-----AV
RL4_PROMM       -------------------------MAECVVHDWQGKEAGKASLELKVSKETT-----AV
RL4_PROMA       -------------------------MANCAVLDWQGKEAGKASLNLKVAKDSS-----AV
RL4_PROMT       -------------------------MTNCTVLDWQGKEAGESSIDLKTAKESS-----AA
RL4_PROM9       -------------------------MTTIETLKWDGKKSGEVKLDLTVAKETS-----SA
RL4_PROMP       -------------------------MTTLETLKWDGKKAGKVSIDLKVAKETS-----SA
RK4_PORPU       -------------------MTVKTQLNYQVYNW-EGQVSGNADLNLKISKDSG------M
RK4_PYRYE       -------------------MTVNTQLNYQVYNW-EGQVSGNADLNLKVSQDSG------M
RK4_GRATL       -------------------MNIKKKLIYSIISSKDTKEKESEEIVVKLSKQSNK----KI
RK4_TRICV       -------------------MTVQKFITYNSVDINGKTLSDEYKLELNVLEKSG------N
RK4_CYACA       ---------------MKFMVTEQKTLIYPVINLITGQHN-YIGFKCRISTNNA------N
RK4_CYAM1       -------------------MRCQVRL----------------EIFYELNEQEQH----MK
RK4_GUITH       -------------MGSNKIKNLVQYEIQDFVSLNKMDTKSHDSLNLNVSKKSR-------
RL4_RHIEC       -------------------------MELNVKTLEGKD-AGKVSLSDEIFGLEP-----RE
RL4_RHIME       -------------------------MDLTVKTLEGKD-AGKVSLSDAIFGLEP-----RE
RL4_AGRFC       -------------------------MELNVKTLEGKD-AGKVSLSDEIFGLDP-----RQ
RL4_BRUSU       -------------------------MDLTITTLEGKD-AGKVKLNEEIFGLDP-----RD
RL4_RHILO       -------------------------MDLKITTLGGKD-AGKVKLSEEIFGLDP-----RE
RL4_BARHE       -------------------------MDLLIKTLDGNE-VGKLKVSESVFGLVP-----RE
RL4_BARQU       -------------------------MDLVIRTLDGNE-AGRLKVSESIFGLVP-----RE
RL4_BRADU       -------------------------MELKVTTLEGKE-AGSVQLSDAIFGLEP-----RQ
RL4_RHOPB       -------------------------MELKVTTLEGKE-AGSVQLSDEIFGLDP-----RV
RL4_RHOPA       -------------------------MELKVTTLEGKE-AGSVQLSDEIFGLEP-----RS
RL4_RHOP2       -------------------------MELKVTTLEGQE-AGSVQLSDAIFGLEP-----RN
RL4_NITWN       -------------------------MELNVTTLEGKA-AGSVHLSDGIFGLEP-----RK
RL4_CAUVC       -------------------------MKLDVIKLDGGK-AGSVDLDDAIFGIDEI----RG
RL4_MAGSA       -------------------------MKTNVISLDNQT-VGEIELADEIFGVPV-----RG
RL4_RHORT       -------------------------MKCDVKTLDGKD-AGSIELSDSVFGLPV-----RT
RL4_JANSC       -------------------------MKVDVIKLDGKK-AGSVDLDEALFGLEP-----RA
RL4_RUEPO       -------------------------MKLDVIKLDGTK-AGNIDLDEALFGLEP-----RA
RL4_RHOS4       -------------------------MKAEVIKLDASP-AGSIELDDAIFGLEP-----RA
RL4_NOVAD       -------------------------MKVQVLNLDGTAGKGEVELSDDVFGLEP-----RA
RL4_ZYMMO       -------------------------MKVEVQSLDASK-KGSIELNDAVFGIEP-----RA
RL4_GLUOX       -------------------------MEYDIKTLDNGS-AGSVALPEEIFAVTP-----RS
RL4_RICPR       -------------------------MKTKILSLANEE-VGEITLNKDIFAVEFI----RD
RL4_RICTY       -------------------------MKTKILSLANEE-VGEITLNKDIFAVEFI----RD
RL4_RICFE       -------------------------MKTKILSLANEE-VGEISLNEDIFAVEFI----RD
RL4_RICBR       -------------------------MKTKILNLANEE-IGEISLNEDIFAVEFI----RD
RL4_ANAMM       -------------------------MEVNVVNIKNEV-VGKVQLSAEVFGVQL-----RR
RL4_ANAPZ       -------------------------MEVNIVNIANEV-VGSIDLNPQVFGLEP-----RR
RL4_EHRCR       -------------------------MEVNIINVNSDR-IGTIDLNPLIFSVNY-----RP
RL4_EHRRW       -------------------------MEVNVINIESQN-IGKIDLNPLIFSVNY-----RP
RL4_WOLPM       -------------------------MECNLVNLSNDN-VGAAQLNPLIFSAKQ-----KL
RL4_WOLTR       -------------------------MECKLVNLSNND-VGTTQLNPLIFSVEQ-----KL
RL4_NEOSM       ----------------------MSSLEVGVLDFGASSLAGSVAVDRALIEAPF-----RP
RL4_BDEBA       ------------------------MATVNVLNWKKEK-VGSVELAADVFETPV-----KK
RL4_AQUAE       ------------------------------MKIGDVE-------VRDDVFNVKV----KK
RL4_AQUPY       ------------------------------MKIGDVE-------VRDDVFNVKV----KK
RL4_THET8       -------------------MKEVAVYQIPVLSPSGRR-------ELAADLPAEI----NP
RL4_DEIRA       ------------------------MAQINVIGQNGGR-------TIELPLP-EV----NS
RL4_ANADE       ------------------------MAKFDVYDLSKKK-VGELDLADAVFAGEV-----NE
RL4_SYNAS       --------------MKLRYSRVNKMLVAEVFDINKNK-VSEIELNDAVFGAEV-----ND
RL4_GEOMG       ------------------------MATIDVFDINKNK-VGEMDLSDAVFNGDV-----RE
RL4_GEOSL       ------------------------MATIDVFDISKNK-VGVMDLNDNVFNGEV-----KE
RL4_PELCD       ------------------------MAKIAVYDINRNQ-VSERELSDEVFNAEV-----KE
RL4_DESAG       ------------------------MAVVKVYDQDKKE-TGELTLAPEVFEVEV-----RP
RL4_DESVH       ------------------------MAVVKVYDQNKQE-AGEITLAPEVFEVEV-----RP
RL4_DESPS       --------------------MERIMSTVSVVNTNNEK-VDEIELNDAIFNREV-----KE
RL4_ONYPE       ------------------------MPKINILNQQGDF-VSEKVLATTVFDIKP-----NQ
RL4_FUSNN       ------------------------MAVLNIYNLAGEQ-TGTVEVNDAVFGIEP-----NK
RL4_BACLD       ------------------------MPKVALYNQNGST-AGDIELNDSVFGIEP-----NE
RL4_BACSU       ------------------------MPKVALYNQNGST-AGDIELNASVFGIEP-----NE
RL4_BACCZ       ------------------------MPKVTVYNQTGSQ-VGEIELAEAIFGIEP-----NE
RL4_BACSK       ------------------------MPKVSLFNQTGSQ-VGEIELADNVFGVEP-----NE
RL4_BACHD       ------------------------MPKVALYNQAGSQ-VGDIELSDAVFGIEP-----NE
RL4_GEOKA       ------------------------MPKVALYNQNGQT-VGEIELNDAVFGIEP-----NK
RL4_LISMF       ------------------------MPKLSLLKQDGTN-AGEITLNDTVFGIEP-----NE
RL4_OCEIH       ------------------------MPKVALLKQDGSN-VGDIELNDSVFGIEP-----NT
RL4_ENTFA       ------------------------MPNVALFKQDGTQ-NGEITLNEEIFGIEP-----NE
RL4_LACSS       ------------------------MANVTLFKQDGSQ-NGNVELNDSIWAIEP-----NE
RL4_LACPL       ------------------------MTSVALFKQDGTQ-NGDVTLNDAVFGVEP-----NE
RL4_STRP3       ------------------------MANVKLFDQTGKE-VSSVELNDAIFGIEP-----NE
RL4_STRT1       ------------------------MANVKLFDQTGKE-VSTVELNDAIFGIEP-----NE
RL4_STRR6       ------------------------MANVTLFDQTGKE-AGQVVLSDAVFGIEP-----NE
RL4_LACLA       ------------------------MAKVSLFKQDGSQ-AGEVTLNDSVFGIEP-----NE
RL4_LACAC       ------------------------MANLKVMDQNGKD-SGEVTLNDKVFGIEP-----ND
RL4_LACJO       ------------------------MANLEIIDQKGKS-AGNVDLNEEIFGIEP-----NE
RL4_STAAR       ------------------------MANYDVLKLDGTK-SGSIELSDAVFGIEP-----NN
RL4_STAS1       ------------------------MANYDVLKVDGTK-SGSVELSDAVFAIEP-----NN
RL4_STAEQ       ------------------------MANYDVLKVDGSK-SGSVELNDAVFAIEP-----NN
RL4_STAHJ       ------------------------MANYDVLKVDGSK-SGSVELSDSVFAIEP-----NN
RL4_CARHZ       ------------------------MPKVPVYNMEGAQ-VGEIELKDEIFGAPV-----NK
RL4_SYMTH       ------------------------MPKVAVYNKEGAT-VGEITLSDAVFGAEV-----NP
RL4_MOOTA       ------------------------MPRVALYNIQGQQ-VGEVDLDDSVFGGEV-----NE
RL4_CLOPE       ------------------------MPKVGLFNKEGQQ-VGDIQLNEQVFGVEV-----NK
RL4_CLOTE       ------------------------MPTVGLFNKEGQK-VGDFQLSDKVFGVEV-----NK
RL4_CLOAB       ------------------------MPTVEVFNKEGKK-VEDIELSEKVFGAKI-----SE
RL4_CALS4       ------------------------MPKVPVYNVKGEQ-VGEIELKDSVFGVPV-----NV
RL4_THEMA       ------------------------MAQVDLLNVKGEK-VGTLEISDFVFNIDP-----NY
RL4_COREF       -------------MTNLTLDVQT----------AEGTTNGSVDLPAEIFDRE-----VSV
RL4_CORGL       -------------MTNLKLDVQT----------ADGNINGSVELPAEIFDRE-----VSV
RL4_CORDI       -------------MTNLKLDVLT----------AEGKTDGQVELPAEIFDRE-----ASV
RL4_CORJK       -------------MSNLKLDVHT----------ADGKTNGTVELPASIFDAE-----ASV
RL4_NOCFA       -MSAVSTQKDTEKKANLVLPVKE----------AGGKSNGTVELPAEIFDVT-----ANI
RL4_MYCTU       -----MAAQEQK---TLKIDVKT----------PAGKVDGAIELPAELFDVP-----ANI
RL4_MYCPA       -----------M---ALKLDVKA----------PGGKVEGSIELPAELFDAP-----ANI
RL4_MYCLE       -----MAAKVENGSNIRKIDVKT----------PDGKVDGTIELPAELFDAP-----ANI
RL4_MYCSM       --------------MTLKVDVKT----------PAGKTDGSVELPAELFDVE-----PNI
RL4_STRAW       ---------------MSTIDILS----------PSGDNAGTVELPAEIFDVEK----ISI
RL4_STRCO       ---------------MSTVDILS----------PAGEKTGSVELPAEIFGVEK----ISI
RL4_FRACC       ---MSRVATSDPSVTARTVAVHA----------PNGGEGGSVELPGGVFDVP-----LNI
RL4_LEIXX       --------------MATSIDVVD----------LKGKKAGSIELPDSLFDVQ-----TNI
RL4_CUTAK       ------------MNETKTIDVLD----------VKGKKAGSAELPGDLFDVN-----TNI
RL4_BIFLO       -------------MANVTLNVTD----------AKGQATGTVEAPEALFGVSAEDVQAHI
RL4_THEFY       ---------------MATIEVKD----------REGAAKGSVELPDEIFAQK-----VNI
RL4_TROWT       --------------MSPSATVFD----------IGGNAVGTLQLVGHLFDSD-----PNL
RL4_DEHMC       ----------------MEIPVYN----------ASGEIVKNINISEDVFGVP-----FNE
RL4_RHOBA       ---------------MANLPILD----------ASGKEVGQYEIDTEQIANR-----VSK
RL4_PSYCK       -----------------------MDLK------TVTG--AAVELSDTAFGRE-----FNE
RL4_ACIAD       ------------------MRGNNVNLK------TVSG--SAVELSEVAFGRE-----FNE
RL4_PSE14       ---------------------MQLNVN------DAQ----AIEVSELTFGGE-----FNE
RL4_PSEPK       ---------------------MQLNVN------DAQ----AIEVSELTFGGE-----FNE
RL4_PSEAE       ---------------------MQLNVN------GAQ----AIEVSERTFGGE-----FNE
RL4_HAHCH       ---------------------MELTIN------GAGK--GTVSVSDVAFARD-----FNE
RL4_HAEDU       ---------------------MELQV-------VGAN--A-LTVSETTFGRE-----FNE
RL4_HAEI8       ---------------------MELQV-------VGAN--A-LTVSETTFGRE-----FNE
RL4_ECOLI       ---------------------MELVL-------KDAQ--SALTVSETTFGRD-----FNE
RL4_PECAS       ---------------------MELVL-------KDAQ--SALTVSETTFGRD-----FNE
RL4_YERPS       ---------------------MELVM-------KDAP--GALTVSETTFGRD-----FNE
RL4_PHOLL       ---------------------MELVM-------KDAQ--GALTVSETTFGRD-----FNE
RL4_MORMO       ---------------------MELVM-------KDAQ--S-LTVSETTFGRD-----FNE
RL4_SHEON       ---------------------MELVL-------KDAQ--SALEVSETTFGRD-----FNE
RL4_VIBVY       ---------------------MELMV-------KGAA--A-LTVSEATFGRE-----FNE
RL4_VIBCH       ---------------------MELMV-------KGAN--A-LTVSETTFGRE-----FNE
RL4_PHOPR       ---------------------MELVV-------KGAD--A-LTVSETTFGRD-----FNE
RL4_COLP3       ---------------------MELSL-------KDAS--GALEVSEATFGRE-----FNE
RL4_PSET1       ---------------------MELAI-------KDAS--GGLEVSEATFGRE-----FNE
RL4_IDILO       ---------------------MELTL-------KDAK--GALEVSEATFGRE-----FNE
RL4_SACD2       ---------------------MELSIATP----QGAK--GTVSVSEAAFGRE-----FNQ
RL4_HYDCU       ---------------------MDLKLIEL----ASGKEAGSVKVSEAIFGAE-----FNE
RL4_COXBU       ---------------------MELPVNSF----DKKE-ASTLTVADSAFGSE-----YKE
RL4_FRATT       ---------------------MDLNIKSL----AGQE-AGSLGVAEGVFAAD-----YNE
RL4_XANOM       ---------------------MELVI-------TGSN--NKVSVSEAVFGRE-----FSE
RL4_XYLFT       ---------------------MDLTI-------VGSD--NTLPVSDVVFGRE-----FSE
RL4_METCA       ---------------------MSLSIPKI-----ENGAAGDLEVSDKVFGQG-----FNE
RL4_NITOC       ---------------------MNLAVQSL----AENSETGMTQLSDTVFTQH-----FNE
RL4_AROAE       ---------------------MELKLLN-----DQGAQSATLQASDALFGRD-----YNE
RL4_NITMU       ---------------------MELKLID-----YNGQSSASVSASETLFGRE-----YNE
RL4_DECAR       ---------------------MELKVIN-----EQGQEAAKLQASDVLFGRD-----FNE
RL4_CUPPJ       ---------------------MELKLLQ-----DNGQVGAGVAASPEVFGRD-----YNE
RL4_RALSO       ---------------------MELKLLQ-----ADGQLGTGVSASPEVFGRD-----YNE
RL4_BURL3       ---------------------MELKLLN-----ENGQEGAVVNASDVVFGRD-----YNE
RL4_BORA1       ---------------------MDLKLLN-----DQGQ-AATFSAPDTIFGRD-----FNE
RL4_RHOFT       ---------------------MQLELLN-----DQGLATAKYEAPETVFGRA-----YNE
RL4_THIDA       ---------------------MDLTVIN-----DRGEQVASVAASDETFGRD-----YNE
RL4_NEIG1       ---------------------MELKVID-----AKGQVSGSLSVSDALFARE-----YNE
RL4_CHRVO       ---------------------MELNVIN-----TQGKAVGSLQVSDALFGRE-----YNE
RL4_NITEU       --------------------MVKIPCIY-----ENGQ-IEDIEASESVFGRV-----YNE
RL4_BLOFL       ---------------------MKLQLQCFLINDLEKYNCINVSVSDKVFGYP-----FNP
RL4_BLOPB       ---------------------MELEVRDF-TTEINILDSEKFSVSDEIFKCP-----FNQ
RL4_BUCAI       ---------------------MELVVKD---------VQNVLSVSEIIFARD-----FNE
RL4_BUCAP       ---------------------MELVIKD---------VPSLLSVSEIIFGRD-----FNE
RL4_BUCBP       ---------------------MELVLRDD--------EHSVLNVSDITFGRD-----FNE
RL4_WIGBR       ---------------------MELLCID---------SKEKVKISEKIFGQK-----FNE
RL4_LEGPL       ---------------------MEITTID---------TKSKLKLNKEIFAYT-----YNE
RL4_PELUB       -------------------------MKIDKLNLDGKK--DSIEVLDKIFSAKI-----NK
                                                                            

RL4_TREDE       DVIYYAINNELANKRVGTACTKGRAEVHGSNSKPYSQKGTGRARRGDKKSPLLVGGGTIF
RL4_TREPA       GVIYYAINSELSNKRLGTACTKGRSEVHGSNTKPYKQKGTGRARRGDKKSPLLVGGGTIF
RL4_BORBP       GSIYNAIKNELSNLRVGTSSTKTRSEVRGSSKKPWKQKGTGRARVGTKRNPIWIGGGIAL
RL4_BRAPL       NLLYEAIKNELANRRQGTHSTKTRAEVSGGGKKPWRQKGTGRARAGSTRSPIWVGGGKTH
RL4_LEPIC       ASIYEAIKAENANLRSGNHATKTRSMVSGGGKKPWSQKGTGRARQGSTRAPHWVGGGTVH
RL4_HELHP       LYVKSYLSSLRAN----SASAKKRGEVSGGGKKPWKQKGGGRARAGSITSPVFVGGGVSH
RL4_WOLSU       LYVKSYLASLRAN----SAKAKKRGEVSGGGKKPWSQKGGGRARAGSITSPVFVGGGVSH
RL4_HELPJ       LYVKHYLSSARAN----TAKSKNRAEVSGGGRKPWAQKGGGRARAGSITSPVFVGGGVSH
RL4_SULDN       LYVKSAQAAMRAN----SASALTRAEVRGGGKKPWAQKGGGRARAGSRRSPVFVGGGKAF
RL4_CAMJR       LYVKSYLASLRAN----TAHTKGRSDVSGGGKKPWRQKGRGGARAGSTRTNVWVGGAVAF
RL4_CHLTA       QSVKDYLVAIQANKRQWSACTRGRSEVSHSTKKPFRQKGTGNARQGCLAAPQFRGGGIVF
RL4_CHLMU       QSVKDYLVAIQANKRQWSACTRGRSEVSHSTRKPFRQKGTGNARQGCLAAPQFRGGGIVF
RL4_CHLAB       QLVKDYLVAIRANKRQWSACTRNRSEVSHSTKKPFRQKGTGNARQGCLAAPQFRGGGIVF
RL4_CHLFF       QLVKDYIVAIRANKRQWSACTRNRSEVSHSTKKPFRQKGTGNARQGCLAAPQFRGGGIVF
RL4_CHLCV       QLVKDYLVAIRANKRQWSACTRNRSEVSHSTKKPFKQKGTGNARQGCLASPQFRGGGVVF
RL4_CHLPN       QLIKDYIVAIRANKRQWSACTRNRSEVSHSTKKPFKQKGTGNARQGCLASPQFRGGGIVF
RL4_MYCMS       QAIYDTVISQQAALRQGTKKVKTRAEVSGGGRKPWKQKGTGRARQGSIRAPQWKGGGVTF
RL4_MESFL       QAIYDTVISQQAALRQGTKKTKTRAEVRGGGKKPWRQKGTGRARQGSIRAPHWRGGGVTF
RL4_SPIKU       QAMFDAVIAQQASMRQGTHKTKTKTEVSGGGRKPWRQKGTGRARQGSIRAPQWKGGGIVF
RL4_MYCGA       QAIFDAILAENLSQIQGTHSTLKKGEVSGGGKKPYQQKHTGRARQGSIRNPHYVGGGIAF
RL4_UREPA       QAMFDSVLAENAAERQGTHSTLTKGEVRGGGKKPWRQKHTGKARTGSTRNPHWTGGGVVF
RL4_MYCPE       QEIFNSVLVEEANSRQSTASTLTKAEVRGGGRKPYKQKHTGRARQGSIRNPHYVGGGRAF
RL4_MYCGE       QPVFDAILLEQAACRQGTHSTLTKGEVSGGGKKPYKQKHTGKARQGSIRNPHYVGGGVVF
RL4_MYCPN       QPVFDAVLVEQASWRQGTHSILTKGEVRGGGKKPYKQKHTGKARQGSTRNPHFVGGGIVF
RL4_MYCH2       QAIFDSILSERASKRLSTHKVKNRAEVSGTGKKPWKQKSTGKARAGSKRSPIFVGGGRAF
RL4_MYCPU       QAIFDCILSERASRRQGTHKVKNRAEVSGTGKKPWKQKGTGKARAGSLRNPIFVGGGRAF
RL4_MYCS5       QAIFDSILSERASRRQGTHQVKNRAAVSGSGKKPWKQKGTGRARHSSRRSPIWVGGGRAF
RL4_MYCMO       QAIFDSILFERASQRQGTHSTKTRSEVSGGGKKPWKQKGTGRARAGSTRSPIWVGGGITF
RL4_BACFN       HAIYLDVKQFMANQRQGTHKSKERSEISGSTRKIGRQKGGGGARRGDMNSPVLVGGGRVF
RL4_BACTN       HAIYLDVKQFMANQRQGTHKSKERSEISGSTRKIGRQKGGGGARRGDMNSPVLVGGARVF
RL4_PORGI       HAIYLDVKQYMANQRQGTHKAKERSELSGSTRKLIRQKGSGGARRGDINSPLLSGGARVF
RL4_SALRD       HIIWLDVKRIQAHQRQGTSKTKERGEVRGSGRKLYRQKGTGNARVGDAQSPIRRGGGRAH
RL4_CHLCH       HAMYLDVKSILANKRQGTHKAKTRSEVRGGGKKPFRQKGTGNARQGSSRSPIHVGGGTIF
RL4_CHLTE       HAMYLDVKAILANRRQGTHKAKTRAEVRGGGKKPFRQKGTGNARQGSTRSGLMVGGGAIF
RL4_PELLD       HAIWLDVKSILANKRQGTHKSKTRAEVRGGGRKPYRQKGTGNARQGSTRSPLMIGGGTIF
RL4_TRIV2       HIVHRALVRQQTNARQGTASTKTRAEVRGGGRKPWRQKGTGRARAGSIRSPLWRGGGVIF
RL4_SYNY3       HIVHRALVRQQNNARQGNASAKTRAEVRGGGRKPWKQKGTGRARAGSIRSPLWRGGGVIF
RL4_THEEB       HIVHRALVRQLANARQGTVSTKTRAEVRGGGRKPWRQKGTGRARAGSIRSPLWRGGGVIF
RL4_SYNE7       AIVHRALIRQLANARQGTHASKTRSEVRGGGRKPWKQKGTGRARAGSIRSPLWRGGGVIF
RL4_SYNJB       HILYLALRRQMTNARQGNAHTKTRAEVRGGGRKPWKQKGTGRARAGSIRSPLWRKGGVIF
RL4_SYNJA       HILYLALRRQMTNARQGNAHTKTRAEVRGGGRKPWRQKGTGRARAGSIRSPLWRKGGVIF
RL4_GLOVI       HVVYLAFKRQMVNSRQGTASTLTRGEVRGGGRKPWKQKGTGRARAGSIRSPLWRKGGVIF
RL4_SYNSC       DLMHRAVLRQQAHARQGTASTLTRSEVRGGGRKPYKQKGTGRARQGSIRTPLKPGGGIIF
RL4_SYNPX       DLMHRAVLRQQAHARQGTASTLTRSEVRGGGRKPYKQKGTGRARQGSIRTPLRPGGGIVF
RL4_SYNS9       DLMHRAVLRQQAHMRQGTASTLTRSEVRGGGRKPYKQKGTGRARQGSVRTPLRPGGGIIF
RL4_PROMM       DLMHRAVLRQQAHSRQGTASTLTRAEVRGGGRKPYKQKGTGRARQGTIRTPLRPGGGIIF
RL4_PROMA       DLMHRAVLRQQAHSRQGTASTLTRAEVRGGGRKPYKQKGTGRARQGSIRTPLRPGGGIIF
RL4_PROMT       DLLHRAVLRQQAHSRQGTASTLTRSEVRGGGRKPYKQKGTGRARQGSIRTPLRPGGGIIF
RL4_PROM9       DLIHRAVLRQLANKRQGTASTLTRSEVRGGGRKPYKQKGTGRARQGSIRTPLRPGGGIIF
RL4_PROMP       DLIHRAVLRQLANKRQGTASTLTRSEVRGGGRKPYKQKGTGRARQGSIRTPLRPGGGVIF
RK4_PORPU       YLVHRALVKQSNEKRQGSANTKTRSEVRGGGRKPWRQKGTGRARAGSIRSPLWRGGGVIF
RK4_PYRYE       YLVHRALVKQSNEKRQGSANTKTRSEVRGGGRKPWRQKGTGRARAGSIRSPLWRGGGVIF
RK4_GRATL       YILHRALIHQLSNHRNRNAHTQTRGEVSGGGRKPWKQKGTGRARAGSNRSPLWRGGGVIF
RK4_TRICV       YLIHKDILRHQSSQRQGTISTKTRSEVRGGGRKPWRQKGTGRARAGSSRSPLWKGGGVIF
RK4_CYACA       YVVHRVFSIQNKLSREHTASTKTKSQVRGGGKKPWKQKGTGRARAGSIRSPLWRGGGVVF
RK4_CYAM1       HLLHRALRTHMLSIRQWGAHTKTRAEIRGGGRKPWKQKGTGRARAGSRRSPLWRGGGVAF
RK4_GUITH       YLLHRVLTNQLINNRSGNACTKTRSEVEGGGKKPWKQKGTGNARAGSSNSPLWKGGGVTF
RL4_RHIEC       DILARVIRWQLAKKQQGTHKAKGRAEVSRTGAKMYKQKGTGRARHHSARAPQFRGGGKAH
RL4_RHIME       DIIARVVRWQLAKRQQGTHKSKGRAEVSRTGAKMYKQKGTGRARHHSARAPQFRGGGKAH
RL4_AGRFC       DILARMVRWQLAKKQQGTHKTKNRSEVSRTGAKMYKQKGTGRARHHSARAPQFRGGGKAH
RL4_BRUSU       DILQRVVRWQLARRQQGSHKAQGRGDVSRTGSKMYKQKGTGRARHHSARAPQFRGGGQAH
RL4_RHILO       DILQRVVRWQLAKKQQGTHKAKGRAEIARTGAKMYKQKGTGRARHHSARAPQFRGGGKAH
RL4_BARHE       DILQRVVRWQLARRQQGTHQSQGRSDVSRTGAKMFKQKGTGRARHSSARAPQFRGGGKAH
RL4_BARQU       DILQRVVRWQLARHQQGTHHSQGRSDVSRTGAKMFKQKGTGRARHSSARAPQFRGGGKAH
RL4_BRADU       DIIARCVQWQLNKRQAGTHKAKGRAEIWRTGKKMYKQKGTGGARHGSARVPQFRGGGRAF
RL4_RHOPB       DIIQRCVNWQLAKRQAGTHKAKGRAEVWRTGKKMYKQKGTGGARHGSQRVPQFRGGGRAF
RL4_RHOPA       DIIQRCVIWQLAKRQAGTHKAKGRAEVWRTGKKMYKQKGTGGARHGSQRVPQFRGGGRAF
RL4_RHOP2       DIVQRCVIWQLAKRQAGTHKAKGRAEVWRTGKKMYKQKGTGGARHGSQRVPQFRGGGRAF
RL4_NITWN       DLIQRCVNWQLAKSQAGTHKTKGRAEIWRTGKKLFKQKGTGNARHGSARAPQFRGGGRAF
RL4_CAUVC       DILQRVVTWQLAKRRSGNHKIQVRNEVSRTSKKMYKQKGTGGARHGSRRAAQFVGGAKAH
RL4_MAGSA       DILFRAVNWQLAKRQSGNHKTKTISEISGTTKKPFAQKGGGRARQGSLRSAQFRGGSTIF
RL4_RHORT       DLLHRMVRWQLARRQAGTHKTKGISEISGTTAKPFKQKGTGHARQGSKRSPQFRGGATIF
RL4_JANSC       DILHRVVRWQRNNAQAGTHKVKTRREVSYSTKKIYRQKGTGGARHGARSAPIFRGGGVYK
RL4_RUEPO       DILHRVVRWQRNNAQAGTHKVLTKSEVSYSTKKIYRQKGTGGARHGSRKSPTFRHGGVYK
RL4_RHOS4       DILHRVVRWQRAKAQAGTHSVLGKSDVSYSTKKIYRQKGTGGARHGSKKAPIFRHGGVYK
RL4_NOVAD       DILHRVVTWQLENRRGIARKARERSDVARTGKKFGRQKGGGTARHGDRKAPIFIGGGKAH
RL4_ZYMMO       DILHRVVTWQLEKRRAPTRATRERSDVARSGKKFGRQKGGGTARHGDRRSPIFIGGGKAH
RL4_GLUOX       DIMARVVHWQLAKRRAGTHRTKGMGEISGTTKKPYRQKGTGSARQGSLRAPQFRTGGVVH
RL4_RICPR       DIIKQVIDWQRAKAMFGNHKTKTVSEVSGTTKKPFKQKGTGNARQGSLRSVQMRGGGISH
RL4_RICTY       DIIKQVIDWQRAKAMSGNHKTKTVSEVSGTTKKPFKQKGTGNARQGSLRSIQMRGGGISH
RL4_RICFE       DIIKQVIDWQRAKAMSGNHKTKTVSEVSGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAH
RL4_RICBR       DIIKQVVDWQRAKAMAGTHKTKTVSEVSGTTKKPFKQKGTGNARQGSLRSVQMRGGGVIH
RL4_ANAMM       DVLRDVVTWQLAKRRAGTHKTRCISDVSGTTAKPYRQKHTGRARQGSLRSPQFRGGAVVF
RL4_ANAPZ       DVLKEVVNWQLAKRRAGTHKAKGISDISGTTAKPYRQKHTGRARQGSLRSPQFRGGAVIF
RL4_EHRCR       DILKMVVDWQLSKRRAGTHKAKTIGDISGTTAKPHRQKHTGRARQGSLRSPQFRGGAVIF
RL4_EHRRW       DILKMVVEWQLSKRRIGAHKTKTIGDVSGTTAKPYRQKHTGRARQGSLRSPQFRGGAVIF
RL4_WOLPM       SILHDIVRWQLAKRRAGTHKTKGISDVSGTTAKPYGQKRTGRARQGSLRSPQFRGGGIIF
RL4_WOLTR       SILHDIVRWQLAKRRAGTHKVKGISDVSGTTAKPYSQKRTGRARQGSLRSPQFRGGGVIF
RL4_NEOSM       DLLSLVINWQLAKRRAGTHKTKGISEVSGTTRKPYRQKGTGRARQGSLRAPQFRKGGIVF
RL4_BDEBA       EVLHTVVQWQLAARRQGTHMTKTKGLVSGGGKKPFKQKGTGGARQGSSRSILMPGGGTAF
RL4_AQUAE       HVLWEVVKWQLAKRRQGTHSTKTRGEVAYSGRKILPQKGTGNARHGERGVNIFVGGGVAH
RL4_AQUPY       HVLWEVVKWQLAKRRQGTHSTKTRGEVAYSGRKILPQKGTGNARHGERGVNIFVGGGVAH
RL4_THET8       HLLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVF
RL4_DEIRA       GVLHEVVTWQLASRRRGTASTRTRAQVSKTGRKMYGQKGTGNARHGDRSVPTFVGGGVAF
RL4_ANADE       HLFYEVVKAKLASDRSGTHAVKNRSLVSGGGKKPWKQKHTGRARQGSTRASQWVGGGKAM
RL4_SYNAS       AVIYDVVRMQMASRRFGTAATKGRSDVSGGGKKPWRQKGTGRARSGTSRSPIWRGGGIVF
RL4_GEOMG       YLIHEAVKVQLANRRAGTVGVKNRAAVSGGGKKPFKQKGTGQARQGCIRAPHYVGGGVAF
RL4_GEOSL       YLIHEAIKVQLANRRAGTVSVKNRAIVSGGGKKPYRQKGTGQARQGCIRAPHFVGGGVAF
RL4_PELCD       YLIHDMVRYQLAARRQGTSAAKNRSAVAGGGKKPYRQKGTGNARQGTIRAPHFVGGGAAF
RL4_DESAG       EILNLVVRAQRAAKRAGTHSVKTRSTISGGGAKPWRQKGTGRARSGSNRSPVWRGGAVVF
RL4_DESVH       EILHLVVRAQRAAFRAGTHATKTRAFVSGGGLKPWRQKGTGRARAGSIRSPLWRGGAIIF
RL4_DESPS       YILHDVVRMQRAAKRAGTASTKTRVEVRGGGAKPWRQKGTGRARAGSRTSPLWRGGGVTF
RL4_ONYPE       QVLYDVVNAQRAAMRQGTHATKTRALVAGGGKKPWRQKGTGRARHGSIRSPLWRGGGVTF
RL4_FUSNN       VVLHEVLTAELAAARQGTASTKTRAMVRGGGRKPFKQKGTGRARQGTIRAPHMVGGGVTF
RL4_BACLD       SVVFDAILMQRASLRQGTHKVKNRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGIVF
RL4_BACSU       SVVFDAILMQRASLRQGTHKVKNRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVF
RL4_BACCZ       AVLFEAVMMQRASLRQGTHKVKTRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGTVF
RL4_BACSK       SVLHDAVVMQQASLRQGTHKTKGRSEVRGGGRKPWRQKGTGRARQGSIRSPQWVGGGVVF
RL4_BACHD       NVLHDAVVMQQASLRQGTHKTKTRSEVRGGGRKPWRQKGTGRARQGSIRSPQWVGGGTVF
RL4_GEOKA       HVLFEAVIMQRASMRQGTHKTKNRAEVSGGGRKPWRQKGTGRARQGSIRAPQWRGGGTVF
RL4_LISMF       KVVVDVILSQRASLRQGTHKVKNRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVF
RL4_OCEIH       HVLHEAVVMQRASLRQGTHAVKNRSEVRGGGRKPWRQKGTGRARQGSTRSPQWVGGGTVF
RL4_ENTFA       SVVYDAIIMQRASLRQGTHAVKNRSAVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVF
RL4_LACSS       NVVFDAIIMQRASLRQGTHAVKNRSAVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVF
RL4_LACPL       NVVFDAILMQRASMRQGTHAVKNRSARRGGGRKPWRQKGTGRARQGSIRSPQWRKGGIVF
RL4_STRP3       SVVFDVVISQRASLRQGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVF
RL4_STRT1       SVVFDVVISQRASLRQGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVF
RL4_STRR6       SVVFDVIISQRASLRQGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVF
RL4_LACLA       SVVFDVVISQRASLRQGTHAHKNRSAVSGGGKKPWRQKGTGRARQGSTRSPQWRGGGTVF
RL4_LACAC       NVVFEAIIRQRAGKRQGTSKVKNRSAVRGGGKKPWRQKGTGRARQGSIRAPQWRGGGTVF
RL4_LACJO       SVVFDAIIRQRAGKRQGTSAVKNRSAVRGGGKKPWRQKGTGRARQGSIRAPQWRGGGTVF
RL4_STAAR       SVLFEAINLQRASLRQGTHAVKNRSAVSGGGRKPWKQKGTGRARQGTIRAPQWRGGGIVF
RL4_STAS1       NVLFEAINLQRASLRQGTHAVKNRSAVRGGGRKPWRQKGTGRARQGTIRAPQWRGGGIVF
RL4_STAEQ       SVLFEAINLQRASLRQGTHAVKNRSAVRGGGRKPWRQKGTGRARQGTIRAPQWRGGGVVF
RL4_STAHJ       SVLFEAINLQRASLRQGTHAVKNRSAVRGGGRKPWRQKGTGRARQGTIRAPQWRGGGIVF
RL4_CARHZ       AVLYEVSLMYLANQRRGTHDTKTRGEVSGGGRKPWRQKGTGRARHGSIRSPLWRKGGIVF
RL4_SYMTH       GLLHEVVQMYLANKRQGTADTKTRAEVSGGGRKPWRQKGTGRARHGSIRSPLWRKGGIVF
RL4_MOOTA       AVLHDAVVMQLASRRRGTAATRGWADVSGGGRKPWRQKGTGRARAGSIRSPLWRGGAVIF
RL4_CLOPE       YALHQVVVAQLANKRQGTQSAKTRSEVRGGGIKPWRQKGTGRARQGSIRAPQWIKGGVVF
RL4_CLOTE       EVLHQVIVAQLANKRQGTQSSKTRAEVSGGGRKPWRQKGTGRARQGSIRAPQWIKGGVVF
RL4_CLOAB       SALHQVVVAQLANKRQGTQSAKTRTEVSGGGIKPWRQKGTGRARQGSIRAPQWIHGGVVF
RL4_CALS4       AVMHQAVVNYLANQRQGTHSTKTRGEVRGGGRKPWRQKGTGRARQGSIRAPQWIKGGVVF
RL4_THEMA       DVMWRYVDMQLSNRRAGTASTKTRGEVSGGGRKPWPQKHTGRARHGSIRSPIWRHGGVVH
RL4_COREF       ALLHQVVNAQLAAARQGTHSTKTRAEVRGGGRKPFRQKGTGRARQGSIRAPHFTGGGISH
RL4_CORGL       ALLHQVVNAQLAAARQGTHSTKTRGEVRGGGRKPFRQKGTGRARQGSIRAPHFTGGGISH
RL4_CORDI       ALLHQVVNAQLAAKRQGTHSAKTRAEVSGGGRKPFRQKGTGRARQGSIRAPHFTGGGISH
RL4_CORJK       ALMHQVVTAQLAAKRQGTHATKTRGMVSGGGRKPFRQKGTGRARQGSIRAPHFTGGGTVH
RL4_NOCFA       ALMHQVVTAQLAAARQGTHATKTRGEVSGGGKKPYRQKGTGRARQGSTRAPQFTGGGTVH
RL4_MYCTU       ALMHQVVTAQRAAARQGTHSTKTRGEVSGGGRKPYRQKGTGRARQGSTRAPQFTGGGVVH
RL4_MYCPA       ALMHQVVTAQRAAARQGTHSTKTRGDVSGGGRKPYRQKGTGRARQGSTRAPQFTGGGVVH
RL4_MYCLE       ALMHQVVTAQRAAARQGTHSTKTRGDVSGGGRKPYRQKGTGRARQGSMRAPQFTGGGIVH
RL4_MYCSM       ALMHQVVTAQLAAKRQGTHSTKTRGEVSGGGKKPYRQKGSGRARQGSTRAPQFTGGGTVH
RL4_STRAW       PLLHQVVVAQLAAARQGTHKVKRRGEVRGGGKKPYRQKGTGRARQGSTRAPQFAGGGVVH
RL4_STRCO       PLIHQVVVAQNAAARQGTHKTKRRGEVRGGGKKPYRQKGTGRARQGSTRAPQFAGGGVVH
RL4_FRACC       PLIHQVVVAQLAAARQGTHDTKTRGEVRGGGRKPYRQKGTGRARQGSLRAPQFTGGGTVH
RL4_LEIXX       PLIHQVVTAQLAAARQGTHKTKNRGEVSGAGRKPFKQKGTGRARQGSIRAPQMTGGGIVH
RL4_CUTAK       PLIHQVVVAQLAAARQGTHATKTRGQVSGGGKKPWRQKGTGRARQGSTRAPQWVGGGTVH
RL4_BIFLO       PLIHQVVTAQLAAARQGTHATKTRGMVSGGGKKPWKQKGTGRARQGSIRAPQWYHGGTVF
RL4_THEFY       PLIHQVVVAQQAAGRQGTHSTKTRGEVRGGGKKPYRQKGTGRARQGSVRAPQFTGGGTVH
RL4_TROWT       HLIHQVVVAQQAAFRQGTHKTKSRAEVSGSGRKPFRQKGTGNARCGSTRAPQMRGGGVVH
RL4_DEHMC       ALVHQAFVAQQANARQGTQSTKTRGEVQGSSRKIYRQKGTGNARMGTNRSPVRRHGGVAF
RL4_RHOBA       QLLHDVVVMYQANKRQGSHNTRTRGQVSGTNKKMYRQKGTGNARAGSKRTNVRRGGGVAR
RL4_PSYCK       ALVHQVVTAYLAGARQGTRAQKTRAEVSGGGIKPWRQKGTGRARAGSIRSPIWRGGGRAF
RL4_ACIAD       ALVHQVVTAYLAGGRQGTRAQKSRAEVSGGGKKPFRQKGTGRARAGSIRSPIWVGGGKTF
RL4_PSE14       TLVHQAVVAYMAGGRQGSKQQKTRSDVRGGGKRPWRQKGTGRARAGTIRSPIWRGGGTTF
RL4_PSEPK       TLVHQAVVAYMAGGRQGTKQQKTRSDVAGGGKRPWRQKGTGRARAGTTRGPIWRGGGVTF
RL4_PSEAE       TLVHQAVVAYMAGGRQGSKAQKTRSEVSGGGKKPWRQKGTGRARAGTIRSPIWRGGGTTF
RL4_HAHCH       ALVHQVVTAYLAGGRQGSKAQKTRSQVSGGGKKPWRQKGSGRARAGTIRSPIWRGGGKTF
RL4_HAEDU       ALIHQVVVAYAAGARQGSRAQKTRAEVSGSGKKPWRQKGTGRARSGDIKSPIWRSGGTTF
RL4_HAEI8       ALIHQVVVAYAAGARQGTRAQKTRAEVSGSGKKPWRQKGTGRARAGDIKSPIWRSGGTTF
RL4_ECOLI       ALVHQVVVAYAAGARQGTRAQKTRAEVTGSGKKPWRQKGTGRARSGSIKSPIWRSGGVTF
RL4_PECAS       ALVHQVVVAYAAGARQGTRAQKTRAEVTGSGKKPWRQKGTGRARAGSVKSPIWRSGGVTF
RL4_YERPS       ALVHQVVVAYAAGARQGTRAQKTRAEVTGSGKKPWRQKGTGRARAGSVKSPIWRSGGVTF
RL4_PHOLL       ALVHQVVVAYAAGARQGTRAQKTRAEVSGSGKKPWRQKGTGRARSGSIKSPIWRSGGVTF
RL4_MORMO       ALVHQVVVAYAAGARQGTRAQKTRAEVTGSGKKPWRQKGTGRARSGSIKSPIWRSGGITF
RL4_SHEON       ALVHQVVVAYAANARQGTRAQKTRAEVTGSGKKPWRQKGTGRARAGGVKGPIWRGGGVTF
RL4_VIBVY       ALVHQVVVAYAAGARQGTRAQKTRSEVSGGGAKPWRQKGTGRARAGTIRSPLWRTGGVTF
RL4_VIBCH       ALVHQVVVAYAAGARQGTRAQKTRSEVSGGGAKPWRQKGTGRARAGTIRSPIWRTGGVTF
RL4_PHOPR       ALVHQVVVAYAAGARQGTRAQKTRSDVSGGGAKPWRQKGTGRARAGTIRSPLWRTGGVTF
RL4_COLP3       ALVHQVVVAYAAGARQGTRAQKTRSEVSGGGAKPWRQKGTGRARAGTTRGPIWRTGGVTF
RL4_PSET1       ALVHQVVVAYAAGARQGTRAQKTRSEVSGGGKKPWAQKGTGRARAGTIRSPIWRSGGVSF
RL4_IDILO       ALVHQVVVAYAAGARQGTKAQKTRSEVAGGGKKPWRQKGTGRARAGTIRSPIWRSGGATF
RL4_SACD2       DLVHQAVVAFMAGARQGTKAQKNRAAVSGGGKKPWRQKGTGRARAGTIRSPLWRSGGVTF
RL4_HYDCU       ALVHQVVNAYLAGARSGTKGQKNRSAVRGGGAKPWAQKGSGRARAGTSRGPIWIGGGRAF
RL4_COXBU       GLVHQVVNAYLAGGRAGTKAQKTRREVSGGGAKPWRQKGTGRARAGSSRSPLWRSGGVAF
RL4_FRATT       ALIHQVVVAYMAGARQGTKAQKTRSEVSGGGAKPWRQKGTGRARAGTIRSPIFRKGGVTF
RL4_XANOM       DLVHQVVVAYRNAGRAGTKAQKTRSEVAGTTKKSKKQKG-GGARHGALTAPIFVGGGVTF
RL4_XYLFT       ALVHQVVVAYRNTARSGTKAQKSRSQVSGTTKKSKKQKG-GGARHGALTAPIFVGGGVAF
RL4_METCA       SLVHQLVVGYLAAARSGTKAQKSRSDVSGGGKKPWKQKGSGHARAGTTRSPLWRTGGVTF
RL4_NITOC       PLIHQVVTAYLAKARAGTHAQKTRSEARGGGAKPFRQKGTGRARAGTIRSPLWRGGGRAF
RL4_AROAE       ALIHQVVVAYMANARSGNRAQKGRAEVSKSTRKPWRQKGTGRARAGMASSPLWRGGGRVF
RL4_NITMU       ALVHQVVTAYLANARSANRAQKARSDVAKSTRKPWRQKGTGRARAGMASSPLWRGGGKIF
RL4_DECAR       ALVHQIVVAYQANARSGDRQQKDRSEVRHTTTKPWRQKGTGRARAGSNGSPLWRGGGRIF
RL4_CUPPJ       ALVHQIVVAYQANARSGNRKQKDREEVKHTTKKPWRQKGTGRARAGMSSSPLWRGGGRIF
RL4_RALSO       ALVHQIVVAYQANARSGNRKQKDREEVKHTTKKPWRQKGTGRARAGMSSSPLWRGGGRIF
RL4_BURL3       ALIHQVVVAYQANARQGNRAQKDREQVKHTTKKPWRQKGTGRARAGMSSSPLWRGGGRIF
RL4_BORA1       ALVHQIVVAYQANARSGNRAQKDRAEVKHSTKKPWRQKGTGRARAGMTSSPLWRGGGRAF
RL4_RHOFT       DLVHQIVVAFQANARQGTRAQKDREQVKHSTKKPFKQKGTGRARAGMTSSPLWRGGGRIF
RL4_THIDA       ALVHQVVTAFQANARSGNRAQQTRAEVSASTHKPWRQKGTGRARSGRASSPIWRGGGVTF
RL4_NEIG1       ALVHQLVNAYLANARSGNRAQKTRAEVKHSTKKPWRQKGTGRARSGMTSSPLWRKGGRAF
RL4_CHRVO       ALVHQVVTAFLANARSGNRAQLTRAEVKHSTKKPFRQKGTGNARAGMTSTPNRRGGGRAF
RL4_NITEU       ALVHQVVKSYLANARAGTRAQKGRSDVTGSTRKQWRQKGTGRARTGAATNPLWRGGGKIF
RL4_BLOFL       ALIHQIVSSYLINCRQGSKSQKSRSDVSGSNKKPWRQKGTGRARSGSVKSPIWRSGGVTF
RL4_BLOPB       ALIHQVISTYLTNSRQGTRSQKSRSEVSGSNKKPWRQKGTGRARSGSVKSPIWRSGGVTF
RL4_BUCAI       ALIHQVVIAYSASTRQGTRAQKSRAEVSGSGRKPWRQKGTGRARAGSFRSPIWRSGGVTF
RL4_BUCAP       ALIHQVVVAYSASTRQGTRAQKSRADVSGSGRKPWRQKGTGRARAGSFRSPIWRSGGVTF
RL4_BUCBP       ALVHQVIISYSSSIRQGTHAQKNRSEVSGSGKKPWRQKGTGRARVGSLRSPLWRSGGVTF
RL4_WIGBR       SLVHQVVRSYRITKRQGTSAQKSRSEVIGSGKKPWRQKGTGRARAGSVKSPIWRSGGVTF
RL4_LEGPL       GLVHQAVVTFMNNARSGNSAQKTRSEVSGGGKKPWNQKGTGRARAGTIRSPLWRSGGVTF
RL4_PELUB       RLVDNVLYKTNANYKGRHAKTKQQNEITGSTSKIYAQKGTGGARHASRKAPIFVGGGVAH
                  .                             :   **  * **           *.   

RL4_TREDE       GPKP-RDFSY-SMPKKAKRLAMKSILSLKAQNDR-LVVVEDFTVES--------GKTRDL
RL4_TREPA       GPKP-RDFHY-ALPKKVKRLAMKSLLSLKAQGDA-LTVIEDFTVES--------GKTRDL
RL4_BORBP       GPKP-RDYSY-RLPKKVKRLAFKSVLSLRAADENNFKVVENFNIES--------GKTKDL
RL4_BRAPL       TPKP-RDYSY-RLPKKMKRKALLSVLSLKYGNNV-LKVFEDFTFDA--------PKTKRM
RL4_LEPIC       GPQK-RDYSY-KVSSKLKHRAVLSILGKKAQASA-VKVVEDLDPKE--------YNTKAF
RL4_HELHP       GPSNDKNYTL-KINKKQKRLALECALFQKAQEGK-LFVVDSLAMPSGK--------TKDA
RL4_WOLSU       GPSNNRNYDL-KVNKKQKKLALQYALMEKAEQGK-LYVVDSLQVDSGK--------TKDA
RL4_HELPJ       GATNKRNYNL-KINKKQKRLALEYALEEKAQANK-LFVVEKIAIKGVVEDNKRKHLTKEA
RL4_SULDN       GPKNNRNYDL-KVNKKQKKLALNFALNEHAQKGS-LFIVDSIEIASGK--------TKDA
RL4_CAMJR       GPTNERNYFQ-KVNKKQKRLALERALADKAAKGV-LFTADSLAIESGK--------TKDA
RL4_CHLTA       GPKPKFDQHI-RINKKERRAAIRLLLAQKIQTGK-LIVAENSVFVSSLDAPK----TKEA
RL4_CHLMU       GPKPKFDQHV-RINKKERRAAIRLLLAQKIQTGK-LIVADNSVFISSLNAPK----TKEA
RL4_CHLAB       GPKPKFDQHV-RINKKEKRAAIRLLLSQKIQTNH-LIVADDSVFTNSLTSPK----TKEA
RL4_CHLFF       GPKPKFDQHV-RINKKEKRAAIRLLLSQKIQTNR-LIVADDSVFTKSLTAPK----TKEA
RL4_CHLCV       GPKPKFDQHV-RINRKEKRAAIRLLLSQKIQTNR-LIVADDSVFTSSLASPK----TKEA
RL4_CHLPN       GPKPKFNQHV-RINRKERKAAIRLLLAQKIQTNK-LTVVDDTVFVDALTAPK----TQSA
RL4_MYCMS       GPTPDINYKK-SVNKKVRALAFRSVLSLKVK--E-NNLVIVDKFEF-A-----KPSTKEM
RL4_MESFL       GPTPDINYKK-SVNKKVRALAFKSALSIKAS--E-QNLVIVDKFDF-A-----KPSTKEM
RL4_SPIKU       GPTPEKKYLK-HVNKKVRKLAIKSAFSLKVQ--D-KNIMIIDQFGI-D-----KPSTKAM
RL4_MYCGA       GPKPNRNYKI-KVNKKVSSLAFKSAITSKVN-NN-EFLGLVDSIKQ-D-----KPSTKAI
RL4_UREPA       GPKPNRNYNL-KVNAKVRLLAFKSALTIKLN-EG-KMLGLVANSDL-E-----TPSTKKM
RL4_MYCPE       GPSPEKNYTL-KQNSKAYKLAFQSAMTLKLN-EQ-GLNLLVNKIDM-K-----EPSTKTI
RL4_MYCGE       GPKPNRNYKL-KLNKKAYQLALTSAFAQKLNNNQ-VIVAEAKLFEQ-T-----NAKTKKM
RL4_MYCPN       GPKPNRNYSL-KLNKKAHTAALHTVWSEKLASDN-THLVDQNLFNK-T-----EGKTKVM
RL4_MYCH2       GPTTQRNYNL-KVNKKVKKLAFISALSQLAQ----NQQILVNDFSM-N-----KISTKLL
RL4_MYCPU       GPSVNRNYKI-SINKKVRLNALMASLFALAK----SNSVLLKTFSL-E-----KPSTKDL
RL4_MYCS5       GPQSVKNYSL-KVNKKVKQLAFRSALTMLVN----DKAVLVEDFKM-D-----KISTKDL
RL4_MYCMO       GPKPQKKYDF-KINKKVRNLAFLSSLTLLAN----KNAILVEDLKL-E-----KISSQEL
RL4_BACFN       GPKP-RDYYF-KLNKKVKTLARKSALSYKAQDNA-IVVVEDFNFEA--------PKTKVF
RL4_BACTN       GPKP-RDYFF-KLNKKVKTLARKSALSYKVQNNA-LIVVEDFVFEA--------PKTKDF
RL4_PORGI       GPRP-RNYSF-KLNKKLKALARRSALSYKAKNNE-IIVVEDFNFDA--------PKTKAF
RL4_SALRD       GARP-RDYAH-DLNQKEKRLARRSALSYKAANDN-IQVIENFSLDR--------PDTRGL
RL4_CHLCH       GPQP-HTYEQ-KVNKKVKLLARRSALSAKAQAGK-IVVVDDFRFDA--------IKTKPF
RL4_CHLTE       GPQP-RTYDQ-KVNRKVKQLARRSALSAKAAAGQ-IVVVDDFSFEA--------IKTRPV
RL4_PELLD       GPTP-HGYDQ-KVNRKVKQLARRSAFSAKAQEGR-ILIVEDFALAE--------IKTKPV
RL4_TRIV2       GPKP-RDFDL-KMNRKERRLALRTALVS-RIDDL-ILVEEFSNEL--S-----RPKTKDL
RL4_SYNY3       GPKP-RDYSQ-KMNRKERRLALRTAIAS-RADNM-VVVEAFGDQF--S-----QPKTKEL
RL4_THEEB       GPKP-RDYSQ-KMNRKERRLALRTALMS-RVEDL-IVVQDFADHL--P-----RPKTKEL
RL4_SYNE7       GPKP-RDYSV-KMNRKERRLALRTALIS-RSADL-VVVQEFADQI--S-----RPKTRDV
RL4_SYNJB       GPRK-REYNL-AMNRKERQLALRTALQS-RVEDL-IVVEDFQEQL--N-----PPKTRAV
RL4_SYNJA       GPRK-REYNL-AMNRKERQLALRTALQS-RVEDL-IVVEDFQDQL--N-----PPKTRAV
RL4_GLOVI       GPKP-RDFEI-KMNRKERRLALRTALQS-RVEDL-IVVDEFEGQL--A-----APKTREL
RL4_SYNSC       GPKP-RTYNL-AMNRKERRLALRTALMA-RIDDV-TVVQDFGASL--E-----APKTREI
RL4_SYNPX       GPKP-RTYNL-AMNRKERRLALRTALMA-RVEDV-TVVKDFGTSL--E-----APKTKEI
RL4_SYNS9       GPKP-RSYNL-AMNRKERRSALRTALMA-RIDDI-TVVKDFGTSL--E-----APKTREI
RL4_PROMM       GPKP-RTYNL-AMNRKERRLALRTALMA-RIEDV-IVVKDFGNSL--K-----VPKTREI
RL4_PROMA       GPKP-RQYNL-SMNRKERRLALRTALMA-RFNDV-IAVKDFGSKL--K-----VPKTKEI
RL4_PROMT       GPKP-RKYNL-EMNRKERRLALRTALMS-RIPDA-KIIKDFGSKL--E-----VPKTSEI
RL4_PROM9       GPKP-RSYNL-DMNRKERRLALRTALMS-RISDV-KAVEDFGSTL--K-----QPKTSDI
RL4_PROMP       GPKP-RSYNL-DMNRKERRLALRTALMS-RISDF-KTVEDFGSTL--D-----QPKTSEI
RK4_PORPU       GPKP-RSFAK-KMNKKESQLALRTALNN-KSVNT-LVVENFDTYF--Q-----KPKTKLF
RK4_PYRYE       GPKP-RSFTK-KMNKKERQLALRTALNN-KSVNT-LIVENFNSYF--H-----QPKTKLF
RK4_GRATL       GPRH-KKYVN-KINKKEKQLALRILINN-KFKNT-IVTENFISKI--S-----TPNTKIL
RK4_TRICV       GPKP-RKIIL-KLNKKERKLALQTLLYN-KRNNI-SIIDNLETNL--D-----LPKTKTF
RK4_CYACA       GPKP-KNVFF-KINKKEIRLALYTVLSN-ALPKT-TVVSSLEGLP--N-----FISTQAL
RK4_CYAM1       GPRG-VAMEC-KLNRKESRKATKIAFMA-CSKKI-QIVNP--PIL--E-----KPSSRTI
RK4_GUITH       GPKP-RTFSN-KTNKKERLLALTTALYL-KSNNT-KVINLDNLDF--T-----NLKTRDL
RL4_RHIEC       GPVV-RSHEH-DLPKKVRALGLRHALSAKIKADD-VIVIDNLVA---A-----EAKTKAL
RL4_RHIME       GPVV-RSHAH-DLPKKIRALGLRHALSAKLKAED-IIVIDDLVA---N-----EAKTKAL
RL4_AGRFC       GPVV-RSHAH-DLPKKVRALALRHALSAKLKAEE-LIIVDQLVA---S-----EAKTKAL
RL4_BRUSU       GPVV-RNHDH-DLPKKVRALGLRHALSAKAKASD-LIIIDDLAS---A-----DAKTKQL
RL4_RHILO       GPVV-RSHEH-DLPKNVRALGLKHALSAKAKSAS-IIVIDELKL---T-----EAKTKAL
RL4_BARHE       GPVV-RSHAH-TLPKKIRALGLRFALSAKLKADD-LIVVDEFNV---K-----DAKTRML
RL4_BARQU       GPVV-RSHAH-DLPKKIRVLGLRLALSAKLKAND-LIIVDELNV---K-----EAKTKML
RL4_BRADU       GPVV-RSHAT-DLPKKVRALALKHALSAKAKDGD-LLVIDKAAL---E-----AAKTKAL
RL4_RHOPB       GPVV-RSHAF-DLPKKVRALALKHALSAKAKDGG-LIVIESATL---E-----AAKTKAL
RL4_RHOPA       GPVV-RSHAI-DLPKKVRVLALRHALSAKAKGGG-LIVLDKAEL---E-----AAKTKTL
RL4_RHOP2       GPVV-RSHAI-DLPKKVRALALRHALSAKAKGGG-LIVIDKAEL---E-----AAKTKAL
RL4_NITWN       GPVV-RSHAH-DLPKKVRALALRHALSAKAKDGG-LIVIDSVEL---K-----EAKTKAL
RL4_CAUVC       GPVV-RSHAF-DLPKKIRALALRHALSSKAKAGS-LVVVDSVAL---T-----EAKTAAL
RL4_MAGSA       GPVV-RSHAH-DLPKKVRKLALKTALSAKVADGK-LIVVDAASA---G-----SPKTKDL
RL4_RHORT       GPVV-RSHAH-DLNKKVRKLGLKTALSAKAQAGQ-LIVLDQAIS---E-----SGKTKDL
RL4_JANSC       GPTP-RSHGH-ELTKKFRKLGLRHALSAKAAEGR-LVVIESIAM---D-----EAKTSAL
RL4_RUEPO       GPTP-RSHGH-DLTKKFRKLGLRHALSAKAKAGE-LVVIEN-AE---A-----EGKTAAL
RL4_RHOS4       GPTP-RSHAH-DLNKKFRALGLKHALSSKATTGN-LIVLEDIAL---A-----EGKTAML
RL4_NOVAD       GPRV-REFNI-SLNKKVRALGLKMALSSKAKAG--LVVVDN-LD---V-----DAKTKAL
RL4_ZYMMO       GARA-RVFNP-SLNKKVRALGLRMALSSKAKTGT-LVVIEA-LD---V-----EAKTKLL
RL4_GLUOX       GPVV-RDHGY-DLPKKVRRLGLICALSQKAAEGK-LIVLDAANG---V-----T-KTREA
RL4_RICPR       GPKV-RSHAI-KLPKKVRKLGLIHALSEKYAEEK-LLIIDSLKL---D-----KPKTSIL
RL4_RICTY       GPKV-RSHAI-KLPKKVRKLGLIHALSEKCAAGK-LLIINSLKL---E-----KPKTSVL
RL4_RICFE       GPRV-RSHAT-KLPKKVRKLGLIHALSEKFAEGK-LLVIDSLKL---D-----KPKTSVL
RL4_RICBR       GPVV-RSHAT-KLPKKVRKLGLIHALSEKFSEGK-LLVIDSLKL---E-----TPKTSNL
RL4_ANAMM       GPVN-RSHAY-SLNKKVRRLGLKVALSMKVSDSK-LVVLDDSGL---L-----LEKTADA
RL4_ANAPZ       GPVP-RSHEY-SLNKKVRRLGLKVALSMKVAANK-LVVLDSLDV---D-----LKKTADA
RL4_EHRCR       GPVV-RSHAY-SLNKKVRNLGLKVALSLKNSCNK-LLILDSIDV---N-----FVKTTQV
RL4_EHRRW       GPVV-RTHAY-SLNKKVRNLGLKVALSLKNSCNK-LLILDSIDV---N-----FVKTAQV
RL4_WOLPM       GPVV-RSHTY-SLNKKVRKFGLKIALSLKYLNNQ-VIILDNLNI---D-----VKKTSEM
RL4_WOLTR       GPIV-RSHAY-SLNKKVRKFGLKVALSLKYLNNQ-VIILNNLNI---N-----VKKTSEM
RL4_NEOSM       GPVV-RQHGF-SVNKKVRSLALRSALSMRFAEGR-LFVLESSRL---G-----ESKAATL
RL4_BDEBA       GPQP-RSYAF-VLPKKVRRLGLSMALSHLQKEGK-LFIVDSMAS---E-----G-KTAEL
RL4_AQUAE       GPKP-RDYEY-PLPKRVRKLGLKMALSDKARNNA-IIFVDNIDLG--K-----KPKTKKA
RL4_AQUPY       GPKP-RDYEY-PLPKKVRKLGLKMALSDKAQNDA-IMFVDNIDLG--E-----QPKTKKA
RL4_THET8       GPKP-RDYSY-TLPKKVRKKGLAMAVADRAREGK-LLLVEAFAG---V-----NGKTKEF
RL4_DEIRA       GPKP-RSYDY-TLPRQVRQLGLAMAIASRQEGGK-LVAVDGFDI---A-----DAKTKNF
RL4_ANADE       GPKP-RDYSY-DVPKKVRKAALRSALALRSKDQK-LVIVQEWKP---E-----GPKTAAA
RL4_SYNAS       GPVP-RDYKY-NVPKKVRKNALRSVLSLKYQGQK-LVVLKDFPL---D-----EIKTKKF
RL4_GEOMG       GPQA-KTYAL-SMNKKARKAAVRSALSMLFKENK-LSVLDCLSL---P-----SISTKGF
RL4_GEOSL       GPRP-KVYNL-SMNKKARKAAVRSALSMLYKENK-LSVLDSFTL---P-----SISTKGF
RL4_PELCD       GPSP-RDFSF-KLNRKVKKAALRSALSARFKEER-VAVLNDFQL---E-----KIGTKAV
RL4_DESAG       GPQP-RDYSF-KVNKKVRKLALKMALSSRLAEEN-LMVVKGIEL---P-----EVKTKHM
RL4_DESVH       GPQP-RDYEF-KVNKKVRKLALRMALSSRLAGSN-LLVVKGFEL---P-----EVKTKLF
RL4_DESPS       GPKP-RDYSF-KLNRKVRQQAVSMALSARFQEGN-LIVLDNFIM---D-----AIKTKEF
RL4_ONYPE       GPSP-RDYSV-KVNQKVRSLALKSALSLQAKNNQ-LVVVDNINL---A-----THKTKDF
RL4_FUSNN       GPHP-RSYEK-KVNKKVRNLALRSALSAKVAAGN-VLVLDYDGI---E-----TPKTKVI
RL4_BACLD       GPTP-RSYAY-KLPKKVRRLAIKSALSSKVNDNN-LIVLEDLNL---D-----AVKTKEM
RL4_BACSU       GPTP-RSYSY-KLPKKVRRLAIKSVLSSKVIDNN-IIVLEDLTL---D-----TAKTKEM
RL4_BACCZ       GPTP-RSYAY-KLPKKVRRLAIKSALATKVVENN-IVVLEDLVL---N-----APKTKDM
RL4_BACSK       GPTP-RSYSY-KLPKKVRRLAIKSALSSKVKDSE-LVVLDDLKL---E-----AIKTKAM
RL4_BACHD       GPTP-RSYSY-KLPKKVRRLAIKSALSSKVKAEE-IVVLESLAL---E-----APKTKEM
RL4_GEOKA       GPVP-RSYSY-KLPKKVRRLAIKSALSSKVLEND-IVVLDQLSL---E-----APKTKEM
RL4_LISMF       GPTP-RSYAY-KLPKKVRRLAIKSILSSKVNEEK-LVVLEGLTF---D-----APKTKEF
RL4_OCEIH       GPTP-RSYSY-KLPKKVRRLALRSALSSKVNEES-LLVLENISI---D-----APKTKEI
RL4_ENTFA       GPTP-RSYSY-KFPKKVRRLAMKSVLSDKVAENN-LVAVEGLSF---D-----APKTKEF
RL4_LACSS       GPTP-RSYSY-KLPRKVRRLAIKSVLSQKVIDND-LIVVDSFSF---D-----APKTKEF
RL4_LACPL       GPTP-RSYSY-KLPKKVMRLALKSVLSQKVLDNS-LVAVDSLAF---D-----APKTKDF
RL4_STRP3       GPTP-RSYGY-KLPQKVRRLALKSVYSAKVAEDK-FVAVEGLSF---A-----APKTAEF
RL4_STRT1       GPTP-RSYGY-KLPQKVRRLALKSVYSAKVAEDK-FVAVEALSF---A-----APKTAEF
RL4_STRR6       GPTP-RSYGY-KLPQKVRRLALKSVYSEKVAENK-FVAVDALSF---T-----APKTAEF
RL4_LACLA       GPNP-RSYAY-KLPQKVRQLALKSVYSTKVADGK-LIAVDTLDF---T-----APKTAEF
RL4_LACAC       GPTP-RSYAY-TMPRKQRRLAIKSVLSQKLIDND-LIVLDKLTM---S-----APKTKEL
RL4_LACJO       GPTP-RSYKM-DMPRKARRLAMKSVLSQKVADND-LIILDQLTL---E-----APKTKEL
RL4_STAAR       GPTP-RSYAY-KMPKKMRRLALRSALSFKVQENG-LTVVDAFNF---E-----APKTKEF
RL4_STAS1       GPTP-RSYSY-KMPKKMRRLALRSALSFKVQEKG-LTVVDALNL---D-----APKTKEF
RL4_STAEQ       GPTP-RSYAY-KMPKKMRRLALRSALSFKVQENS-FTIVDTFGF---E-----APKTKEF
RL4_STAHJ       GPTP-RSYAY-KMPKKMRRLALRSALSFKVKENN-FTIVDNFGF---E-----APKTKEF
RL4_CARHZ       GPHP-RDYSY-SVPKKVRRAALKSALSDKVNENN-LIVVDSLTF---A-----APKTKEM
RL4_SYMTH       GPHP-REYGW-SMPKKARRAALRQALSAKVKSGE-LIVVDKFEL---E-----APKTREV
RL4_MOOTA       GPQP-RDYGY-RLPKKVRRLALRSALASKVRDGN-IIVLDELKM---E-----KPRTKDM
RL4_CLOPE       APKP-RDYRM-SIPKSMRKVAMTSALTSKVAD---MVVLEDLTF---E-----APKTKEA
RL4_CLOTE       APKP-RDYSM-AIPKSMKRVAMKSALSSKVQENE-IVILESLEA---D-----APKTKEI
RL4_CLOAB       APKP-RDYRI-SIPKSMRRTAMLSALTSKVNDKE-MIVLDELKI---D-----APKTKEI
RL4_CALS4       GPKP-RDYSY-KLPKKVKRLALKSALSSKVRDNE-IIVLDEFKL---E-----QPKTKKV
RL4_THEMA       GPKP-RDWSK-KLNKKMKKLALRSALSVKYRENK-LLVLDDLKL---E-----RPKTKSL
RL4_COREF       GPKP-RDYAQ-RTPKKMIKAALYGALSDRARNER-IHVISELVPGQ-------APSTKSA
RL4_CORGL       GPKP-RDYSQ-RTPKKMIKAALYGALSDRARNAR-IHVVSELVPGQ-------TPSTKSA
RL4_CORDI       GPKP-RDYSQ-RTPKKMIKAALFGALTDRARHER-IHVISELVAGQ-------TPSTKSA
RL4_CORJK       GPQP-RDYSQ-RTPKKMKAAALRGALTDRVRHDR-IHVVEELVPGQ-------TPSTKAA
RL4_NOCFA       GPQP-RDYSQ-RTPKKMIRAALHGALSDRARNDR-IHVVSELVAGQ-------TPSTKTA
RL4_MYCTU       GPKP-RDYSQ-RTPKKMIAAALRGALSDRARNGR-IHAITELVEGQ-------NPSTKSA
RL4_MYCPA       GPKP-RDYSQ-RTPKKMIAAALRGALSDRARNGR-IHAITELVSGQ-------TPSTKSA
RL4_MYCLE       GPKL-RDYSQ-RTPKKMIAAALRGALSDRARNGR-IHAVTELVVGK-------TPSTKSA
RL4_MYCSM       GPKP-RDYSQ-RTPKKMIAAALRGALSDRARNDR-IHAVTELVEGQ-------TPSTKSA
RL4_STRAW       GPTP-RDYSQ-RTPKKMKAAALRHALTDRARNAR-IHVITGVIEGE-------TPSTKAA
RL4_STRCO       GPQP-RDYSQ-RTPKKMKAAALRHALTDRARHNR-IHVVTGVIEGE-------NPSTKAA
RL4_FRACC       GPTP-RRYDQ-RTPKKMKAAALRGALSDRARNNR-VHVVSSLVSGE-------TPSTKSA
RL4_LEIXX       GPTP-RDYSQ-RTPKKMIAAALLGALSDRARGSR-IHAVQAFTAGE-------APSTKAV
RL4_CUTAK       GPQP-RSYAQ-RTPKKMVGAALRGALSDMARDNR-IFVVTSLVDGD-------KPSTKQA
RL4_BIFLO       GPQP-RDYSQ-RTPKKMKAAALRYALSDRANAGR-VAVVEFGIT---------EPSTKAA
RL4_THEFY       GPKP-RDYAQ-RTPKKMKAAALRGALSNRAQHGR-IHVVSEFVPEDVT-----TKRTQTA
RL4_TROWT       GPVP-RNYVH-RTPKKMIKAALAGCLTNRARAGR-VHIVDSFGD---------TPSVADA
RL4_DEHMC       GPRP-RDFSK-DLPKKMRRQAIRCVLSFKLESGE-LKVIDQLSFDE--------PKTRDM
RL4_RHOBA       TVKP-RDYSY-RLPKKAIKIATRMAIRSRIDDGE-IVVINELKLDA--------PKTSQI
RL4_PSYCK       AAKP-QDWSQ-KVNRKMYRGAMQCILAELIRQER-LILVEEISVSG--------PKTKEL
RL4_ACIAD       AARP-QDWSQ-KVNRKMYRGAMQCILAELVRQDR-LVLVEEFAVAA--------PKTKEL
RL4_PSE14       AARP-QDHTQ-KLNKKMYRAALRSILAELVRTDR-LVVVQDFAVEA--------PKTKDL
RL4_PSEPK       AARP-QDHSQ-KLNKKMYRAALRSILAELVRSDR-LVVVQDFAVEA--------PKTKDL
RL4_PSEAE       AAKP-RSHEQ-KLNKKMYRAALRSILAELVRLDR-LVVVADFAVDA--------PKTKGL
RL4_HAHCH       AATP-LDHSQ-KVNKKMYRAAMQSILSELVRQER-LVVVEEMAVEA--------PKTKQF
RL4_HAEDU       AAKP-QDHSQ-KVNKKMYRGAIKSILSELVRQER-LVVVEKFEVEA--------PKTKFL
RL4_HAEI8       AAKP-QDHSQ-KVNKKMYRGAIKSILSELVRQDR-LVVVEKFELDA--------PKTKVL
RL4_ECOLI       AARP-QDHSQ-KVNKKMYRGALKSILSELVRQDR-LIVVEKFSVEA--------PKTKLL
RL4_PECAS       AAKP-QDHSQ-KVNKKMYRGALKSILSELVRQDR-LIVVEQFSLEA--------PKTKLL
RL4_YERPS       AAKP-QDHSQ-KVNKKMYRGALKSILSELVRQDR-LIIVEKFSVEA--------PKTKLL
RL4_PHOLL       AAKP-QDHSQ-KVNKKMYRGALKSILSELVRQDR-LIVVEKFSVEA--------PKTKLL
RL4_MORMO       AAKP-QDHSQ-KVNKKMYRGALKSILSELVRQDR-LIIVEKFAVEA--------PKTKLL
RL4_SHEON       AAKT-QDHSQ-KVNKKMYRGALKSILSELVRQDR-LVVVESFSVEA--------PKTKEL
RL4_VIBVY       AAKP-QDHSQ-KVNKKMYRGAMKSILSELVRQER-LIVVDNFSVEA--------PKTKEL
RL4_VIBCH       AAKP-QDHSQ-KVNKKMYRGAMKSILSELVRQER-LIVVENFSVEA--------PKTKAL
RL4_PHOPR       AARP-QDHSQ-KVNKKMYRGAMKSILSELVRQER-LIVVDNFSVEA--------PKTKEL
RL4_COLP3       AAKP-QDHSQ-KVNRKMYRGAIASILSELVRQER-LVVVENFSVET--------PKTKEL
RL4_PSET1       AAKP-QDHSQ-KVNRKMYRGAIKSILSELVRQER-LIVVESFALAA--------PKTKEL
RL4_IDILO       AAKP-QNHSQ-KVNKKMYRGAIKSILSELIRQER-LIVVEKFGVDE--------PKTKQL
RL4_SACD2       AAEP-RDHSQ-KLNKKMYRAAIRCILSELARQER-LVVVEEFDLDA--------PKTKDL
RL4_HYDCU       PGHN-RDFSQ-KVNKKMYRGAMKAIFSELARTER-LVVVDDFKVEA--------PKTKDF
RL4_COXBU       AAKP-RDFTQ-KVNRKMYRSAMASILSELIRREQ-LVVVDSLKLNE--------PKTREL
RL4_FRATT       AAKP-KSYKQ-KVNRKMYSGAVKSILSELLRSGR-MTIVEELKLET--------PKTREF
RL4_XANOM       AAKP-RSFEQ-KVNRKMYRAAICAIFSELNRQGR-LMIVDAFDLEA--------TKTKDL
RL4_XYLFT       AAKP-RSFSQ-KVNRKQYRSAICSIFSELNRQGR-LKVVDAFDVEV--------SKTRVF
RL4_METCA       AASN-RNYRQ-KLNKKMYRAAVRSIFSELLRQGR-LVVSDGIVPTS--------PKTREL
RL4_NITOC       AAKP-GDYSQ-KVNRKMYRAAMRSILSELVRQDR-LRMIDKIMLSK--------PKTRDL
RL4_AROAE       PNSPEDNFSQ-KLNRKMYRAGVASILSQLAREDR-LAIVENFSVEA--------PKTRLL
RL4_NITMU       PNSPEENFSH-KVNRKMYRAGIGAILSQLVRENR-LSVVENFIVDA--------PKTKIL
RL4_DECAR       PNSPEENFSQ-KVNKKMFRAGMAAILSELARQDR-LVVIDDLSVDA--------PKTKLF
RL4_CUPPJ       PNSPEENFSQ-KVNKKMFRAGMRSIYSQLAREGR-INVVDGFTVDA--------PKTKLL
RL4_RALSO       PNSPEENFSQ-KVNKKMYRAGMRSIYSQLAREGR-INVVDSLSVDA--------PKTKLL
RL4_BURL3       PNSPEENFSH-KVNKKMHRAGLCSIFSQLAREGR-LSVVEDIILEA--------PKTKLL
RL4_BORA1       PNSPEENFSQ-KVNKKMYRAGIRSILSQLAREDR-IAVVDTFSLES--------PKTKLA
RL4_RHOFT       PNMPDENFTQ-KINKKMYRAGMASILSQLAREGR-LAVVDSMKVDS--------PKTKPL
RL4_THIDA       PNKPNENFTH-KVNRKMYRAGLAAILSQLAREGK-LKVVESLGIES--------PKTKLL
RL4_NEIG1       PNKPDENFTQ-KVNRKMYRAGMATILSQLARDER-LFVIEALTAET--------PKTKVF
RL4_CHRVO       PNKPDENFTQ-KVNRKMYRAGIATILSQLVRDER-LIVVDDLSVAS--------PKTKEF
RL4_NITEU       PNKPTENFKQ-KLNRKMYRAGMCTIFSELLRNNK-LVAIDEFQIEM--------PKTKVC
RL4_BLOFL       ASKP-KKYDQ-KINKKMYKGAMKSILSKLVCDNR-LFLIEDLFLEK--------PKTNLL
RL4_BLOPB       AAKP-KLYAQ-KINKKMYRGAIRSILSKLVCDNR-LFLVRNLFIKE--------PKTKLL
RL4_BUCAI       AAKP-QEHSQ-KVNKKMYRGALKSIFSELIRQKR-LIVFENFSLDA--------PKTKLL
RL4_BUCAP       ASKP-QSHSQ-KINKKMYRGALKSIFSELIRQKR-LIIFEKFSLDL--------PKTNLL
RL4_BUCBP       AAKP-KSFYQ-KINKKMYRGALKSIFSELIRQKR-LVVFREFTIEF--------PKTRLL
RL4_WIGBR       AKKT-RDFKH-KINKKMYKNALKSIFSELCRQNR-ILIVKNFFVKS--------EKTKLL
RL4_LEGPL       ASKK-RDYSQ-KLNKKMYKRALRSIISELCRTGN-LVVVSDFQCDN--------HKTKDF
RL4_PELUB       GPKGELAYKKRKLNKSEKKLSIASLITEKNKLNN-LIIFSDFGNEI--------KKTKEM
                                    .                                       

RL4_TREDE       VKILDNFAK--GERAVIILKDDD------SLVKRAGRNIPHLSFLAYN------------
RL4_TREPA       IQVLRHFAQ--RERTVFILQNDD------ALLKRAGRNIPTLSFLSYN------------
RL4_BORBP       ALIIKNFASF-NGKVVILLGNDD------QMIKRAGKNIRDLKILSFN------------
RL4_BRAPL       ASFISKVKEPNSRKVAFVVGKDESLGDNYNKLLLSLRNIKDLKLVNAD------------
RL4_LEPIC       DSIFKNMNLKNTGVIGLLVQGEN------DFLKKSVRNIPTVKYINSK------------
RL4_HELHP       YAMFKALKQ-----RSTLFVAQMS----DEPTFLAFRNLQQCYLADAN------------
RL4_WOLSU       YAMFKTLNE-----RSTLFVSQIS----DEKTFLAFRNLKECYLADAN------------
RL4_HELPJ       NQMFQALEQ-----RDTLFVCLNM----DEYTELAFSNLKKCLVIDVS------------
RL4_SULDN       ATLFKALNQ-----RDTLFVKTVL----DEKTYLAFENIASTYVIEEN------------
RL4_CAMJR       NAVIKKLGV-----KDALIVKDLL----DEKTLLAYRNLANCYVVDVT------------
RL4_CHLTA       LRFLKECNVEC---RGVLFVDGLAHVGSNENLRLSVRNLSAVRGFTYGE-----------
RL4_CHLMU       LRFLKECNVEC---RGVLFVDGLDHVGSNENLRLSVRNLAAVRGFTYGE-----------
RL4_CHLAB       LRFLKSCNVEC---RGVLFIDDLEHAQNNESLRLSLRNLPAVRGFTYGM-----------
RL4_CHLFF       LRFLKSCNVEC---RGVLFIDDLNHAQNNEGLRLSLRNLPAVRGFAYGM-----------
RL4_CHLCV       LRFLKSCNVEC---RGILFIDDLDHAQNNEGLRLSLRNLSAVRGFTYGM-----------
RL4_CHLPN       LRFLKDCNVEC---RSILFIDHLDHVEKNENLRLSLRNLTAVKGFVYGI-----------
RL4_MYCMS       VVVMKNLKID-----DQKTLIVTK--EKEELVVKSSNNITGVKTISAN------------
RL4_MESFL       ISVMKNLQID-----DQKTLIITK--ENEELVIKSSSNIKGVKTLPSI------------
RL4_SPIKU       VKVLNNLKVN-----GEKLLIITT--EGDEVNFKSSRNIEKVNIITSA------------
RL4_MYCGA       AKLLKELKV------NKKVLIVAF--EKNENLEKSSANLPNVSYKLWN------------
RL4_UREPA       VNFINNANLE-----NQKVLLVIV--DNFSNIKKSTNNLQKVTTKLWY------------
RL4_MYCPE       SKMLKKVSYE-----NKKVLFVIN--DKNENFLKSCKNIQKVTSKMWN------------
RL4_MYCGE       LTFLKNAKLT-----EQKLLFVID--TISKPLLLSTNNLKQIVVKQFN------------
RL4_MYCPN       MQFLKSAKLL-----DKNVLFVVN--TLNTNLEQSTSNIKNVQVKHLD------------
RL4_MYCH2       VDQLKIFKID-----QLRHILIAS--S-DPNLFLSARNLPNVELVKTN------------
RL4_MYCPU       VEELRKINAS-----NLKRILLVS--D-DKNIFLSARNLKNVKVTKVT------------
RL4_MYCS5       SQKLKSLNVD-----KLRHVILVS--E-NATVFKSSANLKNVTTLKAH------------
RL4_MYCMO       IKKLEDLKIN-----NLKKILIVS--D-DEKIFKSGRNVQNLHVVKLN------------
RL4_BACFN       VEMTKNLKVSD---KKLLVVLP----EANKNVYLSARNIEGANVQTIS------------
RL4_BACTN       VAMTKNLKVSD---KKLLVILP----EANKNVYLSARNIEGANVQTVS------------
RL4_PORGI       KAISAALKVGE---KKVLYVLP----EVNKNVYLSARNLPNTNLILAN------------
RL4_SALRD       TDLFELLGVEG---QDILLATA----EVEREVYLSSQNLPDVNVQEVQ------------
RL4_CHLCH       ADILKNLGLDA---KKTLLLMP----EYDMVVNRSGRNIAKLEIMTAD------------
RL4_CHLTE       ADMLKNLGLAE---KKTLLMMP----HHDNVVSTSGRNIEKLNVMVAD------------
RL4_PELLD       ADMLRNLGLDA---KKILMLTP----DYNMVIARSGRNIEALNIMTAE------------
RL4_TRIV2       VAAFTRWGA--EPESKILLILS----EFPENVYLSARNIENLKLIAAD------------
RL4_SYNY3       ATALTRWGA--KPEKRVLLILD----EIPENVFLSGRNIPYLKILRAD------------
RL4_THEEB       VTALQRWGI--EPEQKVLLLAA----DITETVALSARNVPTLKLLRAD------------
RL4_SYNE7       AEALTRWGV--EPGVKVLLITA----DRDQNVELSVRNLPNVKLITAT------------
RL4_SYNJB       AQALLRWGV--MEDQSALLIVA----ERSEAVERAVRNIARVKLIGLD------------
RL4_SYNJA       AQALLRWGV--MEDQSALLIVA----ERSEAVERAVRNIARVKLIGLD------------
RL4_GLOVI       VQAFERWGVD-MASQSILLILR----ERQTNTYLSARNLPNVKVITAG------------
RL4_SYNSC       TDALGRLGV--AAGSKVLIVLT----NPSDVVRRSVRNLEKVKLISAD------------
RL4_SYNPX       TDALGRLGI--AADAKVLIVLT----EPSDVVRRSVRNLEKVKLIAAN------------
RL4_SYNS9       TEALGRLGI--AADTKVLIVLT----NPSEMVRRSVRNLDKVKLISAN------------
RL4_PROMM       SDALIRLGL--AADAKVLIILS----TPSEIIRRSVRNLEKVKLIAAD------------
RL4_PROMA       QDFLARLDI--SSNSKVLIILS----QPSDIIRRSVRNLEKVKLIAAE------------
RL4_PROMT       VALLKRVGI--DSDVKILIILN----KPSEIIKRSIKNLEKVKLISAD------------
RL4_PROM9       INGLTRLGI--QKTEKVLVILD----SPSEVIKKSINNIEKVKLIAAD------------
RL4_PROMP       INGLSRLGI--EKTEKVLVILD----NPSDVIKKSINNLEKVKLIAAD------------
RK4_PORPU       IEAITRWNLDL--NKKLLVIVD----KKDLNVYLSIRNLYNVEIISAD------------
RK4_PYRYE       MEAIHRWNLDL--NKKVLVIVD----KKDPNVYLSIRNLHNVELISAD------------
RK4_GRATL       VNNLKKYNLDT--NNNILIIVN----EKSNDLYLSTRNLKNVELLAAN------------
RK4_TRICV       YSLCKNCEINL--DQKILIIVG----EKTIPLKLATRNIKNVELILAS------------
RK4_CYACA       IKFLRSLNVSL--DNRVLIVVE----KKETPLFLSCRNIKNLALIQAD------------
RK4_CYAM1       SQMLPPLP-----SRPVLWILH----EKNPSLWLSCRNIKTLQLIQAE------------
RK4_GUITH       VIKCSNLIENYKKDQKILFVAE----PTASGLWRYVKNISNVDLIYTT------------
RL4_RHIEC       ASAFETLGL----TNALFIGGA----ELDGNFKLAAQNIPNIDVLPIQ------------
RL4_RHIME       AGAFASLGL----TNALIIGGA----EIEGNFKLAAQNIPNVDVLPVQ------------
RL4_AGRFC       LGSFASLGL----TNALVIGGA----ELDGNFKLAAQNIPNVDVLPVQ------------
RL4_BRUSU       VSQFAKLGL----ENALLIGGA----EIDANFQRAASNIPNIDVLPVQ------------
RL4_RHILO       IANFATLGL----SNALVIGGA----ELDKNFKLAATNIPNIDVLPIQ------------
RL4_BARHE       VSCFSKLGF----DNALLIGGN----EVDLNFSRATSNIPNIDILPIQ------------
RL4_BARQU       VSCFSKLGF----KNALLVGGK----EIDINFSRAASNIPNIDILPIQ------------
RL4_BRADU       LGHFSGLGL----TNALIIDGA----ELNNGFAAAARNIPNMDVLPIQ------------
RL4_RHOPB       VGHFSGLGL----TSALIIDGA----ELNNGFAVAARNIPNIDVLPIQ------------
RL4_RHOPA       VGHFSGLGL----ESALIIDGA----EVNNGFAAAARNIPNIDVLPVQ------------
RL4_RHOP2       VGAFSGLGL----TNALIIDGA----EVNTGFATAARNIPNIDVLPIQ------------
RL4_NITWN       MGHFSSLGL----TSALIIDGA----QVHAGFATAARNIPNIDVLPIQ------------
RL4_CAUVC       RATFDKIGL----KNALVIAGP----EVDANFKLAARNIPNVDVLPNA------------
RL4_MAGSA       AARLGKLGL----SSVLFIDGA----AVDGNFALASRNIPYVDVLPTQ------------
RL4_RHORT       LAQLKVLGL----EKVLFIDGP----EVNEKFALAARNIIGLDVLPQQ------------
RL4_JANSC       AKQVKEMGW----KRALIIDGS----DVDANFAQAARNIEGLDVLPTM------------
RL4_RUEPO       AKQVANLGW----KRALVIDGA----AVNEGFARAARNIEGLDILPSM------------
RL4_RHOS4       AKAVKELGW----KRVLVIDGA----DINENFAKAARNLEGVDVLPSI------------
RL4_NOVAD       VGQLAKANWG---KKVLVIDGE----GVNDNFAKAARNIVGVNVLPAI------------
RL4_ZYMMO       AAQIQSLGFG---PKVLVVDGD----TVNENFARASSNLVGLDVLPAV------------
RL4_GLUOX       AAKIKALGW----TSALIVDGA-----VDEQFARAIANLPKIDVLPTI------------
RL4_RICPR       VNLLSKFQG----QSFFVIDGN----KVDINFSLATKNIYNTLIVPQI------------
RL4_RICTY       VNLLNKFQG----QSFFIIDGN----KVDTNFSLATKNIYNTLIVPQI------------
RL4_RICFE       VNILNKFQG----KSFFVIDGN----EVDTNFSLAAKNIYNTVIVPQI------------
RL4_RICBR       VNILNKFQG----KSFFVIDGN----EVDVNFSLAAQNIYNTVVVPQI------------
RL4_ANAMM       HVAFGNFGA----HGSYLVVAE----TYEDKVMCACRNLPNVDLLKYA------------
RL4_ANAPZ       KGVFGNFAG----HSSYLVVSE----SCKEEVVRACRNLRGVDLLKCV------------
RL4_EHRCR       LQFIKNFE-----HKSFLIIDK----DYNKSVVCSCRNLHNVTLLKQI------------
RL4_EHRRW       LRFIKNFE-----HQSFLIIGK----DYNKGMMYSCKNLHNVTLLKQI------------
RL4_WOLPM       CKCIKNFK-----FSSFLIVG-----DYGDDLLRAAKNLHYVDLIKPI------------
RL4_WOLTR       CKYIQNFK-----FSSFLIVG-----DYEDSLLRAARNLHYVNLIKPI------------
RL4_NEOSM       LKWFASNAELS-VGKKFLIVTE----EKNEGLLRAASNLHWVKVLWGS------------
RL4_BDEBA       NKRLQAFGL-----KKAVLVDS----VVDDKFNRASKNLPTFKYFPVE------------
RL4_AQUAE       IEFLKNLGVE---KEKVLVVIP----EKADVLYKSFRNLPNVRVLLPE------------
RL4_AQUPY       VEFLKNLGVD---KETLLIVIP----EKNEVLYKSFRNLQNVRVLLPE------------
RL4_THET8       LAWAKEAGLDG--SESVLLVTG----N--ELVRRAARNLPWVVTLAPE------------
RL4_DEIRA       ISWAKQNGLDG--TEKVLLVTD----D--ENTRRAARNVSWVSVLPVA------------
RL4_ANADE       AKVLAALGA-----KKALVVDD----AANLALARSVRNLAGSDFLAVE------------
RL4_SYNAS       KEVVDRFGL-----KKALFVTE----ERNEFLEKSSRNIAGIKMVRSE------------
RL4_GEOMG       VGVLKTFDV-----TKTLVIID----EANTNLELSARNVKDVKVLKAE------------
RL4_GEOSL       VTVLKAFDL-----AKTLVVVD----EPNLNLELSARNVKDVKVLKAE------------
RL4_PELCD       VEVLNRFEL-----SNVLVVVG----EDNRNLELSARNLPHVKVLKAE------------
RL4_DESAG       VKVAGALGL-----GKALVVTP----EMDDKLVLSARNIPGITLMTPE------------
RL4_DESVH       AKIADTLGL-----DKALIIAP----EENTTLALSVRNIPGITIATPE------------
RL4_DESPS       ASTMKTLEL-----ANALIVMD----DASENLSKSCRNVHGYRILPAE------------
RL4_ONYPE       QQMLQKLNITS---KSLIVVTQ-M--TE--QLALASRNLSYITLETAS------------
RL4_FUSNN       VNLVNKVDAKQ---KQLFVVGD-L--IKDYNLYLSARNLENAVILQPN------------
RL4_BACLD       AAILKGLSIEK---KALIVTA-----DANETVELSARNLPGVTVVEAN------------
RL4_BACSU       AAILKGLSVEK---KALIVTA-----DANEAVALSARNIPGVTVVEAN------------
RL4_BACCZ       LAVLKGLTVEK---KALIVTA-----DANESVELSARNIPGVTVITAD------------
RL4_BACSK       KDVLASLSVDS---KALVVTA-----DYNENVALSARNLPGITFLTAD------------
RL4_BACHD       ASILSGLSVDR---KALVVTA-----DYNDNVALSARNIPGVTFVTAE------------
RL4_GEOKA       VKILNNLSVDR---KALIVTD-----ELNENVYLSARNIPGVKVVAAN------------
RL4_LISMF       AAFLKNISVDT---KALIVVA-----GESENVELSARNLQGITVIPAE------------
RL4_OCEIH       VNILKGLQVDA---KALIVLS-----EKDETVIRSANNLQNVTVLTVE------------
RL4_ENTFA       KQVLANLSIDT---KVLVVLE-----NGNDFAALSARNLPNVSVVTSD------------
RL4_LACSS       AEVLNKLDVNT---KVLVVLE-----DGNDFTALSARNLPNVTVVPAD------------
RL4_LACPL       VNVLNNLNVDT---KTLVLVE-----EDNEKAALAGRNLPNVKILKAK------------
RL4_STRP3       AKVLSALSIDT---KVLVLVE-----EGNEFAALSARNLPNVTVATAA------------
RL4_STRT1       ANVLSALSIDS---KVLVIVE-----EGNKFAELSARNLANVTVATPA------------
RL4_STRR6       AKVLAALSIDS---KVLVILE-----EGNEFAALSARNLPNVKVATAT------------
RL4_LACLA       AKVISALSIER---KVLVVLPN----EGNEFAELSARNLANVKVTTAN------------
RL4_LACAC       VSMLNSLNADG---KVLIVSD-------DNNVQLSARNLAKVKVVPVN------------
RL4_LACJO       KAILDNANVSG---KVLVVSD-------DKNVQLSGKNLPKVKVVPVN------------
RL4_STAAR       KNVLSTLEQPK---KVLVVTE-----NEDVNVELSARNIPGVQVTTAQ------------
RL4_STAS1       KTVLSNLEQPK---KVLVVTE-----SEDVNVALSARNIPGVQVTTAQ------------
RL4_STAEQ       KNVLTTLEQPK---KVLVVTE-----NEDVNVELSARNIPGVQVTTAQ------------
RL4_STAHJ       KNVLTTLEQPK---KVLVVTD-----SEDVNVELSARNIPGVQVSTAQ------------
RL4_CARHZ       IRVLNNLKVNG---KTLIVTA-----GYDEIVEKSARNIPGVSVMTAP------------
RL4_SYMTH       ATLLKNLKVDG---SAFIVTA-----QEDVNIYKSARNIPGVRVNAAR------------
RL4_MOOTA       AHILKNLNAEN---KALVVTA-----TREPNVELSARNLPGVRFLTSD------------
RL4_CLOPE       VKMLNAFEAK----KTLIITA-----EVNENVYKSARNIRGVTVMPVN------------
RL4_CLOTE       VKMLAAFNAK----KTLIVTE-----ESNKNIYKSARNIEGVTVLPVN------------
RL4_CLOAB       VKMLNAFEAK----KALIVVA-----ESDQNVYKSVRNIQGAAVIPAN------------
RL4_CALS4       AELLKNFNAK----SALIVVP-----QGEKNVELSARNMPNAKALYAN------------
RL4_THEMA       KEILQNLQLSDK--KTLIVLPWKE--EGYMNVKLSGRNLPDVKVIIADNPNNSKNGEKAV
RL4_COREF       KAFIERLTER----KSVLLVIG----REDINAQKSANNLPGVHILAAD------------
RL4_CORGL       KAFIERLTER----KSVLLVVS----REDINAQKSANNLPGVHILAAD------------
RL4_CORDI       RSFIERITDR----RNVLLVVG----REDVTAQKSARNLPGVHILFAD------------
RL4_CORJK       RAFIERLTDR----KSVLVVLT----REDVTAWKSVNNLPQVHTLVND------------
RL4_NOCFA       KNFLAELSDR----KKFLVVVG----REDVTAWKSVANLQNVQPIAPD------------
RL4_MYCTU       RAFLASLTER----KQVLVVIG----RSDEAGAKSVRNLPGVHILAPD------------
RL4_MYCPA       KAFLGALTER----KQVLVVIG----RSDEAGAKSVRNLPGVHILAPD------------
RL4_MYCLE       KEFLGTLTDR----KQVLVVIG----RSDETGAKSVRNLPGVHLLSPD------------
RL4_MYCSM       KTFLGTLTEN----KKVLVVIG----RTDEVGAKSVRNLPGVHVISPD------------
RL4_STRAW       KSFLGKVSER----KNVLLVIE----RSDEAALLSARNLPQVHILEPG------------
RL4_STRCO       RTLFGKISER----KNLLLVVD----RADEAAWLSARNLPQIHILEPG------------
RL4_FRACC       VTALRTIADT----RRVLVVAS----RSDELTWKSLRNVAAVHLLDPG------------
RL4_LEIXX       VELLSGVATS----KHVLVVLE----RDDELAFKSVRNIASVHALTYD------------
RL4_CUTAK       KAVLSGLAEL----RKVLVVLD----RSDEIDWLSVRNLSEVHVLAAD------------
RL4_BIFLO       VAALAPITAD----KFTTVVFT----RDNINEWLSVRNIPTVHPIFVD------------
RL4_THEFY       LKTLRKITDS----DKVLVVLS----REDQHNRLALRNLPEVHILDAN------------
RL4_TROWT       LTLFQITGLS----SKLLVVAQ----ASDSVAYRSVRNIPGVRLVHVG------------
RL4_DEHMC       AKILTALQVI----SPTLIAVD----NPDTNFIKSARNIPAVKTTPAN------------
RL4_RHOBA       AQILKNLGLAN---TTTLIATA----GDDQIIYKSGRNISGVTVEPVR------------
RL4_PSYCK       IAKLGELNA-----SRALIVTK----EVDENLYLAARNIPHVNVLDTS------------
RL4_ACIAD       LAKLNDLNA-----ARALIVTD----AVDENLYLAARNLPHVDVVDAT------------
RL4_PSE14       LSKLTGMGL-----TDVLIVSD----AVDQNLYLAARNLPHVDVRDVQ------------
RL4_PSEPK       LNKLNGMGL-----SDVLIVSD----AVDQNLYLAARNLPHVDVRDVQ------------
RL4_PSEAE       VAKLDTLGL-----KDVLIVTD----GVDENLYLAARNLAHVDVRDVQ------------
RL4_HAHCH       NAKLKDLGL-----ENVLIVAD----AVDQNLYLASRNIPHVDVCDAV------------
RL4_HAEDU       VQKLKDLAL-----NDALIITA----SLDENLFLAARNLYKVDVRDVQ------------
RL4_HAEI8       VQKLKDLAV-----EDALIITA----SLDENLFLAARNLYKVDVRDVQ------------
RL4_ECOLI       AQKLKDMAL-----EDVLIITG----ELDENLFLAARNLHKVDVRDAT------------
RL4_PECAS       VEKLKEMAL-----EDVLIITG----ELDENLFLAARNLYKVDVRDAA------------
RL4_YERPS       AQKLKDMAL-----EDVLIVTG----ELDENLFLAARNLYKVDVRDVA------------
RL4_PHOLL       VQKLKEMAL-----EDVLIITN----EVDENLFLAARNLYKVDVRDVA------------
RL4_MORMO       VQKLKDMAL-----EDVMIVTH----EVDENLFLAARNLYKVDVRDVT------------
RL4_SHEON       KAKLKAMNL-----EDVLIVTS----EVDENLFLAARNLYKVDVRDVA------------
RL4_VIBVY       VAKLKELEL-----NDVLIVTG----EVDENLFLAARNLYKVDARDVA------------
RL4_VIBCH       VAKLKELEL-----NDVLIVTG----EVDENLFLAARNLYKVDVRDVT------------
RL4_PHOPR       AAKLKELDL-----SDVLIVTG----ELDENLFLAARNLYKVDVRDAA------------
RL4_COLP3       VAKLKGLEL-----KDVLIVTK----EVDENLFLSARNLYKVDVRDVA------------
RL4_PSET1       VAKLKELEL-----KDVLIVTE----EVDENLFLSARNLYKVDTRDVA------------
RL4_IDILO       AAKLKEMDL-----NDVLIVTK----EVDENLFLASRNLHKVDVRDVQ------------
RL4_SACD2       VQKLAQFDL-----ADVLIIGE----DVSENLYLAARNLHKVDVRDVN------------
RL4_HYDCU       VAKLNTLNL-----KDALVITE----GFDEYLYLSARNLYHADVCDVA------------
RL4_COXBU       KESLKKLNL-----GNVLIIID----GDDRNINLASRNMVGVSVCDAL------------
RL4_FRATT       KSVIDSLGV-----KDVLFVVGVE--EFSENLYLSSRNLKNVAVCDSV------------
RL4_XANOM       IEKLKGLDV--G--KRPLIVTE----EASEHLYLSARNLPYVQVRDVQ------------
RL4_XYLFT       AEKIKSLEVV-G--SSLLIVSD----EISECLSLSSRNLPCVDVRSVQ------------
RL4_METCA       AAKLKSFGE-----GYTVILAE----QLDLNLALSSRNLPNVSINTAD------------
RL4_NITOC       AKLLKPITW-----RSVLIVVA----EDDRNLELSARNIPTVAIRNVS------------
RL4_AROAE       SQKLKGMGLD-----SVLVITD----EFDENLFLSSRNLHKVLVLEVS------------
RL4_NITMU       AQKLKDMGLD-----QVMIITD----NIDENLYLSSRNLPLVKVVEAG------------
RL4_DECAR       TQKLKSMGLEG----NLLVITD----ELNENLYLSSRNLPNVLVLEAQ------------
RL4_CUPPJ       ADKFKAMGLD-----SVLIITD----SLDENLYLASRNLPHVAVVEPR------------
RL4_RALSO       ADKFRAMGLD-----SVLVITD----NLDENLFLASRNLAHVLVVEPR------------
RL4_BURL3       AEKFKTMGLD-----SVLIITD----TVDENLYLASRNLPHVAIVEPR------------
RL4_BORA1       AEKLKALGLD-----SVLIITD----TVDENVYLATRNLPHVAVVEPR------------
RL4_RHOFT       AAKFKAMNLE-----SVLVIAD----EVDENLYLASRNLVNVLVVEPR------------
RL4_THIDA       AGKLKSMGYG-----KVMIIAD----AIDDNLWLSSRNLPNVYVVEPH------------
RL4_NEIG1       AEQVKNLALE-----QVLFVTK----RLDENVYLASRNLPNVLVLEAQ------------
RL4_CHRVO       VGAVQPMGLE-----QALFITN----ELSENLYLSSRNLPNMLVIEAV------------
RL4_NITEU       LQKLKNYQLE-----NVMIITS----EIDSNLYLASRNLPNLKVVEVD------------
RL4_BLOFL       LKKLKNITSDR----SVLIVTDN---VIDKNLILASSNLHTVKIYNLN------------
RL4_BLOPB       LEKLRTITSKK----SILIFTD----FLDKNLLLASRNVHKIEVRTAT------------
RL4_BUCAI       VQKLKDINLK-----NVLIVTN----KIDNNLFLASRNLYSVDVKDVH------------
RL4_BUCAP       VKKLKEIKLN-----NVLILTK----EIENNLFLASRNLYSVDVKDVC------------
RL4_BUCBP       IDKLRDIKLH-----DVLIITK----TKDNNLKLASRNLYKVDVQTVN------------
RL4_WIGBR       KKKLNEMNLE-----NVLIISK----TIDKNLVLSSRNLNKVHVCFPI------------
RL4_LEGPL       LKKMNQMEISS----ALIIMSE-----VGENEYLGSRNLIDYDICDVT------------
RL4_PELUB       HSIIKKFEIT----NSLIILDK----SSKEKIEKSVRNIPNVKVTDIN------------
                                                     *:                     

RL4_TREDE       ---RLRAHDLFYGRKVIMLESAAKNLSEFYGCKEAE------------------------
RL4_TREPA       ---RLRAHDLFYGRKVLVLETAVHKIADFYRSKDAAQDGTY-------------------
RL4_BORBP       ---KLRVVDLFYAKNLIALESAVNKLNEFYVK----------------------------
RL4_BRAPL       ---SMSIHPLYYADEVYFTKTALSKLNARIKG----------------------------
RL4_LEPIC       ---RISCRDILYNRNLVITEAALKEMLVQYGAQK--------------------------
RL4_HELHP       ---ELNAYLVAAFRSVVIEKAVFDEIIAEKKGE---------------------------
RL4_WOLSU       ---ELNAYLVAAFRSVVIEKSLFENITKEG------------------------------
RL4_HELPJ       ---ELNAYLLAAFSSVVMEEAAFQHVVQDKTEE---------------------------
RL4_SULDN       ---ELNAYLAANYRSLVIEKAVWENLVGEAK-----------------------------
RL4_CAMJR       ---EVNAYLVSVFNAVIMEKSALESITKEG------------------------------
RL4_CHLTA       ---NISGYDIAAARNIVVSEKALELLVESLVSTTKD------------------------
RL4_CHLMU       ---NINGYDIAAARNIVVSEKALELLVENLVSTTKD------------------------
RL4_CHLAB       ---NINGYDLVSARNIVISEKALNRLSGHLISAMKD------------------------
RL4_CHLFF       ---NVNGYDLVSARNIVISEKALTGLVGHLTSGTKD------------------------
RL4_CHLCV       ---NINGYDLASARNVVISEKALKGLAGHLISGTKD------------------------
RL4_CHLPN       ---NINGYDLASAHNIVISKKALQELVERLVSETKD------------------------
RL4_MYCMS       ---QLNVFDLLNATKLLITEEAAIAVEEVYA-----------------------------
RL4_MESFL       ---KLNVFDILNATKLVMTEEAAMAVEGVYA-----------------------------
RL4_SPIKU       ---GINIYDLLNANKLLVTEQAIKAIEEVYS-----------------------------
RL4_MYCGA       ---QVSVKDLIDANCVLAQKSAINNWVERLN-----------------------------
RL4_UREPA       ---QVSVRDLMHANVVVVAEEAFTNYARKVSK----------------------------
RL4_MYCPE       ---QVSVRDILNSDIAVIQEDAFDKISEVFA-----------------------------
RL4_MYCGE       ---KVSVRDLLLAKTIIIEKAAFTKLEERLK-----------------------------
RL4_MYCPN       ---KVSVRDLMLANALLVEKEVLKALEGKFK-----------------------------
RL4_MYCH2       ---SLTVESLIKADLLIISKNEITNLEKRI------------------------------
RL4_MYCPU       ---SLMIEDLVAADLLILSNENIKYLEGLIK-----------------------------
RL4_MYCS5       ---SLNVETLVRADVLLVENESMKLLTERVLGSN--------------------------
RL4_MYCMO       ---SLTVELLNETHALLLSKKDLTTLESRVK-----------------------------
RL4_BACFN       ---GLNTYRVLNAGVVVLTESSLKAIDNILI-----------------------------
RL4_BACTN       ---GLNTYRVLNAGVVVLTENSLKAIDNILI-----------------------------
RL4_PORGI       ---LINTYTVLASKNLVLTERSVAVVNELFKA----------------------------
RL4_SALRD       ---SINTVDILDADVVLLQEGALDWLTDVLSTDEAVPA----------------------
RL4_CHLCH       ---KASTYDILYSNTLLVQKSALKTIDETLG-----------------------------
RL4_CHLTE       ---QASTYDILNSQVVLFQKGALQKIEETLG-----------------------------
RL4_PELLD       ---KASTYDILNSHTVLFQKTALKKLEETLG-----------------------------
RL4_TRIV2       ---QLNVYDLLHADKIVVTTSALEKIQEVYNG----------------------------
RL4_SYNY3       ---NLNIYDVLVADTIVATATALEKIQEVYGE----------------------------
RL4_THEEB       ---QLNVFDLLYADRIVATTGAIAKIQEVYGD----------------------------
RL4_SYNE7       ---NLNIFDLLNADRIVSTSAALEKIQEVYGG----------------------------
RL4_SYNJB       ---QINVFDLLNVDWVLITVSALEQLKARWGSDAAPAVLETPSEDAPQADIAEDQALPGD
RL4_SYNJA       ---QLNVFDLLNVDWVLITTSALEKLKARWGSGAAAAAPTQADRLEDQAQAAEREARPVE
RL4_GLOVI       ---NLNVRDLLATDWIVVTGPALELIKETYGAVA--------------------------
RL4_SYNSC       ---QLNVFDLLHANALVLGEEALATIQEVYGDD---------------------------
RL4_SYNPX       ---QLNVFDLLHANALVLGEDALATIQEVYGDD---------------------------
RL4_SYNS9       ---HLNVFDLLHANSLVVGEDALTTIQEVYGDD---------------------------
RL4_PROMM       ---QLNVFDLLHANSLVLSEEALAKIQEVYGDD---------------------------
RL4_PROMA       ---HLNVFDLLNANSLIIGEDALGKIKEVYGDD---------------------------
RL4_PROMT       ---QLNVFDLLNANSLVIGEDALSTIKEVYGND---------------------------
RL4_PROM9       ---QLNVFDILNANKLVIGQSAINKIKEVYAS----------------------------
RL4_PROMP       ---QLNVFDILNANKLVIGQSAINKIQEVYAS----------------------------
RK4_PORPU       ---TLNIMALLAAHKVIITVDALSKIQEVYNG----------------------------
RK4_PYRYE       ---TLNIMALLAAHKIIITVDALSKIQEVYNG----------------------------
RK4_GRATL       ---HLNIVSLLKANHIIINKDALDIINKMYND----------------------------
RK4_TRICV       ---NLNTFSLLKAKQILMTPLAVKDIKEIYCG----------------------------
RK4_CYACA       ---HLNVKSVILAQSLVVTLQALKIIYKTFNDN---------------------------
RK4_CYAM1       ---HIYVKPLLWAKQIWISHEAIPILENQLNVKMME------------------------
RK4_GUITH       ---GLDLKKILQAHHIIFTCKALNDVKEVFNEQ---------------------------
RL4_RHIEC       ---GINVYDIVRRGKLVLSKAAVEALEERFK-----------------------------
RL4_RHIME       ---GINVYDILRRGKLVLSKAAVEALEERFK-----------------------------
RL4_AGRFC       ---GINVYDILRRGKLVLSKAAVEALEERFK-----------------------------
RL4_BRUSU       ---GINVYDILRRGKLVLSKAAVEALEERFK-----------------------------
RL4_RHILO       ---GINVYDILRRGTLVLSKAAVEALEERFK-----------------------------
RL4_BARHE       ---GINVYDILRRSKLVLSKAAVEVLEERFK-----------------------------
RL4_BARQU       ---GINVYDILRRSKLVLSKAAVEALEERFK-----------------------------
RL4_BRADU       ---GINVYDILRRQKLVLTKAAIDALEARFK-----------------------------
RL4_RHOPB       ---GINVYDILRRQKLVLTKAAVDALEARFK-----------------------------
RL4_RHOPA       ---GINVYDILRRKKLVLTKAAVDALEARFK-----------------------------
RL4_RHOP2       ---GINVYDIVRRRKLVLTKAALDALEARFK-----------------------------
RL4_NITWN       ---GINVYDILRRQKLVLTKAAVDALEARFK-----------------------------
RL4_CAUVC       ---GLNVYDVLRRQTLVLTKDAVEAISARFAEKEAA------------------------
RL4_MAGSA       ---GANVYDILRRDTLVLTKDAVAALEARLK-----------------------------
RL4_RHORT       ---GANVYDILRRDTLVLTKEAVKHLEERLQ-----------------------------
RL4_JANSC       ---GANVYDILKRDTLVITKAGVEALEARLK-----------------------------
RL4_RUEPO       ---GANVYDILKRDTLVLTKAAVEALEARLK-----------------------------
RL4_RHOS4       ---GANVYDILKRDTLVITKAGVEALEARLK-----------------------------
RL4_NOVAD       ---GANVYDILKHDTLVLTRAAVEKLEARFNG----------------------------
RL4_ZYMMO       ---GANVYDILKHDTLVLTRAAVEKLEARLNG----------------------------
RL4_GLUOX       ---GANVYDILNHDVLVITRAGLEGLKERLA-----------------------------
RL4_RICPR       ---GANVYDIIRHEYVLLSQEAVSFLEERLR-----------------------------
RL4_RICTY       ---GANVYDIIRHEYVLLSQEAVSFLEERLR-----------------------------
RL4_RICFE       ---GANVYDIIRHEYVLLSQEAVSVLEERLR-----------------------------
RL4_RICBR       ---GANVYDIIRHEYVLLSQEAVNVLEERLK-----------------------------
RL4_ANAMM       ---GINVLDILRHDCVILTVGTVKCLESRLCNG---------------------------
RL4_ANAPZ       ---GINVLDILKHDCVILTVDTVKSLEGRLSNE---------------------------
RL4_EHRCR       ---GTNVLDILRHDCIILTVGAVKYLEERLL-----------------------------
RL4_EHRRW       ---GTNVFDILRHDCVILTVDTVKYLEDRLL-----------------------------
RL4_WOLPM       ---GLNVFDILNHECVMLTKDTLKHLEGRLL-----------------------------
RL4_WOLTR       ---GLNVFDILNHECIMLTSDALRYLEGRLL-----------------------------
RL4_NEOSM       ---SANVYDVVLHDFVLLEKASVDVLVKRLLK----------------------------
RL4_BDEBA       ---GLNVFDLLKYDAAVITKDSVAKIVDRCSLEKA-------------------------
RL4_AQUAE       ---GLNVYDVLWANKLVIQKDCLDRIYKKVEA----------------------------
RL4_AQUPY       ---GLNVYDVLWANKLVIHKECLDRIYKKVEA----------------------------
RL4_THET8       ---GLNVYDIVRTERLVMDLDAWEVFQNRIGGEA--------------------------
RL4_DEIRA       ---GVNVYDILRHDRLVIDAAALEIVEEEAGEEQQ-------------------------
RL4_ANADE       ---GLNVYDILRHDALVLTADTAKKLEASLS-----------------------------
RL4_SYNAS       ---GLNVYDVLNHEHLVIIEPAVKKLEGALKS----------------------------
RL4_GEOMG       ---HLNVFDIVKFNNIILTQSAVRKIEGALQS----------------------------
RL4_GEOSL       ---HLNVFDIVKYNNIIVTQSAVRTIEGVLQS----------------------------
RL4_PELCD       ---GVNVYDLMNHRNLVVTEGAVEQLEGALG-----------------------------
RL4_DESAG       ---QLSVFEILKHAQLVLLEGAVEPVQERLK-----------------------------
RL4_DESVH       ---QLSVYEILKHKQLVLVEGAVASVQDRLK-----------------------------
RL4_DESPS       ---GLNVYDILLHKKVVLVKPVIESLEKRLMV----------------------------
RL4_ONYPE       ---HASVYQILNCKQLVLTAAAVNYFEEVLK-----------------------------
RL4_FUSNN       ---EIGVYWLLKQEKVILTKEALATVEEVLG-----------------------------
RL4_BACLD       ---GINVLDVVGHEKLVMTKAAVEKVEEVLA-----------------------------
RL4_BACSU       ---GINVLDVVNHEKLLITKAAVEKVEEVLA-----------------------------
RL4_BACCZ       ---GVNVLDVLHHDKLIMTKAAVEKVEEVLA-----------------------------
RL4_BACSK       ---GVNVLDLLKHDKLVITKDAVEKVEEVLA-----------------------------
RL4_BACHD       ---GVNVLDVIKHDKLIITKDAVEKVEEVLA-----------------------------
RL4_GEOKA       ---GINVLDVLNHDKLVITKAAVEKVEEVLA-----------------------------
RL4_LISMF       ---SISVLEVAKHDKLIITKAAVEKVEEVLA-----------------------------
RL4_OCEIH       ---ELNILDLLMHDKLIITKDAAEKAGEVLA-----------------------------
RL4_ENTFA       ---NVSVLDVVSANKVLATQTALTQIEEVLA-----------------------------
RL4_LACSS       ---GINVLDVVGNQKLILTQAALSKIEEVLA-----------------------------
RL4_LACPL       ---GVNVLDVANSDKLVVTQKALDQLEEALA-----------------------------
RL4_STRP3       ---TASVLDIVNADKLLVTKEAISTIEEVLS-----------------------------
RL4_STRT1       ---TASVLDIVNADKLLVTKEAISSIEEVLA-----------------------------
RL4_STRR6       ---TASVLDIANSDKLLVTQAAISKIEEVLA-----------------------------
RL4_LACLA       ---SASVLDIVSADKLLVVQSALTQIEEVLA-----------------------------
RL4_LACAC       ---GLNVEDAVNYGKLILTQDAVKKIEEVLA-----------------------------
RL4_LACJO       ---GLNVVDAVDYQKLVLTQDAIKRIEEVLA-----------------------------
RL4_STAAR       ---GLNVLDITNADSLVITEAAAKKVEEVLG-----------------------------
RL4_STAS1       ---GLNVLDITSADSVVITESAAKKVEEVLG-----------------------------
RL4_STAEQ       ---GLNVLDLTSADSVIITEAAAKKVEEVLA-----------------------------
RL4_STAHJ       ---GLNVLDITSADSVIITESAAKKVEEVLG-----------------------------
RL4_CARHZ       ---SLNALSLLNHDKLIMTRDAVLKVEEVF------------------------------
RL4_SYMTH       ---NLNAYDVLAASKLVFTQDAVAKVEEVLG-----------------------------
RL4_MOOTA       ---GINVYDLLAHDKLVITKDAVARVQEVLA-----------------------------
RL4_CLOPE       ---NINVYDLLNCKTLMITKEAVNKIEEVYA-----------------------------
RL4_CLOTE       ---NINVYDILRYDKFIITKDAVSKIEEVYA-----------------------------
RL4_CLOAB       ---NLNVYDILKYDKFIVTKEAVSKIEEVYA-----------------------------
RL4_CALS4       ---LLNTYDVLKYEKFIITKDAVAIVEEVFA-----------------------------
RL4_THEMA       RIDGLNVFDMLKYDYLVLTRDMVSKIEEVLGNEAGKALTA--------------------
RL4_COREF       ---QLNTYDVLNSDDIVFSVEALHTFINRA-------TGAAQEEQN--------------
RL4_CORGL       ---QLNTYDVLKSDDVVFSVEALHTFINRA-------SGAAQEEQN--------------
RL4_CORDI       ---QLNTYDVLYSDDVVFSVEALNTFINRA-------SGAAQEEK---------------
RL4_CORJK       ---QLNTYDVLNADDVVFSVEALNAFINAA-------DKTKEEAK---------------
RL4_NOCFA       ---QLNTYDVLNSDDVVFSVEALNAFVHGP-------TEAAQEESK--------------
RL4_MYCTU       ---QLNTYDVLRADDVVFSVEALNAYIAAN-------TTTSEEVSA--------------
RL4_MYCPA       ---QLNTYDVLRADDVVFSVEALRAYIAAN-------TGTPEEVSA--------------
RL4_MYCLE       ---QLNTYDVLRADDLVFSVEALNSYIAAQQA---AGTSTPEKVSA--------------
RL4_MYCSM       ---QLNTYDVLNADDVVFSVEALNAYISAN---------SKEGASV--------------
RL4_STRAW       ---QLNTYDVLVSDDVVFTQAAFESFVSGAPQ---SSAADTEGSEA--------------
RL4_STRCO       ---QLNTYDVLVSDDVVFTQAAFESFVSGP-----NKAVDTEGSEA--------------
RL4_FRACC       ---QLNTYDVLVSDDVVFIEDALAAFLARD-T---RPATSTAGTEAAAGTEGVAGAEENK
RL4_LEIXX       ---QLNAYDVLVSDDIVFTQAALEGFIAAKST-----SAATKKEEVNA------------
RL4_CUTAK       ---QLNTYDVVNARTIVFSQAGLDAFVGARSANTQALSAQPEVPETNVADQHPYGEDSFR
RL4_BIFLO       ---QLNTYDVITSQYVVFTKEAFEAFVAAK----------TEPKEA--------------
RL4_THEFY       ---QVNTYDVLYADDIVFTEAGYQEFLAHAKG---SKIAASQEDDQ--------------
RL4_TROWT       ---QLNSYDVLRSDDVLFTRGAYNVFVGPSGDLAFSEDRDNPGTSLPKSPTPEDSSDATK
RL4_DEHMC       ---LLNISDMLKNKQLVMTEEAVRQVEELWGQ------RSG-------------------
RL4_RHOBA       ---QLNALTLLTPKRVLFTQEALDRVKDGTFA------GSTQNTNEAEAAA---------
RL4_PSYCK       ---EVDPVSLIAFDKVIMTVEAAKQFEEALA-----------------------------
RL4_ACIAD       ---AIDPVSLIAFDKVVMSVAAAKKIEVELG-----------------------------
RL4_PSE14       ---GSDPVSLIAYDKVLITVSAVKKFEELLG-----------------------------
RL4_PSEPK       ---GSDPVSLIAYEKVLITVSAVKKFEELLG-----------------------------
RL4_PSEAE       ---GSDPVSLIAYDKVLVTVSAVKKFEELLG-----------------------------
RL4_HAHCH       ---AINPVSLIAHDKVLVTVSALKKIEEMLG-----------------------------
RL4_HAEDU       ---GIDPVSLIAFDKVVITTDAVKQIEEMLA-----------------------------
RL4_HAEI8       ---GIDPVSLIAFDKVIVTVDAVKQIEEILA-----------------------------
RL4_ECOLI       ---GIDPVSLIAFDKVVMTADAVKQVEEMLA-----------------------------
RL4_PECAS       ---AIDPVSLIAFDKVVMTADAVKQVEEMLA-----------------------------
RL4_YERPS       ---GIDPVSLIAFDKVVMTADAVKQVEEMLA-----------------------------
RL4_PHOLL       ---GIDPVSLIAFDKVVMTADAVKQVEEMLA-----------------------------
RL4_MORMO       ---AIDPVSLIAFGKVVMTAEAVKQVEEMLA-----------------------------
RL4_SHEON       ---GLDPVSLIAFNTVLVTADAVKQIEEMLA-----------------------------
RL4_VIBVY       ---GIDPVSLIAFNKVLMTADAVKQVEEMLA-----------------------------
RL4_VIBCH       ---GIDPVSLIAFDKVLMTAAAVKQVEEMLA-----------------------------
RL4_PHOPR       ---TIDPVSLIAFDKIVMTAAAVKQVEEMLA-----------------------------
RL4_COLP3       ---AIDPVSLVGFEKVLITADAVKEIEGILA-----------------------------
RL4_PSET1       ---GIDPVSLIAFDKVLITAAAVKQLEEALA-----------------------------
RL4_IDILO       ---GIDPVSLIAFEKVLMTADAVKQLEEVLS-----------------------------
RL4_SACD2       ---GLDPVSLIRFDKVVVTVAALKKLEEVLV-----------------------------
RL4_HYDCU       ---SIDPVSLVGFKSIVVTQGAIKQLEEKLA-----------------------------
RL4_COXBU       ---HVDPVSLVAAENIVVTVDAVKRLEERLS-----------------------------
RL4_FRATT       ---EINPVSLVCFENVVLTKKAIKEIEEKLV-----------------------------
RL4_XANOM       ---GLDPVALVGADTVVITADAVKKVEEWLA-----------------------------
RL4_XYLFT       ---ALDPVALVGSDVVVLTVGAVKKIEEWLV-----------------------------
RL4_METCA       ---TLSPVDLVHAERVIATSSAIRKLEVRLS-----------------------------
RL4_NITOC       ---RVSPVELIRFDGVLVTGDAIRCFEESLT-----------------------------
RL4_AROAE       ---ETDPVSLVHYDRVIVTKGALAKMEEAWQ-----------------------------
RL4_NITMU       ---YADPVSLMRFANVLITRNALAKMEEALA-----------------------------
RL4_DECAR       ---EADPVSLVRFAKVLVTKNAVAKFEEMWG-----------------------------
RL4_CUPPJ       ---QADPLSLVHYKKVLVTKAAVAQIEELLK-----------------------------
RL4_RALSO       ---HADPLSLVHYKKVLVTKAAVAQIEELLK-----------------------------
RL4_BURL3       ---YADPLSLIYFKKVLVTKAAVAQIEELLS-----------------------------
RL4_BORA1       ---YADPLSLIHYKKVLITKPAIAQLEEMLG-----------------------------
RL4_RHOFT       ---YADPVSLVHYRKVIVTKAAMEKLQEMFA-----------------------------
RL4_THIDA       ---QADPWSLVKFGNVLITKAAIKQFEEMV------------------------------
RL4_NEIG1       ---QVDPYSLLRYKKVIITKDAVAQLEEQWV-----------------------------
RL4_CHRVO       ---QADPYSLLRFKKTVITRDAVKQLEEQWA-----------------------------
RL4_NITEU       ---LIDPVSLLAYDNVVITRDTVNKIENVLQ-----------------------------
RL4_BLOFL       ---SIDPVSLINFNITLLFRTIVESLELRLS-----------------------------
RL4_BLOPB       ---HIDPVSLINFNVTLIADNVIKKIEKQLV-----------------------------
RL4_BUCAI       ---SIDPVSLIAFDHVVITVEAVKRIEEILS-----------------------------
RL4_BUCAP       ---SMDPVSLIAFEHIIITVAALKKVEEMLS-----------------------------
RL4_BUCBP       ---HMNPRSLISFNHVLITSKAIQKVEELLT-----------------------------
RL4_WIGBR       ---NINPINLISFKKTIITIDAIKIIEEILT-----------------------------
RL4_LEGPL       ---TIDPVSLLRFEKVVVTEAAIKKIEEQLQ-----------------------------
RL4_PELUB       ---HFSAFDIIKFKKVVFTESSIKELEKRYS-----------------------------
                                                                            

RL4_TREDE       ------------------------------------------------------------
RL4_TREPA       ------------------------------------------------------------
RL4_BORBP       ------------------------------------------------------------
RL4_BRAPL       ------------------------------------------------------------
RL4_LEPIC       ------------------------------------------------------------
RL4_HELHP       ------------------------------------------------------------
RL4_WOLSU       ------------------------------------------------------------
RL4_HELPJ       ------------------------------------------------------------
RL4_SULDN       ------------------------------------------------------------
RL4_CAMJR       ------------------------------------------------------------
RL4_CHLTA       ------------------------------------------------------------
RL4_CHLMU       ------------------------------------------------------------
RL4_CHLAB       ------------------------------------------------------------
RL4_CHLFF       ------------------------------------------------------------
RL4_CHLCV       ------------------------------------------------------------
RL4_CHLPN       ------------------------------------------------------------
RL4_MYCMS       ------------------------------------------------------------
RL4_MESFL       ------------------------------------------------------------
RL4_SPIKU       ------------------------------------------------------------
RL4_MYCGA       ------------------------------------------------------------
RL4_UREPA       ------------------------------------------------------------
RL4_MYCPE       ------------------------------------------------------------
RL4_MYCGE       ------------------------------------------------------------
RL4_MYCPN       ------------------------------------------------------------
RL4_MYCH2       ------------------------------------------------------------
RL4_MYCPU       ------------------------------------------------------------
RL4_MYCS5       ------------------------------------------------------------
RL4_MYCMO       ------------------------------------------------------------
RL4_BACFN       ------------------------------------------------------------
RL4_BACTN       ------------------------------------------------------------
RL4_PORGI       ------------------------------------------------------------
RL4_SALRD       ------------------------------------------------------------
RL4_CHLCH       ------------------------------------------------------------
RL4_CHLTE       ------------------------------------------------------------
RL4_PELLD       ------------------------------------------------------------
RL4_TRIV2       ------------------------------------------------------------
RL4_SYNY3       ------------------------------------------------------------
RL4_THEEB       ------------------------------------------------------------
RL4_SYNE7       ------------------------------------------------------------
RL4_SYNJB       GPEDQAVPESEHEEAEQTPAQPEAQENQAALQGRPADPQGPEEQTEEPQDPAE-------
RL4_SYNJA       QAEGQSQEQEEQAEAQAQPEAPPAQADQANQVAL-ANPQVQETQEEELAQAQEREVQGQA
RL4_GLOVI       ------------------------------------------------------------
RL4_SYNSC       ------------------------------------------------------------
RL4_SYNPX       ------------------------------------------------------------
RL4_SYNS9       ------------------------------------------------------------
RL4_PROMM       ------------------------------------------------------------
RL4_PROMA       ------------------------------------------------------------
RL4_PROMT       ------------------------------------------------------------
RL4_PROM9       ------------------------------------------------------------
RL4_PROMP       ------------------------------------------------------------
RK4_PORPU       ------------------------------------------------------------
RK4_PYRYE       ------------------------------------------------------------
RK4_GRATL       ------------------------------------------------------------
RK4_TRICV       ------------------------------------------------------------
RK4_CYACA       ------------------------------------------------------------
RK4_CYAM1       ------------------------------------------------------------
RK4_GUITH       ------------------------------------------------------------
RL4_RHIEC       ------------------------------------------------------------
RL4_RHIME       ------------------------------------------------------------
RL4_AGRFC       ------------------------------------------------------------
RL4_BRUSU       ------------------------------------------------------------
RL4_RHILO       ------------------------------------------------------------
RL4_BARHE       ------------------------------------------------------------
RL4_BARQU       ------------------------------------------------------------
RL4_BRADU       ------------------------------------------------------------
RL4_RHOPB       ------------------------------------------------------------
RL4_RHOPA       ------------------------------------------------------------
RL4_RHOP2       ------------------------------------------------------------
RL4_NITWN       ------------------------------------------------------------
RL4_CAUVC       ------------------------------------------------------------
RL4_MAGSA       ------------------------------------------------------------
RL4_RHORT       ------------------------------------------------------------
RL4_JANSC       ------------------------------------------------------------
RL4_RUEPO       ------------------------------------------------------------
RL4_RHOS4       ------------------------------------------------------------
RL4_NOVAD       ------------------------------------------------------------
RL4_ZYMMO       ------------------------------------------------------------
RL4_GLUOX       ------------------------------------------------------------
RL4_RICPR       ------------------------------------------------------------
RL4_RICTY       ------------------------------------------------------------
RL4_RICFE       ------------------------------------------------------------
RL4_RICBR       ------------------------------------------------------------
RL4_ANAMM       ------------------------------------------------------------
RL4_ANAPZ       ------------------------------------------------------------
RL4_EHRCR       ------------------------------------------------------------
RL4_EHRRW       ------------------------------------------------------------
RL4_WOLPM       ------------------------------------------------------------
RL4_WOLTR       ------------------------------------------------------------
RL4_NEOSM       ------------------------------------------------------------
RL4_BDEBA       ------------------------------------------------------------
RL4_AQUAE       ------------------------------------------------------------
RL4_AQUPY       ------------------------------------------------------------
RL4_THET8       ------------------------------------------------------------
RL4_DEIRA       ------------------------------------------------------------
RL4_ANADE       ------------------------------------------------------------
RL4_SYNAS       ------------------------------------------------------------
RL4_GEOMG       ------------------------------------------------------------
RL4_GEOSL       ------------------------------------------------------------
RL4_PELCD       ------------------------------------------------------------
RL4_DESAG       ------------------------------------------------------------
RL4_DESVH       ------------------------------------------------------------
RL4_DESPS       ------------------------------------------------------------
RL4_ONYPE       ------------------------------------------------------------
RL4_FUSNN       ------------------------------------------------------------
RL4_BACLD       ------------------------------------------------------------
RL4_BACSU       ------------------------------------------------------------
RL4_BACCZ       ------------------------------------------------------------
RL4_BACSK       ------------------------------------------------------------
RL4_BACHD       ------------------------------------------------------------
RL4_GEOKA       ------------------------------------------------------------
RL4_LISMF       ------------------------------------------------------------
RL4_OCEIH       ------------------------------------------------------------
RL4_ENTFA       ------------------------------------------------------------
RL4_LACSS       ------------------------------------------------------------
RL4_LACPL       ------------------------------------------------------------
RL4_STRP3       ------------------------------------------------------------
RL4_STRT1       ------------------------------------------------------------
RL4_STRR6       ------------------------------------------------------------
RL4_LACLA       ------------------------------------------------------------
RL4_LACAC       ------------------------------------------------------------
RL4_LACJO       ------------------------------------------------------------
RL4_STAAR       ------------------------------------------------------------
RL4_STAS1       ------------------------------------------------------------
RL4_STAEQ       ------------------------------------------------------------
RL4_STAHJ       ------------------------------------------------------------
RL4_CARHZ       ------------------------------------------------------------
RL4_SYMTH       ------------------------------------------------------------
RL4_MOOTA       ------------------------------------------------------------
RL4_CLOPE       ------------------------------------------------------------
RL4_CLOTE       ------------------------------------------------------------
RL4_CLOAB       ------------------------------------------------------------
RL4_CALS4       ------------------------------------------------------------
RL4_THEMA       ------------------------------------------------------------
RL4_COREF       ------------------------------------------------------------
RL4_CORGL       ------------------------------------------------------------
RL4_CORDI       ------------------------------------------------------------
RL4_CORJK       ------------------------------------------------------------
RL4_NOCFA       ------------------------------------------------------------
RL4_MYCTU       ------------------------------------------------------------
RL4_MYCPA       ------------------------------------------------------------
RL4_MYCLE       ------------------------------------------------------------
RL4_MYCSM       ------------------------------------------------------------
RL4_STRAW       ------------------------------------------------------------
RL4_STRCO       ------------------------------------------------------------
RL4_FRACC       ------------------------------------------------------------
RL4_LEIXX       ------------------------------------------------------------
RL4_CUTAK       GDNPPAGFDIKGNEDSMKFHEPSSPWYGRTIAEVWFRSAAAAEAAGFVNAVKSDSEKEDA
RL4_BIFLO       ------------------------------------------------------------
RL4_THEFY       ------------------------------------------------------------
RL4_TROWT       ARSSRHDDRTGA------------------------------------------------
RL4_DEHMC       ------------------------------------------------------------
RL4_RHOBA       ------------------------------------------------------------
RL4_PSYCK       ------------------------------------------------------------
RL4_ACIAD       ------------------------------------------------------------
RL4_PSE14       ------------------------------------------------------------
RL4_PSEPK       ------------------------------------------------------------
RL4_PSEAE       ------------------------------------------------------------
RL4_HAHCH       ------------------------------------------------------------
RL4_HAEDU       ------------------------------------------------------------
RL4_HAEI8       ------------------------------------------------------------
RL4_ECOLI       ------------------------------------------------------------
RL4_PECAS       ------------------------------------------------------------
RL4_YERPS       ------------------------------------------------------------
RL4_PHOLL       ------------------------------------------------------------
RL4_MORMO       ------------------------------------------------------------
RL4_SHEON       ------------------------------------------------------------
RL4_VIBVY       ------------------------------------------------------------
RL4_VIBCH       ------------------------------------------------------------
RL4_PHOPR       ------------------------------------------------------------
RL4_COLP3       ------------------------------------------------------------
RL4_PSET1       ------------------------------------------------------------
RL4_IDILO       ------------------------------------------------------------
RL4_SACD2       ------------------------------------------------------------
RL4_HYDCU       ------------------------------------------------------------
RL4_COXBU       ------------------------------------------------------------
RL4_FRATT       ------------------------------------------------------------
RL4_XANOM       ------------------------------------------------------------
RL4_XYLFT       ------------------------------------------------------------
RL4_METCA       ------------------------------------------------------------
RL4_NITOC       ------------------------------------------------------------
RL4_AROAE       ------------------------------------------------------------
RL4_NITMU       ------------------------------------------------------------
RL4_DECAR       ------------------------------------------------------------
RL4_CUPPJ       ------------------------------------------------------------
RL4_RALSO       ------------------------------------------------------------
RL4_BURL3       ------------------------------------------------------------
RL4_BORA1       ------------------------------------------------------------
RL4_RHOFT       ------------------------------------------------------------
RL4_THIDA       ------------------------------------------------------------
RL4_NEIG1       ------------------------------------------------------------
RL4_CHRVO       ------------------------------------------------------------
RL4_NITEU       ------------------------------------------------------------
RL4_BLOFL       ------------------------------------------------------------
RL4_BLOPB       ------------------------------------------------------------
RL4_BUCAI       ------------------------------------------------------------
RL4_BUCAP       ------------------------------------------------------------
RL4_BUCBP       ------------------------------------------------------------
RL4_WIGBR       ------------------------------------------------------------
RL4_LEGPL       ------------------------------------------------------------
RL4_PELUB       ------------------------------------------------------------
                                                                            

RL4_TREDE       -----------------------------
RL4_TREPA       -----------------------------
RL4_BORBP       -----------------------------
RL4_BRAPL       -----------------------------
RL4_LEPIC       -----------------------------
RL4_HELHP       -----------------------------
RL4_WOLSU       -----------------------------
RL4_HELPJ       -----------------------------
RL4_SULDN       -----------------------------
RL4_CAMJR       -----------------------------
RL4_CHLTA       -----------------------------
RL4_CHLMU       -----------------------------
RL4_CHLAB       -----------------------------
RL4_CHLFF       -----------------------------
RL4_CHLCV       -----------------------------
RL4_CHLPN       -----------------------------
RL4_MYCMS       -----------------------------
RL4_MESFL       -----------------------------
RL4_SPIKU       -----------------------------
RL4_MYCGA       -----------------------------
RL4_UREPA       -----------------------------
RL4_MYCPE       -----------------------------
RL4_MYCGE       -----------------------------
RL4_MYCPN       -----------------------------
RL4_MYCH2       -----------------------------
RL4_MYCPU       -----------------------------
RL4_MYCS5       -----------------------------
RL4_MYCMO       -----------------------------
RL4_BACFN       -----------------------------
RL4_BACTN       -----------------------------
RL4_PORGI       -----------------------------
RL4_SALRD       -----------------------------
RL4_CHLCH       -----------------------------
RL4_CHLTE       -----------------------------
RL4_PELLD       -----------------------------
RL4_TRIV2       -----------------------------
RL4_SYNY3       -----------------------------
RL4_THEEB       -----------------------------
RL4_SYNE7       -----------------------------
RL4_SYNJB       ELAQGAEP----STVEEAETAPAEEESDD
RL4_SYNJA       ELAQEAEPLAQPPAGEEAETAAAEEEDND
RL4_GLOVI       -----------------------------
RL4_SYNSC       -----------------------------
RL4_SYNPX       -----------------------------
RL4_SYNS9       -----------------------------
RL4_PROMM       -----------------------------
RL4_PROMA       -----------------------------
RL4_PROMT       -----------------------------
RL4_PROM9       -----------------------------
RL4_PROMP       -----------------------------
RK4_PORPU       -----------------------------
RK4_PYRYE       -----------------------------
RK4_GRATL       -----------------------------
RK4_TRICV       -----------------------------
RK4_CYACA       -----------------------------
RK4_CYAM1       -----------------------------
RK4_GUITH       -----------------------------
RL4_RHIEC       -----------------------------
RL4_RHIME       -----------------------------
RL4_AGRFC       -----------------------------
RL4_BRUSU       -----------------------------
RL4_RHILO       -----------------------------
RL4_BARHE       -----------------------------
RL4_BARQU       -----------------------------
RL4_BRADU       -----------------------------
RL4_RHOPB       -----------------------------
RL4_RHOPA       -----------------------------
RL4_RHOP2       -----------------------------
RL4_NITWN       -----------------------------
RL4_CAUVC       -----------------------------
RL4_MAGSA       -----------------------------
RL4_RHORT       -----------------------------
RL4_JANSC       -----------------------------
RL4_RUEPO       -----------------------------
RL4_RHOS4       -----------------------------
RL4_NOVAD       -----------------------------
RL4_ZYMMO       -----------------------------
RL4_GLUOX       -----------------------------
RL4_RICPR       -----------------------------
RL4_RICTY       -----------------------------
RL4_RICFE       -----------------------------
RL4_RICBR       -----------------------------
RL4_ANAMM       -----------------------------
RL4_ANAPZ       -----------------------------
RL4_EHRCR       -----------------------------
RL4_EHRRW       -----------------------------
RL4_WOLPM       -----------------------------
RL4_WOLTR       -----------------------------
RL4_NEOSM       -----------------------------
RL4_BDEBA       -----------------------------
RL4_AQUAE       -----------------------------
RL4_AQUPY       -----------------------------
RL4_THET8       -----------------------------
RL4_DEIRA       -----------------------------
RL4_ANADE       -----------------------------
RL4_SYNAS       -----------------------------
RL4_GEOMG       -----------------------------
RL4_GEOSL       -----------------------------
RL4_PELCD       -----------------------------
RL4_DESAG       -----------------------------
RL4_DESVH       -----------------------------
RL4_DESPS       -----------------------------
RL4_ONYPE       -----------------------------
RL4_FUSNN       -----------------------------
RL4_BACLD       -----------------------------
RL4_BACSU       -----------------------------
RL4_BACCZ       -----------------------------
RL4_BACSK       -----------------------------
RL4_BACHD       -----------------------------
RL4_GEOKA       -----------------------------
RL4_LISMF       -----------------------------
RL4_OCEIH       -----------------------------
RL4_ENTFA       -----------------------------
RL4_LACSS       -----------------------------
RL4_LACPL       -----------------------------
RL4_STRP3       -----------------------------
RL4_STRT1       -----------------------------
RL4_STRR6       -----------------------------
RL4_LACLA       -----------------------------
RL4_LACAC       -----------------------------
RL4_LACJO       -----------------------------
RL4_STAAR       -----------------------------
RL4_STAS1       -----------------------------
RL4_STAEQ       -----------------------------
RL4_STAHJ       -----------------------------
RL4_CARHZ       -----------------------------
RL4_SYMTH       -----------------------------
RL4_MOOTA       -----------------------------
RL4_CLOPE       -----------------------------
RL4_CLOTE       -----------------------------
RL4_CLOAB       -----------------------------
RL4_CALS4       -----------------------------
RL4_THEMA       -----------------------------
RL4_COREF       -----------------------------
RL4_CORGL       -----------------------------
RL4_CORDI       -----------------------------
RL4_CORJK       -----------------------------
RL4_NOCFA       -----------------------------
RL4_MYCTU       -----------------------------
RL4_MYCPA       -----------------------------
RL4_MYCLE       -----------------------------
RL4_MYCSM       -----------------------------
RL4_STRAW       -----------------------------
RL4_STRCO       -----------------------------
RL4_FRACC       -----------------------------
RL4_LEIXX       -----------------------------
RL4_CUTAK       K----------------------------
RL4_BIFLO       -----------------------------
RL4_THEFY       -----------------------------
RL4_TROWT       -----------------------------
RL4_DEHMC       -----------------------------
RL4_RHOBA       -----------------------------
RL4_PSYCK       -----------------------------
RL4_ACIAD       -----------------------------
RL4_PSE14       -----------------------------
RL4_PSEPK       -----------------------------
RL4_PSEAE       -----------------------------
RL4_HAHCH       -----------------------------
RL4_HAEDU       -----------------------------
RL4_HAEI8       -----------------------------
RL4_ECOLI       -----------------------------
RL4_PECAS       -----------------------------
RL4_YERPS       -----------------------------
RL4_PHOLL       -----------------------------
RL4_MORMO       -----------------------------
RL4_SHEON       -----------------------------
RL4_VIBVY       -----------------------------
RL4_VIBCH       -----------------------------
RL4_PHOPR       -----------------------------
RL4_COLP3       -----------------------------
RL4_PSET1       -----------------------------
RL4_IDILO       -----------------------------
RL4_SACD2       -----------------------------
RL4_HYDCU       -----------------------------
RL4_COXBU       -----------------------------
RL4_FRATT       -----------------------------
RL4_XANOM       -----------------------------
RL4_XYLFT       -----------------------------
RL4_METCA       -----------------------------
RL4_NITOC       -----------------------------
RL4_AROAE       -----------------------------
RL4_NITMU       -----------------------------
RL4_DECAR       -----------------------------
RL4_CUPPJ       -----------------------------
RL4_RALSO       -----------------------------
RL4_BURL3       -----------------------------
RL4_BORA1       -----------------------------
RL4_RHOFT       -----------------------------
RL4_THIDA       -----------------------------
RL4_NEIG1       -----------------------------
RL4_CHRVO       -----------------------------
RL4_NITEU       -----------------------------
RL4_BLOFL       -----------------------------
RL4_BLOPB       -----------------------------
RL4_BUCAI       -----------------------------
RL4_BUCAP       -----------------------------
RL4_BUCBP       -----------------------------
RL4_WIGBR       -----------------------------
RL4_LEGPL       -----------------------------
RL4_PELUB       -----------------------------