CLUSTAL format seed alignment for MF_01333_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RK5_THAPS       MRSQQSLEEIAELYGLLENIKKEYEDGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGL
RK5_TRICV       MRNQHSLEEIAEIHSLLEDIKGEYEKGIRAVIKKNNPELFGNPHTIPKLQKIQINRGLGL
RK5_PHATC       MLNQHSLEEIAEIHNLLGNIKQEYEIGIKPLLIKNSPKLFKNPHTVPKLKKIQINRGLGL
RL5_TROW8       ------------MTCYTPRLLTRYREEIVPVLMSRFD--INNVHQVPSITKIVVNSGVGD
RL5_TROWT       ------------MTCYTPRLLTRYREEIVPVLMSRFD--INNVHQVPSITKIVVNSGVGD
RL5_COREF       -----------MAENYTPRLKSRYQDEIRPNLQTQFE--FSNVMQIPGVTKVVVNMGVGD
RL5_CORGL       -----------MTENYIPRLKTRYQDEIRTKLQGEFE--FENVMQIPGVTKIVVNMGVGD
RL5_CORDI       -----------MSENYTPRLKTRYREEIRTKLNDEFS--YENVMQIPGVVKVVVNMGVGD
RL5_STRAW       -----------MATTTTPRLKTKYREEIAGKLQEEFS--YENVMQTPGLVKIVVNMGVGD
RL5_STRCO       -----------MATTTTPRLKTKYREEIAGKLREEFS--YENVMQIPGLVKIVVNMGVGD
RL5_MICLU       ------MTEVQQTEKVTPRLKTKYREEIRGRLQEQFQ--YGNVMQVPGLVKVVVNMGVGE
RL5_MYCBO       ---------MTTAQKVQPRLKERYRSEIRDALRKQFG--YGNVMQIPTVTKVVVNMGVGE
RL5_MYCTU       ---------MTTAQKVQPRLKERYRSEIRDALRKQFG--YGNVMQIPTVTKVVVNMGVGE
RL5_MYCLE       ---------MSTAEKVQPRLKQRYRSEIREALNKQFS--YGNVMQIPTVVKVVVNMGVGD
RL5_MYCPA       ---------MTTTEKVQPRLKERYRNEIRDSLQQQFG--SANVMQIPTVTKVVVNMGIGE
RL5_BIFLO       ------MTDTTVEAPATPRLKVKYNEQIIPELEKEFK--YSNPMQVARVQKVVVSMGVGA
RL5_NEOSM       ------------------MLESEYHKSALARVMKEVG--VDSPVKAPRFEKVCLSVGLGG
RL5_DESVH       ----------------MTRLENIYREKVVPVLQKEFN--YDSSMQVPGIVKVSLNIGLGA
RL5_TREDE       ----------MSNY--VPRLKKVYTEQIMPELKKEFN--YSSVMQIPRLKKVVVSMGVGV
RL5_TREPA       ----------MTDHSCIPELKVRYVQQIVPDMMRDFG--YSTVMQVPKLLKIVLSMGLGE
RL5_BORBU       -----------MNY--VPELKKYYKDSVIKELVKEFE--YKSIMQVPKLEKIVISVGVGE
RL5_AGRFC       ----MADKY-------EPRLKTEYVSRIRGAMQEKFS--YANVMMIPKLDKIVINMGVGE
RL5_RHIME       ---MAKSAY-------ESRLKKEYVERIRKAMQEQFS--YANEMQIPRLDKIVINMGVGE
RL5_BRUME       ---MAEAKA-------LPRFKKLYQDNIRKALLEEFK--YDNEMQIPRITKVVLNMGVGE
RL5_BRUSU       ---MAEAKA-------LPRFKKLYQDNIRKALLEEFK--YDNEMQIPRITKVVLNMGVGE
RL5_RHILO       ---MAKAQSKQATATNTPRLKQVYNETIRKALQEQFG--YDNDMQVPRLDKIVLNMGVGE
RL5_CAUVC       ---MADQAY-------EPRLKTVYRERIRAAMKEQFG--YTNEMQIPKLDKIVLNMGIGE
RL5_BRADU       ---MAEAAY-------TPRLRAEYDAKIRTAMTEKFG--YENVMQVPRLDKVVLNMGVGD
RL5_RHOPA       ---MAETAY-------VPRLRTEYDRHIRTQLTEKFG--YANVMQVPKLDKVVLNMGVGE
RL5_RICCN       ----------------MLRFKELYQQKIIENLQKKFS--YKNKHEIPQIKKIVINMGVGE
RL5_RICPR       ----------------MLRFKELYKQKIIESLKKEFS--FKNKHEIPKIKKIVINMGVGE
RL5_WOLPM       ------------------MFKELYKDSIVKSLKDKFN--YGNIMQVPKLVKVCINMGVGD
RL5_BORBR       ----------------MSRLQEFYKSKVVADLQAKFG--YKCVMEVPRITKITLNMGVSE
RL5_BORPA       ----------------MSRLQEFYKSKVVADLQAKFG--YKCVMEVPRITKITLNMGVSE
RL5_BORPE       ----------------MSRLQEFYKSKVVADLQAKFG--YKCVMEVPRITKITLNMGVSE
RL5_RALSO       ---------------MTARLQEFYKEKVVAELIKQFG--YKSVMEVPRITKITLNMGLGE
RL5_NEIMA       ----------------MARLREFYKETVVPELVKQFG--YKSVMEVPRIEKITLNMGVGE
RL5_NEIMB       ----------------MARLREFYKETVVPELVKQFG--YKSVMEVPRIEKITLNMGVGE
RL5_CHRVO       ----------------MARLYDFYKDSVVPELMKQFG--YKSIMQVPRIEKITVNMGVGE
RL5_NITEU       ----------------MARLLEYYRDTVTKELTQKFN--YKTVMEVPKITKITLNMGVGE
RL5_PSEPK       ----------------MARLKEIYRNEIAPKLKEELK--LSNVMEVPRVTKITLNMGLGE
RL5_PSESM       ----------------MARLKEIYRKEIAPKLKEELK--LGNVMEVPRVTKITLNMGLGE
RL5_PSEAE       ----------------MARLKEIYRKEIAPKLKEELQ--LANVMEVPRVTKITLNMGLGE
RL5_XANAC       ---------------MNTRLEKFYKDNVVPALMKEFG--YTNPMEVPKLVKVTLNMGVGE
RL5_XANCP       ---------------MNTRLEKFYKENVVPALMKEFG--YTNPMEVPKLVKVTLNMGVGE
RL5_XYLFA       ----------------MTRLENMYKKEVVPALIKRFG--YSNPMAVPRLVKITLNMGVGE
RL5_XYLFT       ----------------MTRLENMYKKEVVPALIKRFG--YSNPMAVPRLVKITLNMGVGE
RL5_BUCAI       ----------------MATLYDYYKSKVITQLMHELN--YSSVMQVPKIDKITLNMGVGG
RL5_BUCAP       ----------------MTTFYDYYKSKIVKKLMMELN--YSSIMQVPKIDKITLNMGVGA
RL5_BUCBP       ----------------MVALYDYYKNSISKKLMLNFN--YSSVMQVPKIDKITLNIGVGI
RL5_WIGBR       -----------------MQLYDFYKKNVLIKLKNKFN--YKSIMQVPKIEKITLNMGVGK
RL5_BLOFL       ----------------MAKLRDYYKSHVVYDLMREFK--YKSVMQVPKINKITISMGVGK
RL5_BUCAK       ----------------MAKLHDYYKDEVIKQLMSQFD--YNSVMQVPRVEKITLNMGVGE
RL5_YERPE       ----------------MAKLHDYYKDEVVKQLMSQFG--YDSVMQVPRVEKITLNMGVGE
RL5_PHOLL       ----------------MAKLHDYYKDEVVQKLMTQFG--YNSVMQVPRVEKITLNMGVGE
RL5_ECOLI       ----------------MAKLHDYYKDEVVKKLMTEFN--YNSVMQVPRVEKITLNMGVGE
RL5_ECOL6       ----------------MAKLHDYYKDEVVKKLMTEFN--YNSVMQVPRVEKITLNMGVGE
RL5_ECO57       ----------------MAKLHDYYKDEVVKKLMTEFN--YNSVMQVPRVEKITLNMGVGE
RL5_SHIFL       ----------------MAKLHDYYKDEVVKKLMTEFN--YNSVMQVPRVEKITLNMGVGE
RL5_SALTI       ----------------MAKLHDYYKDEVVNKLMTEFN--YNSVMQVPRVEKITLNMGVGE
RL5_SALTY       ----------------MAKLHDYYKDEVVNKLMTEFN--YNSVMQVPRVEKITLNMGVGE
RL5_HAEDU       ----------------MAKLHDYYRDQVVNELKTKFN--YSSVMQVPRIEKITLNMGVGE
RL5_PASMU       ----------------MAKLHDYYRDQVVNELKDKFN--YKSVMQVPRIEKITLNMGVGE
RL5_HAEIN       ----------------MAKLHDYYRDQVVSELKNKFG--YKSVMQVPRIEKITLNMGVGE
RL5_VIBVU       ----------------MAKLHDYYKSSVVAELTKQFG--YTSVMQVPRIEKITLNMGVGD
RL5_VIBVY       ----------------MAKLHDYYKSSVVAELTKQFG--YTSVMQVPRIEKITLNMGVGD
RL5_VIBPA       ----------------MAKLHDYYKSSVVAELTKQFS--YTSVMQVPRIEKITLNMGVGE
RL5_VIBCH       ----------------MAKLHDYYKSSVVAELTKQFS--YTSVMQVPRIEKITLNMGVGE
RL5_PHOPR       ----------------MAKLHDYYKETVVKELVEKFE--YKSIMQVPRIEKITLNMGVGE
RL5_SHEON       ----------------MAKLHDKYQETVVAELTQKFG--YTSVMQVPRIEKITLNMGVGE
RL5_COXBU       ----------------MVELQELYKKTITPALQKEFG--FKSVMAVPRLEKITLNMGLGE
RL5_AQUAE       --------MSATETKYVPRLYKKYKEEVVPILQKKFN--YKSPMQIPRLQKIVVNMGVGE
RL5_AQUPY       --------MSATETKYVPRLYKKYKEEVVPKLIQKFQ--YKNPMQVPRLVKIVVNMGVGE
RL5_CHLTE       ---------------MPARLEVYYRETVVPKLMERFK--YKSIMMVPRLEKISVNIGVGE
RL5_FUSNN       ------------MDKYTSRYHKFYDEVVVPKLMKELE--IKNIMECPKLEKIIVNMGVGE
RL5_HELHP       ----------------MFALREKYKNEIISQLKSELN--MSNPMLLPKLEKIVISVGAGD
RL5_WOLSU       ----------------MYQLKKLYNEELKAKLSEELG--IKNPMLLPKLEKIVISVGAGD
RL5_HELPY       ----------------MFGLKQFYQSEVRTKLAQELD--IKNPMLLPKLEKIVISVGAGA
RL5_HELPJ       ----------------MFGLKQFYQNEVRAKLAQELD--IKNPMLLPKLEKIVISVGAGA
RL5_CAMJE       ----------------MMRLKEKYNQSIKPALVKEFD--IKNPMLIPVIEKVVISVGAGE
RL5_CHLCV       ----------------MSRLKKLYTEEIRKSLQEKFG--YGNTMQIPVLRKIVISMGLAE
RL5_CHLPN       ----------------MSRLKKFYTEEIRKSLFEKFG--YANKMQIPVLKKIVLSMGLAE
RL5_CHLMU       ----------------MSRLKKLYTEEIRKTLQDKFQ--YENVMQIPVLKKIVISMGLAE
RL5_CHLTR       ----------------MSRLKKLYTEEIRKTLQDKFQ--YENVMQIPVLKKIVISMGLAE
RL5_BACTN       -------------MSNTASLKKEYADRIAPALKSQFQ--YSSTMQVPVLKKIVINQGLGM
RL5_PORGI       -------------MSATANLKKDYQERIVPALMKQFG--YTSVMQVPVLKKIVINQGLGM
RL5_RHOBA       ---------MPNMSSNIPRMQQRYDESVRAALTETYG--YKNVHQVPRLLKISMNMGVGA
RL5_BACAN       ----------------MNRLKEKFQKEITPALVSKFN--YKSVMQVPKIEKIVINTGVGD
RL5_BACCR       ----------------MNRLKEKFQKEITPALVSKFN--YKSVMQVPKIEKIVINTGVGD
RL5_BACC1       ----------------MNRLKEKFQKEITPALMSKFN--YKSVMQVPKIEKIVINTGVGD
RL5_GEOSE       ----------------MNRLKEKYVKEVVPALMSKFN--YKSIMQVPKIEKIVINMGVGD
RL5_BACSU       ----------------MNRLKEKYNKEIAPALMTKFN--YDSVMQVPKIEKIVINMGVGD
RL5_LISIN       ----------------MNRLKDQYLKEIVPALMSKFN--YDSVMEVPKIDKIVINTGVGD
RL5_LISMF       ----------------MNRLKDQYLKEIVPALMSKFN--YDSVMEVPKIDKIVINTGVGD
RL5_LISMO       ----------------MNRLKDQYLKEIVPALMSKFN--YDSVMEVPKIDKIVINTGVGD
RL5_BACHD       ----------------MNRLKEKYQKEIVPSLTEKFN--YSSVMAVPKLEKIVVNMGVGD
RL5_OCEIH       ----------------MNELKQKYQDEIVSSLMDKFN--YNSVMEVPKVEKIVINMGVGD
RL5_STRA3       ---------------MANRLKEKYTNEVVPALTEKFN--YSSVMAVPKVEKIVLNMGVGD
RL5_STRA5       ---------------MANRLKEKYTNEVVPALTEKFN--YSSVMAVPKVEKIVLNMGVGD
RL5_STRP1       ---------------MANRLKEKYTNEVIPALTEKFN--YTSVMAVPKVEKIVLNMGVGD
RL5_STRP3       ---------------MANRLKEKYTNEVIPALTEKFN--YTSVMAVPKVEKIVLNMGVGD
RL5_STRP6       ---------------MANRLKEKYTNEVIPALTEKFN--YTSVMAVPKVEKIVLNMGVGD
RL5_STRP8       ---------------MANRLKEKYTNEVIPALTEKFN--YTSVMAVPKVEKIVLNMGVGD
RL5_STRMU       ---------------MANRLKEKYLNEVVPALTEKFN--YTSVMAVPKVDKIVLNMGVGD
RL5_STRPN       ---------------MANRLKEKYLNEVVPALTEQFN--YSSVMAVPKVDKIVLNMGVGE
RL5_STRR6       ---------------MANRLKEKYLNEVVPALTEQFN--YSSVMAVPKVDKIVLNMGVGE
RL5_LACLA       ---------------MTNRLKEKYTNEVVPALTEQFN--YTSIMAVPKVDKIVINMGVGD
RL5_ENTFA       ----------------MNRLKEKYIKEVTPSLVEKFN--YSSVMQTPKVDKIVINMGVGD
RL5_STAAC       ----------------MNRLKEKFNTEVTENLMKKFN--YSSVMEVPKIDKIVVNMGVGD
RL5_STAAM       ----------------MNRLKEKFNTEVTENLMKKFN--YSSVMEVPKIDKIVVNMGVGD
RL5_STAAN       ----------------MNRLKEKFNTEVTENLMKKFN--YSSVMEVPKIDKIVVNMGVGD
RL5_STAAR       ----------------MNRLKEKFNTEVTENLMKKFN--YSSVMEVPKIDKIVVNMGVGD
RL5_STAAS       ----------------MNRLKEKFNTEVTENLMKKFN--YSSVMEVPKIDKIVVNMGVGD
RL5_STAAW       ----------------MNRLKEKFNTEVTENLMKKFN--YSSVMEVPKIDKIVVNMGVGD
RL5_STAES       ----------------MNRLKEKFNTEVTENLVKKFN--YSSVMEVPKIEKIVVNMGVGD
RL5_STAEQ       ----------------MNRLKEKFNTEVTENLVKKFN--YSSVMEVPKIEKIVVNMGVGD
RL5_STAHJ       ----------------MNRLKERYNTEVTENLVKKFN--YSSVMEVPKIEKIVVNMGVGD
RL5_STAS1       ----------------MNRLKEKFNSEVTQNLVKQFD--YSSVMEVPKIEKIVVNMGVGD
RL5_LACJO       ---------------MANSLVEKYSNEIAPAMNKKFN--YDSVMEIPKIDKIVLNMGVGD
RL5_LACPL       ---------------MENRLKAQYEKEIVPALVDKFN--YTSVMQVPKLAKIVLNMGVGD
RL5_ONYPE       --------------MSMKKENTLDYSKITATLMETFN--YKSVMQVPKVEKVVINMGVGD
RL5_MYCCT       ---------------MKSRLEIKYKDQIVPELFKELN--YKSIMQVPKIQKIVINMGIGD
RL5_MYCMS       ---------------MKSRLEIKYKDQIVPELFKELN--YKSIMQVPKIQKIVINMGIGD
RL5_SPIKU       ---------------MNVNLEKKYKNTIVKELFKEQR--FQSIMQVPVVKKIVVNMGAGD
RL5_MYCGE       ----------------MNNLEKTYKTELVNQLQQQLG--FSSIMQVPKLTKIVVNMGVGD
RL5_MYCPN       ----------------MNNLKAHYQKTIAKELQKSFA--FSSIMQVPRLEKIVINMGVGD
RL5_MYCGA       -----------------MNLKTKYKTKIVPLLQKEFG--FSSVMQVPKIEKIVINMGVGD
RL5_UREPA       ----------------MAFLKDLYKNKVAKDLQKEFA--YSSVMQIPKIEKVVINAGIGN
RL5_MYCPE       -------------MAIKSVLYDKYKKDVTKSLMKEFN--YKSTMEIPRLEKIVINSGLGD
RL5_MYCPU       -----------------MILKEKYLKEVKSNLQKQFN--YSSSMEIPRIEKVILNMTAGK
RL5_CLOAB       ---------------MVPRLKEKYEKEVIPALMEKFQ--YKNIMEVPKLEKIVINMGVGE
RL5_CLOTE       ---------------MVPRLQEKYEKEVIPALIEKFG--YKNIMEVPKLEKIVINMGVGE
RL5_CLOPE       ----------------MNRLQERYEKEVVPAMMEKFG--YKNIMQVPKIEKVVINMGVGE
RL5_CALS4       ----------------MSRLREKYEKEVVPALMERFG--YKNIMQVPKLEKVVINIGVGE
RL5_THET8       -------------MPLDVALKRKYYEEVRPELIRRFG--YQNVWEVPRLEKVVINQGLGE
RL5_THETH       -------------MPLDVALKRKYYEEVRPELIRRFG--YQNVWEVPRLEKVVINQGLGE
RL5_THET2       -------------MPLDLALKRKYYEEVRPELIRRFG--YQNVWEVPRLEKVVINQGLGE
RL5_THEAQ       -------------MPLDVALKKKYYDEVRPELIRRFG--YQNIWEVPRLEKVVINQGLGE
RL5_DEIRA       ----------------MQQLKTKYNDQVRPALMQQFG--YSSVMAVPRIEKIVVNEGLGS
RL5_THEMA       ------------MRYEYVPLKDQYEKEIVPALMKEFN--YKNIHQVPKLVKIVINMGIGE
RL5_LEPIC       ---------------MAARLRTKYKKEIVPELNKKFK--FSSIMQVPRLEKIVLNVGMGE
RL5_LEPIN       ---------------MAARLRTKYKKEIVPELNKKFK--FSSIMQVPRLEKIVLNVGMGE
RL5_GEOSL       ----------------MARLKELYHKEIVEQLTKDFG--YSNVMQVPKIEKIVVNMGLGE
RL5_BDEBA       ----------------MNRLHTRYNKEIAPALKNQLG--VKNVMQVPRLEKITLSVCLSE
RL5_THEEB       ---------------MSQRLKDHYNKTVVPQLMQQFQ--YKNIHQVPKIVKVTVNRGLGE
RL5_SYNY3       ---------------MTQRLKTLYQETILPKLQEEFG--YKNIHQVPKLTKVTVNRGLGE
RL5_NOSS1       --------------MATTRLKTLYQETIVPKLTQQFQ--YTNVHQVPKLVKITVNRGLGE
RL5_SYNP6       -----------------MSLKTKYRDIIVPKLMKEFG--YTNIHQVPKVVKVTINRGLGE
RL5_PROMM       -----------------MSLKQRYRETIQPKLLKDLS--LSNIHEVPKVLKITVNRGLGE
RL5_SYNPX       -----------------MSLKKRYRETIQPKLQKDLS--LTNIHEVPKVVKVTVNRGLGE
RL5_PROMA       -----------------MSLKNRYRETIRPKLLKDLG--FSNLHQVPKVVKINVNRGLGE
RL5_PROMP       -----------------MTLKTRYKEAIRPKLLKDLG--LKNIHQVPKVIKVNVNRGLGE
RK5_CYAPA       ---------------MVQRLKTVYEQEVIKQLMTRFQ--YKNIHEVPKLKKITVNRGLGE
RK5_PORPU       ---------------MVIGLKEKYKTTVTQALKEEFQ--YENIHEVPRFTKITINRGLGE
RK5_GUITH       ---------------MNKSLKEIYYQDVIPGLIEQFN--YTNIHQVLKITKITLNRGLGE
RK5_CHAGL       ---------------MVQRLKSIYLNNVIPKLNEEAK--YKNVHQIPRLKKIVINCGIGE
RK5_MESVI       ---------------MVQRLKTLYLESAVLKLQETFG--YKNPHQIPRIKKIVINCGLSE
RK5_CHLRE       ---------------MTQRLKNLYTKTIVPKLTTNFN--YSNMHEVPKIEKIVINRGIGD
RK5_NEPOL       ---------------MAQRLKTFYLNSVVPKLRQQFH--HRNIHEVPSIKKIVINRGLGD
RK5_CHLVU       ---------------MVQRLDSFYQEQSIPQLIKEFH--YKNKHQVPKLDKIVINRGLGD
RL5_GLOVI       -------------MATPVRMKDKYNREVVPRLQEQFN--YTNLMQVPKISKIVINRGLGE
RK5_EUGLO       ----------------MQKLKSIYITKVCPILVNEFL--YTNFFEIPKINKVVISRGFGE
RK5_EUGGR       ----------------MQRLKSFYLETIIPKLKEEFG--YVNSYRVPKLKKIVINRGFDE
RK5_CYACA       --------------MSGGNLQHLYFNKIRVELQKQFE--YTNVHQIPKLTKITLNRGLGT
RK5_GRATL       ---------------MENTLKTLYNNKICKDLQKKFR--YKNIHQIPKLVKITINRGLGE
RK5_CYAM1       ---------------MERINTTFYKTKVIPQLQQKYS--YSNVHQIPKLRSIHLNRCLGA
RK5_HELSJ       ---------------MKNDFFNYYKTKIIPQYLKDYN--KKKALEVPVIKKIVISRGIGK
                                                                . .: :.     

RK5_THAPS       AAQNT--NILKKSITEFTRITGQKPLITRAKKAVAGFKIREEMELGLSSTLRGEKMYSFL
RK5_TRICV       AAQNT--NILKKSINEFTAITGQKPIITRAKKAIAGFKIRENMELGLTVTLRGSKMYSFL
RK5_PHATC       AAQNT--NLLKKNIEEFEKIAGQKPLITRSKKAIAGFKIREDMELGLSVTLRGEKMYTFL
RL5_TROW8       AARDS--KIIEGAVSDITLITGQKPRINRAKQSIAKFKLREGQAVGVTATLRGRRMWEFL
RL5_TROWT       AARDS--KIIEGAVSDITLITGQKPRINRAKQSIAKFKLREGQAVGVTATLRGRRMWEFL
RL5_COREF       AARDS--KMINGALEDLTAITGQKPQLRRAKKSIANFKLREGMPIGAKVTLRGDRMWEFL
RL5_CORGL       AARDS--KLINGAIEDLTAITGQKPQLRRAKKSIANFKLREGMPIGAKVTLRGDRMWEFL
RL5_CORDI       AARDS--KLINGALEDLTLITGQKPELRRAKKSIANFKLREGMPIGARVTLRGDRMWEFL
RL5_STRAW       AARDS--KLIDGAIRDLTTITGQKPAVTKARKSIAQFKLREGQPIGAHVTLRGDRMWEFL
RL5_STRCO       AARDS--KLIEGAIRDLTTITGQKPAVTKARKSIAQFKLREGQPIGAHVTLRGDRMWEFL
RL5_MICLU       AAKDS--KIIDDAVTDLTAITGQKPMITKARKSIAQFKLREGMPIGTHATLRGDRMWEFL
RL5_MYCBO       AARDA--KLINGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMWEFL
RL5_MYCTU       AARDA--KLINGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMWEFL
RL5_MYCLE       AARDA--KLINGAVSDLALITGQKPEVRKARKSIAQFKLREGMPIGVRVTLRDDRMWEFL
RL5_MYCPA       AARDA--KLINGAVNDLALITGQRPEIRRARKSIAQFKLREGMPIGARVTLRGDRMWEFL
RL5_BIFLO       AARDS--KLIEGAVKDLTLITGQKPKITKAKKSVAQFHLREGQAIGAYVTLRGDRMWEFL
RL5_NEOSM       ASSDS--KLLASAVEDLSLIAGQKAVVTVAKKSISSFKLRKGFPVGCRVTLRKRRMFDFI
RL5_DESVH       ASQNN--KLMEEALKELTVIAGQKAVVTRAKKSIASFKLREGMPIGCRVTLRKERMWDFL
RL5_TREDE       ALTNR--KLLDAAVTDLETITGQKAVKTKARKSIANFKLREGNEIGAMVTLRGARMYEFL
RL5_TREPA       ALANR--KLLDASVADLGVISGQHAVKTRARKSIANFKLREGNEIGVMVTLRRSRMYEFL
RL5_BORBU       AVRNK--KLLDSAVLELAQITGQKAVKTKAKKAIAGFKIRQGQEIGAKVTLRGNAMYEFL
RL5_AGRFC       ATADS--KKPTIAAGDLAAIAGQKPVITKARNSIAGFKVREHMPIGAKVTLRGERMYEFL
RL5_RHIME       ATGDS--KKPTVAAADLAAIAGQKPVITRARNSIAGFKLREGMPIGAKVTLRGVRMYDFL
RL5_BRUME       ATGDS--KKPAVAAEDLAMIAGQKAVVTRARNSIATFKLREGMPIGAKVTLRQDRMYEFL
RL5_BRUSU       ATGDS--KKPAVAAEDLAMIAGQKAVVTRARNSIATFKLREGMPIGAKVTLRQDRMYEFL
RL5_RHILO       ATADS--KKPSVAAEDLALIAGQKAVVTRARNSIAGFKVRENMPIGAKVTLRKERMYEFL
RL5_CAUVC       AVADS--KKAQTALKDLQAIAGQKPVATKARKSIAGFKLREGMVVGAKVTLRKDRMYEFL
RL5_BRADU       SVNDR--KKAETAAAELTQIAGQKAIVTYSRIAIATFKLRENQPIGCKVTLRKARMYEFI
RL5_RHOPA       AVNDR--KKAEQAAADLSLIAGQKAVITYSRVAISTFKLRENQPIGCKVTLRQARMYEFI
RL5_RICCN       ATADS--KVINNAVNDLTLISGQKPVVTLARKSIATFKLRENMKIGCKVTLRKDRMYDFL
RL5_RICPR       AIADS--KVINNALNDLTLISGQKPVVTLARKSIATFKLRENMKIGCKVTLRKDRMYDFL
RL5_WOLPM       AATDS--KAINEPLDSLYLIAGQKPLSTFAKKSISGFKIRKGATVGCKVTLRRDKMYEFL
RL5_BORBR       AVADK--KVIEHAVSDLTKISGQKPVVTKTRKAIAGFKIRENYPIGCMVTLRGQRMYEFL
RL5_BORPA       AVADK--KVIEHAVSDLTKISGQKPVVTKTRKAIAGFKIRENYPIGCMVTLRGQRMYEFL
RL5_BORPE       AVADK--KVIEHAVSDLTKISGQKPVVTKTRKAIAGFKIRENYPIGCMVTLRGQRMYEFL
RL5_RALSO       AVNDK--KVIEHATGDLTKIAGQKPVVTKARKAIAGFKIRQGYPIGTMVTLRGQRMYEFL
RL5_NEIMA       AIADK--KVMEHAVSDLEKIAGQKPVVTVARKSIAGFKIRDNYPVGCKVTLRRDQMFEFL
RL5_NEIMB       AVADK--KVMEHAVSDLEKIAGQKPVVTVARKSIAGFKIRDNYPVGCKVTLRRDQMFEFL
RL5_CHRVO       AVADK--KVMEFAVGDLEKIAGQKPVVTTARKSIAGFKIRDDYPVGCKVTLRRERMYEFL
RL5_NITEU       ASTDK--KIIENAVSDLEKISAQKPVVTKARKSIATFKVRQGYPVGCKVTLRGVKMYEFL
RL5_PSEPK       AIGDK--KVIEHAVADLEKITGQKPVVTFARKSIAGFKVREGWPIGVKVTLRSDKMYEFL
RL5_PSESM       AIGDK--KVIENAVADLEKITGQKVVVTYARKSIAGFKVREGWPIGVKVTLRRDRMYEFL
RL5_PSEAE       AVGDK--KIIENAVADLEKITGQKPVVTYARKSIAGFKIREGWPIGVKVTLRSDRMYEFL
RL5_XANAC       AATNK--KILENAVADMAKISGQKPVVTKSRVSVASFKIRDGWPIGCKTTLRRAKMYEFL
RL5_XANCP       AATNK--KILENAVADMSKISGQKPVVTKSRVSVASFKIRDGWPIGCKTTLRRAKMYEFL
RL5_XYLFA       AATNK--KVLENAVADMAKISGQRPIVTKSRISVASFKIRNGWPIGCKTTLRRSKMYEFL
RL5_XYLFT       AATNK--KVLENALADMAKISGQKPIVTKSRISVASFKIRNGWPIGCKTTLRRSKMYEFL
RL5_BUCAI       AASDK--KILDNAILDLTAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGQKKWHFF
RL5_BUCAP       ASSDK--KVLDNAVLDLTAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGKRKWDFF
RL5_BUCBP       ATIDK--KNLDFAISDLTKISGQKPLITKARKSIASFKIRKGYPIGCKVTLRGNRKWDFF
RL5_WIGBR       ASFDK--KLLEHAVNDLTLISGQKPYITKAKKSIANFKIRQGHPIGCKVTLRGKLMWFFF
RL5_BLOFL       SIINK--KFLERAIEDLEMISGQKPVITKARKSIASFKIRQGQEIGCKVTLRRKRMWEFF
RL5_BUCAK       AIADK--KLLDNAAADLAAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFF
RL5_YERPE       AIADK--KLLDNAAADLAAISGQKPFITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFF
RL5_PHOLL       AIADK--KLLDNAAADLAAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFL
RL5_ECOLI       AIADK--KLLDNAAADLAAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFF
RL5_ECOL6       AIADK--KLLDNAAADLAAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFF
RL5_ECO57       AIADK--KLLDNAAADLAAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFF
RL5_SHIFL       AIADK--KLLDNAAADLAAFSRQKPLSTKARKFVACFKIRQGYPIGCKVTLRGERMWEFF
RL5_SALTI       AIADK--KLLDNAAADLTAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFF
RL5_SALTY       AIADK--KLLDNAAADLTAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFF
RL5_HAEDU       ALTDK--KLLDNAVADLTAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFF
RL5_PASMU       ALTDK--KLLDNAVADLAAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFF
RL5_HAEIN       ALTDK--KLLDNAVADLAAISGQKPLVTKARKSVAGFKIRQGYPIGCKVTLRGERMWEFF
RL5_VIBVU       AINDK--KLLENAAADMATISGQKPLITKARKSVAGFKIREGYPIGCKVTLRGERMWDFM
RL5_VIBVY       AINDK--KLLENAAADMATISGQKPLITKARKSVAGFKIREGYPIGCKVTLRGERMWDFM
RL5_VIBPA       AINDK--KLLENAASDMATISGQKPLITKARKSVAGFKIREGYPIGCKVTLRGERMWDFL
RL5_VIBCH       AINDK--KLLENAASDMAIISGQKPLITKARKSVAGFKIREGYPIGCKVTLRGERMWDFL
RL5_PHOPR       AINDK--KLLENAAADMTAIAGQKPLITKARKSVAGFKIREGYPIGCKVTLRGERMWDFF
RL5_SHEON       AVADK--KVMEHAVRDMTAIAGQKPVVTVARKSVAGFKIREGYPIGCKVTLRGERMWEFL
RL5_COXBU       AVADK--KVIERAMDDMIKISGQKPLITYARKSEAGFKIRAGWPIGCKVTLRRDRMYEFL
RL5_AQUAE       AVQDI--RQLERAVEDLRAITGQQPVITRARKSEAGFKLRKGMPIGCKVTLRKERMWDFL
RL5_AQUPY       AVQDI--KQLERAVEDLRAITGQQPMITRARKSKAGFKLRKGMPIGCKVTLRNHTMWDFL
RL5_CHLTE       AAQEP--KLLETAMQELGQITGQKPQVRKAKKAISNFKLREGQAIGCRVTLRRKIMFEFM
RL5_FUSNN       ATQNS--KLIDAAMADLTIITGQKPLLRKAKKSEAGFKLREGMPIGAKVTLRKERMYDFL
RL5_HELHP       YAKDS--KIMQNIADTISLIAGQKAVITLAKKSVAGFKMREGMPMGVKVTLRGKMMYNFL
RL5_WOLSU       HAKDT--KVMQNIADTISLIAGQKAVITIAKKSVAGFKMREGMPMGVKVTLRGNQMYNFL
RL5_HELPY       HAKDM--KIMQNIAQTISLIAGQKAVITKAKKSVAGFKIREGMAVGAKVTLRNKRMYNFL
RL5_HELPJ       HAKDM--KIMQNIAQTISLVAGQKAVITKAKKSVAGFKIREGMAVGAKVTLRNKRMYNFL
RL5_CAMJE       LAKDQ--KVLQNVADTISLIAGQKAVITKAKKSVAGFKVREGFPVGVMVTLRKENMYAFL
RL5_CHLCV       AAKDK--NLFQAHLEELSMISGQKPLVTKARNSIAGFKLREGQGIGAKVTLRGQRMYDFM
RL5_CHLPN       AAKDK--NLFQAHLEELTMISGQKPLVTKARNSIAGFKLREGQGIGAKVTLRGIRMYDFM
RL5_CHLMU       AAKDK--NLFQSHLEELAVISGQKPLVTRAKNSIAGFKLREGQGIGAKVTLRGIRMYDFM
RL5_CHLTR       AAKDK--NLFQAHLEELAVISSQKPLVTRARNSIAGFKLREGQGIGAKVTLRGIRMYDFM
RL5_BACTN       AVADK--KIIEVAINEMTAITGQKAVATISRKDIANFKLRKKMPIGVMVTLRRERMYEFL
RL5_PORGI       ATGDK--KIIDVAVSELTAITGQKAVPTVSKKDISNFKLRKKMPIGVMVTLRREQMYEFL
RL5_RHOBA       AVGDK--KVLDLAIDSMTQITGQKPVTTIARKSIAGFRLREGMPIGCMVTMRRQRMYEFL
RL5_BACAN       AVSNS--KTLDNAVEELTQITGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGEQMYEFF
RL5_BACCR       AVSNS--KALDNAVEELTQITGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGEQMYEFF
RL5_BACC1       AVSNS--KALDNAVEELTQIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGEQMYEFF
RL5_GEOSE       AVQNP--KALDSAVEELTLIAGQRPVVTRAKKSIAGFRLRQGMPIGAKVTLRGERMYEFL
RL5_BACSU       AVQNA--KAIDSAVEELTFIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFL
RL5_LISIN       ATANA--KVLDSAVEELALITGQKPVITKAKNSIAGFRLREGMPIGAKVTLRGERMYDFL
RL5_LISMF       ATANA--KVLDSAVEELALITGQKPVITKAKNSIAGFRLREGMPIGAKVTLRGERMYDFL
RL5_LISMO       ATANA--KVLDSAVEELALITGQKPVITKAKNSIAGFRLREGMPIGAKVTLRGERMYDFL
RL5_BACHD       AVQNA--KALDKAVEELTEITGQKPIITKAKKSIAGFKLREGMPIGAKVTLRGERMYEFL
RL5_OCEIH       AVQNS--KALDSAVEELSLISGQKPMITRAKKSIAGFRLREGMPIGAKVTLRGERMYEFL
RL5_STRA3       AVSNA--KNLEKAAAELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFL
RL5_STRA5       AVSNA--KNLEKAAAELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFL
RL5_STRP1       AVSNA--KNLEKAAAELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFL
RL5_STRP3       AVSNA--KNLEKAAAELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFL
RL5_STRP6       AVSNA--KNLEKAAAELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFL
RL5_STRP8       AVSNA--KNLEKAAAELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFL
RL5_STRMU       AVSNA--KNLEKAAAELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGQRMYEFL
RL5_STRPN       AVSNA--KSLEKAAEELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFL
RL5_STRR6       AVSNA--KSLEKAAEELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFL
RL5_LACLA       AVNNS--KNLDKAVAELALISGQKPLITKAKKSVAAFRLREGMPIGAKVTLRGERMFEFL
RL5_ENTFA       AVSNA--KNLDKAVEELALITGQKPLITKAKKSIAGFRLREGMPIGAKVTLRGERMYEFL
RL5_STAAC       AVQNS--KVLDNAVEELELITGQKPLVTKAKKSIATFRLREGMPIGAKVTLRGERMYEFL
RL5_STAAM       AVQNS--KVLDNAVEELELITGQKPLVTKAKKSIATFRLREGMPIGAKVTLRGERMYEFL
RL5_STAAN       AVQNS--KVLDNAVEELELITGQKPLVTKAKKSIATFRLREGMPIGAKVTLRGERMYEFL
RL5_STAAR       AVQNS--KVLDNAVEELELITGQKPLVTKAKKSIATFRLREGMPIGAKVTLRGERMYEFL
RL5_STAAS       AVQNS--KVLDNAVEELELITGQKPLVTKAKKSIATFRLREGMPIGAKVTLRGERMYEFL
RL5_STAAW       AVQNS--KVLDNAVEELELITGQKPLVTKAKKSIATFRLREGMPIGAKVTLRGERMYEFL
RL5_STAES       AVQNS--KVLDNAVEELELITGQKPLVTKAKKSVATFRLREGMPIGAKVTLRGERMYEFL
RL5_STAEQ       AVQNS--KVLDNAVEELELITGQKPLVTKAKKSVATFRLREGMPIGAKVTLRGERMYEFL
RL5_STAHJ       AVQNS--KVLDNAVEELELITGQKPLVTKAKKSVATFRLREGMPIGAKVTLRGERMYEFL
RL5_STAS1       AVQNT--KVLDDAVEELQAITGQKPLITKAKKSVATFRLREGMPIGAKVTLRGERMYDFL
RL5_LACJO       AVSNA--KNLDEAVEELTLISGQKPLITKAKKSIANFRLREGMSIGAKVTLRGDRMYDFL
RL5_LACPL       AVTNA--KNLDEAVEELTLISGQKPLVTRAKKSIAGFRLREGMAIGAKVDLRGERMYDFL
RL5_ONYPE       AIFNV--KVLDDVVEELKLLSGQSPVITKAKKAISNFKLREGMPIGAKVTLRGARKEAFL
RL5_MYCCT       ATTDP--KKLDAAIFELEKLSGQKPIVTKAKKSLAVFKLREGMAIGAKVTLRGKKMYDFL
RL5_MYCMS       ATTDP--KKLDAAISELEKLSGQKPIVTKAKKSLAVFKLREGMAIGAKVTLRGKKMYDFL
RL5_SPIKU       ATQNS--KVIEDITNELALITGLRPVVTKAKDSIASFKLREGMPIGAKVTLRGKKMYQFL
RL5_MYCGE       AIRDN--KFLESALNELHLITGQKPVATKAKNAISTYKLRAGQLIGCKVTLRNKKMWSFL
RL5_MYCPN       AIRDS--KFLESALNELHLISGQKPVATKAKNAISTYKLRAGQLIGCKVTLRGERMWAFL
RL5_MYCGA       ATKDA--KLLELAQAELQAISGQKPVITKAHSSNASFKIRQGQAIGCKVTLRGEKMWNFL
RL5_UREPA       AVADK--KHLEAAISELTLITGQRPVETKAKKSIATFKLRAGQSIGAKVTLRGDRMWAFI
RL5_MYCPE       ATSDS--KIVEIGLKELHLITGQKPIATKSKKSIATFKLREGQAIGAKVTLRRENMWNFL
RL5_MYCPU       EVTNA--KAIEEVINELTLISGQKPYQTVAKKSLASWKLREGMPMGGKVTLRSKNMWIFL
RL5_CLOAB       AKENQ--KVLESAVADMQLISGQKPILTRAKKSVANFKIRENMPIGCKVTLRKNKMFEFA
RL5_CLOTE       AKENQ--KMLESAVSDLSIIAGQKPIVTKAKKSVANFKIRENMPIGCKVTLRKVKMYEFA
RL5_CLOPE       AKDNP--KVLESAVSDLQIIAGQKPVLTRAKKSVANFKIRENMALGCKVTLRKTNMYEFV
RL5_CALS4       AKENP--KALEAAMNDLMMISGQKPVITRAKKSISNFKIRKGMPIGVKVTLRRERMYEFL
RL5_THET8       AKEDA--RILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIFL
RL5_THETH       AKEDA--RILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIFL
RL5_THET2       AKEDA--RILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIFL
RL5_THEAQ       AKEDA--RILEKASKELALIAGQKPAITRAKKSISNFKLRKGMPIGLRVTLRGDRMWIFL
RL5_DEIRA       SKEDS--KAIDKAAKELALITLQKPIITKAKKSISNFKLRQGMPVGIKVTLRGERMYVFL
RL5_THEMA       GSRNY--DLIERHANELAKITGQKPIVTRARKSISNFKIRKGMPIGLKVTLRGARMYNFL
RL5_LEPIC       AHTNP--KALEAAVEELALITGQRPVKTKAKKSIAGFKIREGMSLGCMVTLRGDYMYEFL
RL5_LEPIN       AHTNP--KALEAAVEELALITGQRPVKTKAKKSIAGFKIREGMSLGCMVTLRGDYMYEFL
RL5_GEOSL       AIQNV--KILDSAVEELAAIAGQKAVITKAKKSIAGFKLRQGMPIGCMVTLRREKMYEFL
RL5_BDEBA       AVQNP--KILNTVVDEITAITGQKAVITKAKKAISNFKLRAGIPLGVRVTLRREKMWSFM
RL5_THEEB       AAQNA--KALEATLAEIATITGQKPVVTRAKKAIAGFKIRKGMPVGVAVTLRSERMYAFL
RL5_SYNY3       ASQNA--KALESSLTELATITGQKPVVTRARKAIAGFKIREGMPVGVMVTLRSERMYAFL
RL5_NOSS1       AAQNA--KSLEASLTEIATITGQKPVVTRAKKAIAGFKIRQGMPVGIMVTLRGERMYAFF
RL5_SYNP6       GAQNA--KALESSLAEIAKIAGQKPVVTRAKKAIAGFKIRAGMPVGLMVTLRGDRRDAFL
RL5_PROMM       AAQNA--KSLEASITELATITGQKVVVTRAKKAIAGFKIRQGMPIGCAVTLRGERMYAFL
RL5_SYNPX       AAANA--KSLEASVNELAQITGQKVVVTRAKKAIAAFKIRQGMPIGCAVTLRGDRMYAFL
RL5_PROMA       AAQNS--KALEASLSEVSTITGQKALVTRAKKAIAGFKIRQGMPIGCAVTLRGERMYAFL
RL5_PROMP       AASNS--KALEASLNEMATITGQKALVTRSKKAIAGFKIREGMAIGCTVTLRGDRMYSFL
RK5_CYAPA       AAQNA--KILEASVKEITEITGQKAIVTRAKKAIAGFKLRQDMPIGVMVTLRGDYMYAFL
RK5_PORPU       ASQNA--KALESSIQELTLITGQKPIVTRAKKSIAGFKIREEVPIGIVVHLRKDKMYSFL
RK5_GUITH       ASKNN--KILEASIKEFELISGQHPLINKARKSVAGFKIREGMPVGISVTLRKKLMYTFL
RK5_CHAGL       ASQNA--KTLEYTIRDLSIIAGQRPLVKRAKKAIASFQLRKKMPVGVSVTLRGDAMYAFL
RK5_MESVI       ASQNS--KSLESAMKELSIIAGQKGVITRAKKAIAGFKIREGLPIGICITLRGDSMYAFL
RK5_CHLRE       ASQNQ--KIVESSLKELAMIAGQKGVVTRSKKAIAGFKLRQQMPVGVTVTLRGDRMYGFL
RK5_NEPOL       ASQNA--KLLDGSLQELTTIAGQRGVITRSKQAIAAFKIRQDMPVGISVTLRGERMYAFL
RK5_CHLVU       ASQNA--KVLESCSKEQSIITRQQGVVTRSKKAIASFKLREKMPVGLVVTLRGDKMYAFL
RL5_GLOVI       ASQNA--KALDGSIAEVARIAGQKPVVTRAKKAIAGFKLRAGVPVGVTVTLRARRMYEFL
RK5_EUGLO       SCNSS--KILESLLVELKNISGQKPILCKSKNSISNFKVKKGMPIGMFVTLHGDKMYSFL
RK5_EUGGR       SCQNS--KILEVLLNELEIISGQKPIISKAKKAIANFKLKEKMPVGMFLTLRSEKMYSFL
RK5_CYACA       LYQQSP-KVFESSVSDLMLITGQKPRFNKSKKSIAGFKLREGTVVGLSVTLRRKKMYAFL
RK5_GRATL       AANNK--QVLEKSMNEIAAITGQKPKITKSKKAIAGFKIRENIAIGLVVTLRRDKMYDFL
RK5_CYAM1       VSQKI----FQKSSEEIAMISGQRPKITYAKKAIAGFQIRKGMPIGMTVTLRRERMYDFL
RK5_HELSJ       ANTLEINNYIEESIKEFLIMTGQKPKLNRAKKHIAAFKIKKKMILGLSVTLRGAKMYAFL
                                   .:        ::   : ::::    :*    ::      * 

RK5_THAPS       TKLIFFTFAQIRDFRGLSVRSFDKAGNYTFSLKEQLIFPEIEYDDVDQVQGLSITLVLDS
RK5_TRICV       TKLIFFTFAQIRDFRGLSVRSFDKAGNYTLGLKEQLIFPEIDYDDVDQTQGFSITLVFSS
RK5_PHATC       TKLLFFTFAQIRDFRGLSLRSFDKAGNYTLGLKEQLIFPEIDYDDVDQIQGFTINIILEH
RL5_TROW8       DRLLTLALPRIRDFRGISDKQFDGHGNYTFGLSEQGIFHEIDQDKIDRVRGMDITVVTTS
RL5_TROWT       DRLLTLALPRIRDFRGISDKQFDGHGNYTFGLSEQGIFHEIDQDKIDRVRGMDITVVTTS
RL5_COREF       DRLLTVALPRIRDFRGLSDQQFDGHGNYTFGLTEQTMFYEIDVDKIDRPRGMDITVVTTA
RL5_CORGL       DRLLTVALPRIRDFRGLSDQQFDGHGNYTFGLTEQTMFYEIDVDKIDRPRGMDITVVTTA
RL5_CORDI       DRLLTVALPRIRDFRGLSDQQFDGHGNYTFGLSEQTMFYEIDVDKIDRPRGMDITVVTTA
RL5_STRAW       DRTLSLALPRIRDFRGLSPKQFDGRGNYTFGLTEQVMFHEIDQDKIDRVRGMDITVVTTA
RL5_STRCO       DRTLSLALPRIRDFRGLSPKQFDGRGNYTFGLTEQVMFHEIDQDKIDRTRGMDITVVTTA
RL5_MICLU       DRLVTLPLPRIRDFRGLSDRQFDGNGNYTFGLSEQTVFHEIDQDKIDRVRGMDITVVTTA
RL5_MYCBO       DRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDVDKIDRVRGMDINVVTSA
RL5_MYCTU       DRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDVDKIDRVRGMDINVVTSA
RL5_MYCLE       DRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQSVFHEIDVDKIDRVRGMDINVVTSA
RL5_MYCPA       DRLTSIALPRIRDFRGLSSKQFDGVGNYTFGLAEQSVFHEIDVDKIDRVRGMDINVVTSA
RL5_BIFLO       DRLLTLALPRIRDFRGINGHQFDGQGNYNFGLTEQSMFHEIDPDSIDHVRGMDITVVTST
RL5_NEOSM       NRLLYMALPDQKDFKGFTMRNFDGHGNMAFGLTEHIVFPEVDFDKTYRIIGMNVVVVTTA
RL5_DESVH       DKLINFALPRVRDFRGVPDRGFDGRGNFTLGIKEHAIFPEMEADRVENPKGMNITIVTTA
RL5_TREDE       DRFINVALPRVKDFRGVNPNGFDGRGNYSVGITEQIIFPEIDFDKIERISGLNVNVVTSA
RL5_TREPA       HRLINVALPRVKDFRGVSPXGFDGHGNYSMGITEQIIFPEIDFDKIERISGLNVNVVTSA
RL5_BORBU       YKLIHLALPRVKDFRGINGDAFDGNGNYSFGITEQIIFSEIDYDKIERISGLNITIVTTA
RL5_AGRFC       DRLINIALPRVRDFRGLNPKSFDGRGNFAMGIKEHIVFPEINYDKVDQMWGMDIIVCTTA
RL5_RHIME       DRLINIALPRVRDFRGLNPKSFDGRGNFAMGIKEHIVFPEINYDKVDQMWGMDIIVCTTA
RL5_BRUME       DRLITIALPRVRDFRGLNPKSFDGRGNYAMGIKEHIVFPEINYDKVDQIWGMDIIVCTTA
RL5_BRUSU       DRLITIALPRVRDFRGLNPKSFDGRGNYAMGIKEHIVFPEINYDKVDQIWGMDIIVCTTA
RL5_RHILO       DRLVNIALPRVRDFRGLNPKSFDGRGNYAMGIKEHIVFPEINYDKVDQIWGMDVIVCTTA
RL5_CAUVC       DRLVTIALPRVKDFRGLNGKSFDGRGNYAMGLKEHLVFPEINYDQIEQIWGMDIIVCTTA
RL5_BRADU       DRLVTVALPRVRDFRGLNPKSFDGRGNYSLGIKEHIIFPEIDFDKVTEARGMDITVCTTA
RL5_RHOPA       DRLITVALPRVRDFRGLNPKSFDGRGNYSLGIKEHIIFPEIDFDKTGESWGMDITVCTTA
RL5_RICCN       ERLVIVALPRVKEFRGFSYKSFDGKGNFTFGLKEQIVFPEINYDKIDTIRGMDITIVTSA
RL5_RICPR       ERLVIVALPRVKEFRGFSYKSFDGKGNFTFGLKEQIVFPEINYDKIDTIRGMDITIVTSA
RL5_WOLPM       ERLIYIALPREKDFRGFSVKQFDGNGNFSFGIKEHISFLEIDYDKISKIRGMDINIITSA
RL5_BORBR       DRLVAVALPRVRDFRGISGRAFDGRGNYNIGVKEQIIFPEIEYDKIDALRGLNISITTTA
RL5_BORPA       DRLVAVALPRVRDFRGISGRAFDGRGNYNIGVKEQIIFPEIEYDKIDALRGLNISITTTA
RL5_BORPE       DRLVAVALPRVRDFRGISGRAFDGRGNYNIGVKEQIIFPEIEYDKIDALRGLNISITTTA
RL5_RALSO       DRFITVSLPRVRDFRGVSGRAFDGRGNYNIGVKEQIIFPEIEYDKIDALRGLNISITTTA
RL5_NEIMA       DRLITIALPRVRDFRGVSGKSFDGRGNYNMGVREQIIFPEIEYDKIDALRGLNITITTTA
RL5_NEIMB       DRLITIALPRVRDFRGVSGKSFDGRGNYNMGVREQIIFPEIEYDKIDALRGLNITITTTA
RL5_CHRVO       DRLVTIALPRVRDFRGVSAKSFDGRGNYNMGVKEQIIFPEIEYDKIDALRGMNITITTSA
RL5_NITEU       DRLVNVAIPRIRDFRGIQVKGFDGRGNFNMGIKEQIIFPEIDYDKIDKVRGLNITVTTTA
RL5_PSEPK       DRLLAISLPRVRDFRGLNAKSFDGRGNYSMGVKEQIIFPEIDYDKIDALRGLDITLTTTA
RL5_PSESM       DRLLSISLPRVRDFRGLNAKSFDGRGNYSMGVKEQIIFPEIDYDKIDALRGLDITLTTTA
RL5_PSEAE       DRLLSISLPRVRDFRGLNAKSFDGRGNYSMGVKEQIIFPEIDYDKIDALRGLDITLTTTA
RL5_XANAC       DRLINISLPRVRDFRGVSGRSFDGRGNFNMGVKEQIIFPEIDFDAVDAIRGMDIAITTTA
RL5_XANCP       DRLINISLPRVRDFRGVSGRSFDGRGNFNMGVKEQIIFPEIDFDAVDAIRGMDIAITTTA
RL5_XYLFA       DRLINISLPCVRDFRGIPPRSFDGRGNFNMGVKEQVVFPEIDFDAVDAIRGMDIAITTTA
RL5_XYLFT       DRLINISLPCVRDFRGIPPRSFDGRGNFNMGVKEQVVFPEIDFDAVDAIRGMDIAITTTA
RL5_BUCAI       ERLIIIAVPRIRDFRGLSSHSFDGQGNYSLGIREQIIFPEIDYDKIDRVRGLDITITTTA
RL5_BUCAP       ERLIVIAIPRIRDFRGLSTNSFDGKGNYSLGIREQIIFPEIDYDKIDRVRGLDITITTTA
RL5_BUCBP       ERLIFIVIPRIRDFRGFSNKSFDGKGNYSIGIKEQIIFPEIDFDKIDRIRGINITITTTA
RL5_WIGBR       QKLICIAIPRIRDFRGLPVKSFDGFGNYSLGIKEQIIFPEIDYDKIDKIRGLDITITTNA
RL5_BLOFL       ERLISIAIPRIRDFRGLSIKSFDGYGNYTMGIREQIIFPEINYDTIDGIRGMNITITTNA
RL5_BUCAK       ERLISIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTA
RL5_YERPE       ERLITIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTA
RL5_PHOLL       ERLISIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTA
RL5_ECOLI       ERLITIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTA
RL5_ECOL6       ERLITIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTA
RL5_ECO57       ERLITIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTA
RL5_SHIFL       ERLITIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTA
RL5_SALTI       ERLITIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTA
RL5_SALTY       ERLITIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTA
RL5_HAEDU       ERLITIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTA
RL5_PASMU       ERLITIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTA
RL5_HAEIN       ERLITIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTA
RL5_VIBVU       ERLISIALPRVRDFRGVNAKSFDGRGNYSMGVREQIIFPEIDFDKVDRVRGLDITITTSA
RL5_VIBVY       ERLISIALPRVRDFRGVNAKSFDGRGNYSMGVREQIIFPEIDFDKVDRVRGLDITITTSA
RL5_VIBPA       ERLINIALPRVRDFRGVSAKSFDGRGNYSMGVREQIIFPEIDFDKVDRVRGLDITITTSA
RL5_VIBCH       ERLISIALPRVRDFRGVNGKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTA
RL5_PHOPR       ERLISIAVPRIRDFRGLNPNSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTSA
RL5_SHEON       ERLVDIAIPRIRDFRGLSAKAFDGRGNYAMGVREQIIFPEIDYDKIDKIRGMDIVITTSA
RL5_COXBU       KRLISIAIPRIRDFRGLSPKSFDGRGNYSLGIREQIVFPEIQYDKVDAIRGMDITITTTA
RL5_AQUAE       DKLISVALPRVKDFKGLSPRSFDGRGNYAFGIAEQIVFPEIDYDKVDRIRGMDIIINTTA
RL5_AQUPY       DKVISVALPRVKDFKGLNPRSFDGRGNYAFGIAEQIVFPEIDYDKVDRIRGMDIIINTTA
RL5_CHLTE       DRFISVAVPRIRDFRGLSDTSFDGRGNYNVGIREQIIFPEIDIDKVPRINGMDISFVTSA
RL5_FUSNN       DRLVNVVLPRVRDFEGVPSNSFDGRGNYSVGLRDQLVFPEIDFDKVEKLLGMSITMVSSA
RL5_HELHP       EKLIVIALPRVKDFRGLKRNGFDGRGNYSFGLNEQLMFPEVVYDDIMVTHGMNITIVTST
RL5_WOLSU       EKLISIALPRVKDFRGVPRNGFDGRGNYSFGLNEQLMFPEVVYDDIMVSHGMNITMVTTT
RL5_HELPY       EKLIVISLPRVKDFRGISRNGFDGCGNYTFGINEQLIFPEVVYDDIMVSHGMNITMVTST
RL5_HELPJ       EKLIVISLPRVKDFRGISRNGFDGRGNYTFGINEQLIFPEVVYDDIMVSHGMNITMVTST
RL5_CAMJE       DKLISIALPRVKDFRGLSRDGFDGRGNYNFGLDEQLMFPEVEYDKILRTHGMNISIVTTA
RL5_CHLCV       DRFCNIVSPRIRDFRGFSMKG-DGRGCYSLGLDDQQIFPEIDLDRVKRTQGMNITWVTTA
RL5_CHLPN       DRFCNIVSPRIRDFRGFSNKG-DGRGCYSVGLDDQQIFPEINLDRVKRTQGLNITWVTTA
RL5_CHLMU       DRFCNIVSPRIRDFRGFSCKG-DGRGCYSLGLDDQQIFPEVDLDRVKRSQGMNITWVTTA
RL5_CHLTR       DRFCNIVSPRIRDFRGFSCKG-DGRGCYSFGLDDQQIFPEVDLDRVKRSQGMNITWVTTA
RL5_BACTN       EKLVRVALPRIRDFKGIESK-FDGKGNYTLGIQEQIIFPEINIDSITRILGMNITFVTSA
RL5_PORGI       ERLVRIALPRIRDFKGIESK-LDGRGNYTLGINEQIIFPEINIDAITKILGMNITFVTSA
RL5_RHOBA       DRLVSIVLPRVRDFRGISRKAFDGNGNYTLGLNEQLVFPELNPDKFVRPQGMNISFVTSA
RL5_BACAN       DKLVSVSLPRVRDFRGVSKKSFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTA
RL5_BACCR       DKLVSVSLPRVRDFRGVSKKSFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTA
RL5_BACC1       DKLVSVSLPRVRDFRGVSKKSFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTA
RL5_GEOSE       DKLISVSLPRVRDFRGVSKKAFDGRGNYTLGIKEQLIFPEIDYDKVNKVRGMDIVIVTTA
RL5_BACSU       DKLISVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVTKVRGMDIVIVTTA
RL5_LISIN       DKLVTVSLPRVRDFRGVSKKAFDGRGNYTLGVREQLIFPEIDYDQVSKVRGMDVVIVTTA
RL5_LISMF       DKLVTVSLPRVRDFRGVSKKAFDGRGNYTLGVREQLIFPEIDYDQVSKVRGMDVVIVTTA
RL5_LISMO       DKLVTVSLPRVRDFRGVSKKAFDGRGNYTLGVREQLIFPEIDYDQVSKVRGMDVVIVTTA
RL5_BACHD       DKLISVSLPRVRDFRGISKKAFDGRGNYTLGVKEQLIFPEIDYDKVDKVRGMDVVIVTTA
RL5_OCEIH       QKLVAVSLPRVRDFRGISKKAFDGRGNYTLGVKEQLIFPEINYDKVSKIRGMDIVVVTTS
RL5_STRA3       DKLVSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKVRGLDIVIVTTA
RL5_STRA5       DKLVSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKVRGLDIVIVTTA
RL5_STRP1       DKLVSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEISFDDVDKVRGLDIVIVTTA
RL5_STRP3       DKLVSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEISFDDVDKVRGLDIVIVTTA
RL5_STRP6       DKLVSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEISFDDVDKVRGLDIVIVTTA
RL5_STRP8       DKLVSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEISFDDVDKVRGLDIVIVTTA
RL5_STRMU       DKLVTVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDNVDKVRGLDIVIVTTA
RL5_STRPN       DKLVSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKTRGLDIVIVTTA
RL5_STRR6       DKLVSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKTRGLDIVIVTTA
RL5_LACLA       DKLVTVSLPRVRDFHGVSNKAFDGRGNYTLGVKEQLIFPEINYDDVDKVRGMDIVIVTTA
RL5_ENTFA       DKLVTVSLPRVRDFHGVSKKAFDGRGNYTLGIKEQLIFPEVDYDLVDKVRGMDIVIVTTA
RL5_STAAC       DKLISVSLPRVRDFQGVSKKAFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTA
RL5_STAAM       DKLISVSLPRVRDFQGVSKKAFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTA
RL5_STAAN       DKLISVSLPRVRDFQGVSKKAFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTA
RL5_STAAR       DKLISVSLPRVRDFQGVSKKAFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTA
RL5_STAAS       DKLISVSLPRVRDFQGVSKKAFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTA
RL5_STAAW       DKLISVSLPRVRDFQGVSKKAFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTA
RL5_STAES       DKLIAVSLPRVRDFQGVSKTAFDGRGNYTLGVKEQLIFPEIDYDKVTKVRGMDIVIVTTA
RL5_STAEQ       DKLIAVSLPRVRDFQGVSKTAFDGRGNYTLGVKEQLIFPEIDYDKVTKVRGMDIVIVTTA
RL5_STAHJ       DKLIAVSLPRVRDFQGVSKTAFDGRGNYTLGIKEQLIFPEIDYDKVSKVRGMDIVIVTTA
RL5_STAS1       DKLIAVSLPRVRDFQGVSKTAFDGRGNYTLGVKEQLIFPEIDYDRVNKVRGMDIVIVTTA
RL5_LACJO       YKLINVSLPRVRDFRGISSRSFDGRGNYTLGIKEQLIFPEIDYDKVNRVRGLDVVIVTTA
RL5_LACPL       DKLINVSLPRVRDFHGVSTRSFDGRGNYTLGVREQLIFPEINYDNVNRVRGLDIVIVTTA
RL5_ONYPE       CKLTRLVFPRVRDFRGISGKSFDGRGNYALGLKEQIVFPEINIDKVKKIRGMDIIIVTTA
RL5_MYCCT       DKLINVALPRVRDFRGVSKTSFDGFGNFTTGIKEQIIFPEVDYDKVIRLRGMDITIVTSA
RL5_MYCMS       DKLINVALPRVRDFRGVSKTSFDGFGNFTTGIKEQIIFPEVDYDKVIRLRGMDITIVTSA
RL5_SPIKU       DKLINIALPRVRDFRGLNKDAFDGRGNYTLGIKEQIIFPEIDYDKVKRVRGMDITIVTSA
RL5_MYCGE       EKLIYIALPRVRDFRGLSLRSFDGKGNYTIGIKEQIIFPEIVYDDIKRIRGFDITIVTST
RL5_MYCPN       EKLIYVALPRVRDFRGLSLKSFDGRGNYTIGIKEQIIFPEIVYDDIKRIRGFDVTLVTST
RL5_MYCGA       EKLINIALPRVRDFRGLSNRAFDARGNYTLGIKEQIIFPEIIYDNVKKIRGFDVTLVISS
RL5_UREPA       ETLFNIALPRVRDFKGISNNSFDNQGNYTLGIKEQIIFPQVVYDDVKSVRGFDVTFVTTA
RL5_MYCPE       TKLISIAIPRIRDFRGLSTKSFDGNGNYTFGIKEQIIFPEIVYDDVKKLRGFDITIVTSA
RL5_MYCPU       NKLINIAMPRIRDFRGVSPKAFDGRGNYSLGIKEQIIFPEIEFDKIRKIKGLDVIIVTSA
RL5_CLOAB       DKLMNVALPRVRDFRGVSSKSFDGRGNYALGIKEQLIFPEVEYDKIDKVRGMDVIFVTNA
RL5_CLOTE       DKLMNVALPRVRDFRGVSSKSFDGRGNYSLGVKEQLMFPEIEYDKVDKVRGMDIIFVTTA
RL5_CLOPE       DKLVSIALPRVRDFRGVSAKAFDGRGNYSLGIKEQLIFPEIEYDKVDKVRGMDIIFVTSA
RL5_CALS4       DKLFNIALPRVRDFKGVSPNSFDGRGNYALGVREQLIFPEIDYDKIDKVRGMDIIIVTTA
RL5_THET8       EKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALRGMDIAVVTTA
RL5_THETH       EKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALRGMDIAVVTTA
RL5_THET2       EKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALRGMDIAVVTTA
RL5_THEAQ       EKLLSVALPRIRDFRGLNPNSFDGRGNYNLGLKEQLIFPEITYDMVDVPRGMDIAVVTTA
RL5_DEIRA       EKLINIGLPRIRDFRGINPNAFDGRGNYNLGIKEQLIFPEITYDMVDKTRGMDITIVTTA
RL5_THEMA       YKLINIVLPKVRDFRGLDPNSFDGRGNYSFGLSEQLVFPELNPDEVRRIQGMDITIVTTA
RL5_LEPIC       DRLVNVALPRVRDFKGVSEKGFDGRGNYNMSIKEQIIFPEIKVDKINTLYGINMTFVTNS
RL5_LEPIN       DRLVNVALPRVRDFKGVSEKGFDGRGNYNMSIKEQIIFPEIKVDKINTLYGINMTFVTNS
RL5_GEOSL       DRLINVALPRVRDFKGVSAKGFDGRGNYSLGVKEQLIFPEINYDKIDKIKGLNITIVTSA
RL5_BDEBA       DRLNTLALPRVRDFRGLPNKGFDGRGNYNMGLKEQIVFPEINYDKVDKTRGMNITICTTA
RL5_THEEB       DRLINLALPRIRDFRGVNPKSFDGRGNYTLGLREQLIFPEVNYDDIDQIRGMDVSIITTA
RL5_SYNY3       DRLINLALPRIRDFRGISPNSFDGRGNYSLGIREQLIFPEIDYDTIDQIRGMDVSIITSA
RL5_NOSS1       DRLISLSLPRIRDFRGISPKSFDGRGNYTLGVREQLIFPEIEYDSIDQIRGLDISIITTA
RL5_SYNP6       ERLINLSLPRIRDFRGISPRSFDGRGNYTLGLREQLIFPEITYDSIDQIRGMDITIVTSA
RL5_PROMM       ERLINLALPRIRDFRGVSPKSFDGRGNYTLGVREQLIFPEISFDKIDAIRGMDITIVTSA
RL5_SYNPX       ERLINLALPRIRDFRGVSPKSFDGRGNYTLGVREQIIFPEISFDKIDAIRGMDITIVTTA
RL5_PROMA       ERLINLALPRIRDFRGVSPKSFDGRGNFTLGVKEQLIFPEISFDKIDAIRGMDITIVTSA
RL5_PROMP       ERFINLALPRIRDFRGVNPKSFDGRGNYTLGVKEQLIFPEISFDKIDSIRGMDITIVTSA
RK5_CYAPA       DRLINLSLPRIRDFRGITAKSFDGRGNYNLGLKEQLIFPEVDYDGIEQIRGMDISIVTTA
RK5_PORPU       EKLINLTLPRIRDFRGISPKSFDGKGNYNLGLREQLIFPEIDYDNIDQIRGLDISIVTTA
RK5_GUITH       EKLIHLSLPRIRDFRGVSVKSFDGRGNYNLGIKEQLIFPEIEYDQVDQVRGLDISITTTA
RK5_CHAGL       DRLINLALPRIRDFQGLNRKSFDGHGNFHLGLKEQLMFPEIDYDKIDKLRGMDICIVTTC
RK5_MESVI       DRLINLALPRIRDFQGVSSKSFDGHGNYNLGLKEQLMFPEIDYDQIDKIRGMDICIVTNA
RK5_CHLRE       DRLIHLALPRVRDFQGISSKSFDKKGNYSLGLEEQLMFPEIEYDKIDQVRGMDISIVTTA
RK5_NEPOL       DRLINLALPRIRDFQGMSTKSFDGQGNYSLGLNEQLMFPEINYDAIDQMRGMDISIITSA
RK5_CHLVU       DRLINLALPRIRDFQGVSRKSFDGRGNYSLGLEEQLMFPEIDYDKIDQIRGMDVSIVTTA
RL5_GLOVI       DRLVSVALPRIRDFRGVSPKAFDGRGNYTLGLREQLIFPEIEYDSVDKIRGMDITICTTA
RK5_EUGLO       DRLINLSFPRMRDFNGLNIKGFDGFGNYNVGLSEQSIFPEIEYSSILKNKGMNITIVTTA
RK5_EUGGR       DRLINLSLPRIRDFQGINKNCFDGSGNFSFGLSEQSMFPEINFDKMIKVQGLNITIVTTA
RK5_CYACA       EKLIHFSLPAARDFRGLSTKNFDGLGNYNLGIKEHAIFPEIDFDKIDHSYGLNICIVTTA
RK5_GRATL       NKLINLALPRIRDFRGISYKTFDGRGNYNLGLKEQIIFPEIKYDNVDKIRGLDITIVTTA
RK5_CYAM1       TKFIHLILPRLKDFRGLNPTSFDGNGNYHMGLPDQLAFPEIDYDQIDQYRGMDISIITTA
RK5_HELSJ       YKFINIILPNIRQFQGIENKQFDSLGNITFPIYSQSNIPELPYNPRVEKRGFNVTINIKA
                     .  .  ::*.*.     *  *     : .:  : ::  .      *: :      

RK5_THAPS       STPKSRSKTVDRVLNGMILLKFLRFPLNDCGYYDKYESFGEITQVWDKKKHLRRKRWSQE
RK5_TRICV       TAPKSRSKTMDRVLNGMVLFKFLRFPLNDSGYYDKYSSFSEVSQAWDRKKHLRRKRWSQE
RK5_PHATC       GSPKYRAESIDKILNGMILFKFLRFPLNDCGYYDKYEAFSDINRNWDKKRHLKRKRWSQE
RL5_TROW8       SSDD----------MARALLGELGFPFKK-------------------------------
RL5_TROWT       SSDD----------MARALLGELGFPFKK-------------------------------
RL5_COREF       VTDD----------EGRALLRELGFPFKGEDGKKQ-------------------------
RL5_CORGL       VTDD----------EGRSLLRELGFPFKGEDGNRQQ------------------------
RL5_CORDI       TNNE----------EGRALLRELGFPFKKADA----------------------------
RL5_STRAW       TNDA----------EGRALLRHLGFPFKEA------------------------------
RL5_STRCO       TNDA----------EGRALLRHLGFPFKEA------------------------------
RL5_MICLU       KNDD----------EGRALLKALGFPFKTDQ-----------------------------
RL5_MYCBO       ATDD----------EGRALLRALGFPFKEN------------------------------
RL5_MYCTU       ATDD----------EGRALLRALGFPFKEN------------------------------
RL5_MYCLE       TTDD----------EGRALLRALGFPFKEN------------------------------
RL5_MYCPA       TTDD----------EGRALLRALGFPFKEN------------------------------
RL5_BIFLO       KDDK----------EAYALLKHLGFPFKEN------------------------------
RL5_NEOSM       STDQ----------LARILLSCYGFPFRD-------------------------------
RL5_DESVH       TTDK----------EGKLLLDQLGMPFRK-------------------------------
RL5_TREDE       ETDQ----------EARSLLAKFGMPFRK-------------------------------
RL5_TREPA       QTDQ----------EARTLLTKLGMPFRK-------------------------------
RL5_BORBU       SNDK----------ESKALLLKFGMPFSN-------------------------------
RL5_AGRFC       TSDD----------EARALLTEFNFPFRH-------------------------------
RL5_RHIME       TNDD----------EARALLKEFNFPFRQ-------------------------------
RL5_BRUME       KTDD----------EARSLLRAFNFPFRQ-------------------------------
RL5_BRUSU       KTDD----------EARSLLRAFNFPFRQ-------------------------------
RL5_RHILO       KTDD----------EARALLKAFNFPFRQ-------------------------------
RL5_CAUVC       KSDQ----------EAKALLKEFQFPFVN-------------------------------
RL5_BRADU       KTDE----------EARALLTAFNFPFRQ-------------------------------
RL5_RHOPA       RTDD----------EARALLTAFNFPFRQ-------------------------------
RL5_RICCN       KTDQ----------ESKFLLSGFNLPFYN-------------------------------
RL5_RICPR       KTDQ----------ESKFLLSGFNLPFYN-------------------------------
RL5_WOLPM       VSDK----------EAKELLLALKFPFFD-------------------------------
RL5_BORBR       KTDD----------EAKALLTAFSFPFRN-------------------------------
RL5_BORPA       KTDD----------EAKALLTAFSFPFRN-------------------------------
RL5_BORPE       KTDD----------EAKALLTAFSFPFRN-------------------------------
RL5_RALSO       KSDE----------EAKALLAAFKFPFRN-------------------------------
RL5_NEIMA       KTDE----------EAKALLSLFKFPFKG-------------------------------
RL5_NEIMB       KTDE----------EAKALLSLFKFPFKG-------------------------------
RL5_CHRVO       KTDE----------EARALLAAFKFPFKG-------------------------------
RL5_NITEU       KTDQ----------EARALLSAFKFPFKN-------------------------------
RL5_PSEPK       RSDD----------EGRALLRAFKFPFRN-------------------------------
RL5_PSESM       KNDD----------EGRALLRAFKFPFRN-------------------------------
RL5_PSEAE       RTDD----------EGRALLRAFKFPFRN-------------------------------
RL5_XANAC       KTDA----------EAKALLAAFKFPFRN-------------------------------
RL5_XANCP       KTDA----------EAKALLAAFKFPFRN-------------------------------
RL5_XYLFA       NSDA----------EAKALLDAFNFPFRN-------------------------------
RL5_XYLFT       NSDA----------EAKALLDAFNFPFRN-------------------------------
RL5_BUCAI       KSNH----------EARLLLSAFNFPFRK-------------------------------
RL5_BUCAP       NSDH----------EARLLLSSFNFPFRK-------------------------------
RL5_BUCBP       LSDR----------EGYALLSAFNFPFRT-------------------------------
RL5_WIGBR       KSDK----------EGLALLSAFNFPFRK-------------------------------
RL5_BLOFL       VSDK----------EAYVLLRAFRFPLKNNDSIYTSTEEH--------------------
RL5_BUCAK       KSDD----------EGRALLAAFNFPFRK-------------------------------
RL5_YERPE       KSDD----------EGRALLAAFKFPFRK-------------------------------
RL5_PHOLL       KSDD----------EGRALLAAFNFPFRK-------------------------------
RL5_ECOLI       KSDE----------EGRALLAAFDFPFRK-------------------------------
RL5_ECOL6       KSDE----------EGRALLAAFDFPFRK-------------------------------
RL5_ECO57       KSDE----------EGRALLAAFDFPFRK-------------------------------
RL5_SHIFL       KSDE----------EGRALLAAFDFPFRK-------------------------------
RL5_SALTI       KSDE----------EGRALLAAFDFPFRK-------------------------------
RL5_SALTY       KSDE----------EGRALLAAFDFPFRK-------------------------------
RL5_HAEDU       KSDE----------EGQALLAVFNFPFRK-------------------------------
RL5_PASMU       KSDE----------EGQALLAAFNFPFRK-------------------------------
RL5_HAEIN       KNDE----------EGQALLAAFNFPFRK-------------------------------
RL5_VIBVU       GTDE----------EGRALLAAFNFPFRK-------------------------------
RL5_VIBVY       GTDE----------EGRALLAAFNFPFRK-------------------------------
RL5_VIBPA       GTDE----------EGRALLAAFNFPFRK-------------------------------
RL5_VIBCH       GTDE----------EGRALLAAFNFPFRK-------------------------------
RL5_PHOPR       ASDE----------ESKALLSAFNFPFRK-------------------------------
RL5_SHEON       KTDE----------EGRALLDAFNFPFKK-------------------------------
RL5_COXBU       RTDE----------EGRALLKAFGFPLKDESR----------------------------
RL5_AQUAE       ETDE----------EAFWLLSLLGLPIRSM------------------------------
RL5_AQUPY       VSDQ----------ESLLATLTLGLPIRAM------------------------------
RL5_CHLTE       KTDE----------EAYELLSLLGMPFKKKNQ----------------------------
RL5_FUSNN       KTDE----------EGRALLKAFGMPFKK-------------------------------
RL5_HELHP       HSDK----------EAFKLLELLGMPFAKGR-----------------------------
RL5_WOLSU       NNDK----------EAFKMLELFGMPFAKGRVNG--------------------------
RL5_HELPY       DNDK----------EAFKLLELLGLPFAKVR-----------------------------
RL5_HELPJ       DNDK----------EAFKLLELLGLPFAKVR-----------------------------
RL5_CAMJE       QNDK----------QAQKLLELIGVPFTKGK-----------------------------
RL5_CHLCV       QTDV----------ECTTLLELMGLRFKKAQ-----------------------------
RL5_CHLPN       QTDD----------ECTTLLELMGLRFKKAQ-----------------------------
RL5_CHLMU       QTDA----------ECLTLLECMGLRFKKAQ-----------------------------
RL5_CHLTR       QTDA----------ECLTLLECMGLRFKKAQ-----------------------------
RL5_BACTN       ETDE----------EGYALLKEFGLPFKNAKKD---------------------------
RL5_PORGI       QSDE----------EGYALLKEFGLPFKNAKKQN--------------------------
RL5_RHOBA       KTDD----------EAREMLRLFGMPFKQPKEKEQAGAA---------------------
RL5_BACAN       KTDE----------EARELLTQFGMPFQK-------------------------------
RL5_BACCR       KTDE----------EARELLTQFGMPFQK-------------------------------
RL5_BACC1       NTDE----------EARELLTQFGMPFQK-------------------------------
RL5_GEOSE       NTDE----------EARELLALLGMPFQK-------------------------------
RL5_BACSU       NTDE----------EARELLTQVGMPFQK-------------------------------
RL5_LISIN       KSDE----------ESHELLTQLGMPFQK-------------------------------
RL5_LISMF       KSDE----------ESHELLTQLGMPFQK-------------------------------
RL5_LISMO       KSDE----------ESHELLTQLGMPFQK-------------------------------
RL5_BACHD       STDE----------EARELLSQMGMPFQK-------------------------------
RL5_OCEIH       NTDE----------EARELLAQLGMPFQK-------------------------------
RL5_STRA3       NTDE----------ESRELLKGLGMPFAK-------------------------------
RL5_STRA5       NTDE----------ESRELLKGLGMPFAK-------------------------------
RL5_STRP1       NTDE----------ESRELLKGLGMPFAK-------------------------------
RL5_STRP3       NTDE----------ESRELLKGLGMPFAK-------------------------------
RL5_STRP6       NTDE----------ESRELLKGLGMPFAK-------------------------------
RL5_STRP8       NTDE----------ESRELLKGLGMPFAK-------------------------------
RL5_STRMU       NTDE----------ESRELLTGLGMPFAK-------------------------------
RL5_STRPN       NTDE----------ESRALLTGLGMPFAK-------------------------------
RL5_STRR6       NTDE----------ESRALLTGLGMPFAK-------------------------------
RL5_LACLA       NTDE----------ESRELLAKLGMPFAK-------------------------------
RL5_ENTFA       NTDE----------ESRELLAQLGMPFQK-------------------------------
RL5_STAAC       NTDE----------EARELLANFGMPFRK-------------------------------
RL5_STAAM       NTDE----------EARELLANFGMPFRK-------------------------------
RL5_STAAN       NTDE----------EARELLANFGMPFRK-------------------------------
RL5_STAAR       NTDE----------EARELLANFGMPFRK-------------------------------
RL5_STAAS       NTDE----------EARELLANFGMPFRK-------------------------------
RL5_STAAW       NTDE----------EARELLANFGMPFRK-------------------------------
RL5_STAES       NTDE----------EARELLTNFGMPFRK-------------------------------
RL5_STAEQ       NTDE----------EARELLTNFGMPFRK-------------------------------
RL5_STAHJ       NTDE----------EARELLTNFGMPFRK-------------------------------
RL5_STAS1       NTDE----------EARELLSQFGMPFHK-------------------------------
RL5_LACJO       KTDE----------EARELLTEFGMPFAK-------------------------------
RL5_LACPL       DSDE----------ESRELLTQFGMPFAK-------------------------------
RL5_ONYPE       KNNT----------QAKKLLELYGMPFKN-------------------------------
RL5_MYCCT       KTNK----------EAFALLQKIGMPFEK-------------------------------
RL5_MYCMS       KTNK----------EAFALLQKVGMPFEK-------------------------------
RL5_SPIKU       TNDA----------DARALLRKMGMPFKK-------------------------------
RL5_MYCGE       NKDS----------EALALLRALKMPFVKE------------------------------
RL5_MYCPN       NKDS----------EALALLRALNLPLVKG------------------------------
RL5_MYCGA       DNAK----------YNHRLLLELGMPLIKTKEHANG------------------------
RL5_UREPA       KTAQ----------EAKALLVGLGAPFQKVRGDK--------------------------
RL5_MYCPE       KTDK----------EAMFLLKELGMPFVKTKEAK--------------------------
RL5_MYCPU       KTNK----------EARALLEGIGIPFAKVEK----------------------------
RL5_CLOAB       KTDE----------EARELLRFLGMPFAQ-------------------------------
RL5_CLOTE       KTDE----------EARELLRFLGMPFAH-------------------------------
RL5_CLOPE       NTDE----------EARELLRFLGMPFAQ-------------------------------
RL5_CALS4       KTDE----------EAKALLELLGMPFAK-------------------------------
RL5_THET8       ETDE----------EARALLELLGFPFRK-------------------------------
RL5_THETH       ETDE----------EARALLELLGFPFRK-------------------------------
RL5_THET2       ETDE----------EARALLELLGFPFRK-------------------------------
RL5_THEAQ       KTDE----------EAKALLELLGFPFRK-------------------------------
RL5_DEIRA       KTDE----------EARALLQSMGLPFRKQ------------------------------
RL5_THEMA       KTDQ----------EARRLLELFGMPFKRG------------------------------
RL5_LEPIC       KSNE----------EAYSLLAAFGMPYRNQK-----------------------------
RL5_LEPIN       KSNE----------EAYSLLAAFGMPYRNQK-----------------------------
RL5_GEOSL       KTDE----------ESRALLKHLGMPFRH-------------------------------
RL5_BDEBA       KNDT----------EGRALLEALGMPFRK-------------------------------
RL5_THEEB       NTDE----------EGRALLKAMGMPFREN------------------------------
RL5_SYNY3       QTDE----------EGRALLKALGMPFRS-------------------------------
RL5_NOSS1       KNDE----------EGRALLKEFGMPFRDQ------------------------------
RL5_SYNP6       NSDE----------EGRALLRELGMPFREN------------------------------
RL5_PROMM       RTDE----------EGQSLLREMGMPFRSN------------------------------
RL5_SYNPX       RSDE----------EGRALLREMGMPFQSN------------------------------
RL5_PROMA       RTDE----------EGRALLKEMGMPFRSN------------------------------
RL5_PROMP       STDQ----------EGKALLKELGMPFSN-------------------------------
RK5_CYAPA       KTDQ----------EGLALLKSLGMPFAES------------------------------
RK5_PORPU       KTDQ----------EGLALLKKLGMPFRES------------------------------
RK5_GUITH       KTQQ----------EGIALLRALGMPFNDN------------------------------
RK5_CHAGL       TNDN----------ECFQFLSALGMPFQTVSSKKL-------------------------
RK5_MESVI       KTDS----------EGFYLLEVLGMPFKEKFAN---------------------------
RK5_CHLRE       KTQE----------EGLALLKEFGLPFK--------------------------------
RK5_NEPOL       TEDR----------EGFALLQALGMPFRTATID---------------------------
RK5_CHLVU       KTDK----------EAMALFKTFGMPFKN-------------------------------
RL5_GLOVI       KTDE----------EGRALLAALGMPFRK-------------------------------
RK5_EUGLO       KTDL----------ESFSLLKGLGFPFCV-------------------------------
RK5_EUGGR       ETNQ----------EAFFLLKELGIPFRD-------------------------------
RK5_CYACA       NNDI----------EGKALLKFLGMPFKD-------------------------------
RK5_GRATL       KNDE----------EGLTLLKEFGMPFM--------------------------------
RK5_CYAM1       KTDE----------EAKFLLEALGMRFQ--------------------------------
RK5_HELSJ       KNVS----------EAKALCAYLGFPII--------------------------------