CLUSTAL format seed alignment for MF_01335

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

UCRI_SYNJB       MTEAVSNFEAPPMSRRVLLNALLSGSVGVVVVGALYPVVKYFIPPS-AGGGGEGLIAQDA
UCRI_SYNJA       MTEAVSNFEAPPMSRRVFLNALLSSSVGVVVVGTLYPVVKYFIPPS-SGGAGEGVIAQDA
UCRI_GLOVI       MSESAA--QEIPMSRRQLLSFVTGGAIAATTAATLYPVVLYFLPPS-TAGGGEGVAAKDK
UCRIA_NOSS1      MAQFSESVDVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPA-AGGAGGGTTAKDE
UCRIA_TRIV2      MAQFSESVDVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPA-TGGAGGGTTAKDE
UCRI_MASLA       MAQFTESMDVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPS-GGAVGGGTTAKDK
UCRI_THEEB       MAQVSGMSDVPDMGRRQFMNLLTFGTITGTALGALYPVVKYFIPPA-SGGTGGGAVAKDA
UCRIB_SYNY3      MTQISGSPDVPDLGRRQFMNLLTFGTITGVAAGALYPAVKYLIPPS-SGGSGGGVTAKDA
UCRI_TRIEI       MAQAEGTPDVPSMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPS-SGGSGGGVTAKDA
UCRI_SYNE7       MTQVSGASDVPSMGRRQFMNLLTFGSVTGVALGALYPVVNYFIPPS-SGGSGGGVAAKDA
UCRI_SYNP6       MTQVSGASDVPSMGRRQFMNLLTFGSVTGVALGALYPVVNYFIPPS-SGGSGGGVAAKDA
UCRI_SYNS3       MTQMP-ASDVPGMGRRQFMNLLTFGSVTGVALGALYPVANYFIPPR-AAGGGGGTSAKDE
UCRI_SYNPW       MTQMP-AGDVPGMGRRQFMNLLTFGSVTGVALGALYPVVNYFIPPR-AAGSGGGTSAKDE
UCRI_SYNSC       MTQLS-SSDVPGMGRRQFMNLLTFGSVTGVALGALYPVANYFIPPK-AAGSGGGTSAKDE
UCRI_SYNPX       MTQLS-SSDVPGMGRRQFMNLLTFGSVTGVALGALYPVVNYFIPPR-AAGAGGGTTAKDE
UCRI_SYNS9       MTQIP-SSDVPGMGRRQFMNLLTFGSVTGVALGALYPVARYFIPPK-AAGSGGGTTAKDE
UCRI_PROM3       MTQMT-SSDVPGMGRRQFMNLLTFGSVTGVALGSLYPVVKYFIPPR-ASGSGGGTSAKDE
UCRI_PROMM       MTQMT-SSDVPGMGRRQFMNLLTFGSVTGVALGSLYPVVKYFIPPR-ASGSGGGTSAKDE
UCRI_PROM1       MTQMT-TADVPSMGRRQFMNLLTFGTVTGVALGALYPVAQYFTPYR-AGGGGGGTNAKDE
UCRI_PROMT       MTQMT-TADVPSMGRRQFMNLLTFGTVTGVALGALYPVAQYFTPYR-AGGGGGGTNAKDE
UCRI_PROMS       MTQLS-SNDVPSMGRRQFMNLLTFGTATGVALGALYPVANYFMPLR-AGGGGGGTSAKDE
UCRI_PROM0       MTQLS-SNDVPSMGRRQFMNLLTFGTATGVALGALYPVANYFMPLR-AGGGGGGTSAKDE
UCRI_PROM9       MTQLS-SNDVPSMGRRQFMNLLTFGTATGVALGALYPVANYFMPLR-AGGGGGGTSAKDE
UCRI_PROM5       MTQLS-SNDVPSMGRRQFMNLLTFGTATGVALGALYPVANYFMPLR-AGGGGGGTSAKDE
UCRI_PROMP       MTQLS-SNDVPSMGRRQFMNLLTFGTATGVALGALYPVANYFMPLR-AGGGGGGTSAKDE
UCRI_PROMA       MTQMS-PSDVPSMGRRQFMNLLTFGTATGVALGALYPVANFFMPLR-AGGGTGGTTAKDE
UCRIB_NOSS1      -MDDTLNQANPSMSRRQLLNFFTGAIVATTASAAIYPATKFFMPPAESTDAEGGILAQDK
UCRIB_TRIV2      -MDDTLNQLNPSMSRRQLLNFFTGAIVAATASAAIYPATKFFMPPAESTDAEGGVLAKDK
UCRIC_NOSS1      -MDNSIPIESPSLSRRQLLNFITGATVAVTAGAALYPAGKFLIAPAEKTGAGGAILAKDI
UCRIA_SYNY3      -MDNTQAIAPPSYSRRQLLNFLAGTTVAVTASAGAYAMGKFFVPPAEKGGAGGGIIAKDV
                   :          .** ::. .       .. .  *.   :: .         .  *:* 

UCRI_SYNJB       LGKPISVSELLATHAATDRVLAQGLK---GDPTYIVI-DNGAVANYGLNAVCTHLGCVVP
UCRI_SYNJA       LGKPISVSELLATHAATDRVLAQGLK---GDPTYIVI-DNGAVANYGLNAVCTHLGCVVP
UCRI_GLOVI       EGKDISVSKLLAAATPGEPVLTLGLDVNGGDATYIVINDQKEIANFGINAVCTHLGCVVP
UCRIA_NOSS1      LGNDVSVSKFLESHNVGDRTLVQGLK---GDPTYIVVESKEAITDYGINAVCTHLGCVVP
UCRIA_TRIV2      LGNDVSVSKFLESHNVGDRTLVQGLK---GDPTYIVVESKEAITDYGINAVCTHLGCVVP
UCRI_MASLA       LGNNVKVSKFLESHNAGDRVLVQGLK---GDPTYIVVESKEAIRDYGINAVCTHLGCVVP
UCRI_THEEB       LGNDIKVSEYLAKHLPGDRSLAQGIK---GDPTYVIVTEDHQIANYGLNAVCTHLGCVVP
UCRIB_SYNY3      LGNDVKVTEFLASHNAGDRVLAQGLK---GDPTYIVVQGDDTIANYGINAVCTHLGCVVP
UCRI_TRIEI       LGNDIIVSEFLANHNSGERTLAQGLK---GDPTYVVIEGEQTLAEYGLNAVCTHLGCVVP
UCRI_SYNE7       LGNDVVLSKFLADHNVGDRTLVQGLK---GDPTYLVVESSEAIGDYGINAVCTHLGCVVP
UCRI_SYNP6       LGNDVVLSKFLADHNVGDRTLVQGLK---GDPTYLVVESSEAIGDYGINAVCTHLGCVVP
UCRI_SYNS3       LGNSVTASGWLSSHAEGDRSLVQGLK---GDPTYLIVEGVDAIGSYGINAICTHLGCVVP
UCRI_SYNPW       LGNAVTASGWLSTHPAGDRSLVQGLK---GDPTYLIVEGDDAIGSYGINAICTHLGCVVP
UCRI_SYNSC       LGNPITASGWLSSHPEGDRSLVQGLK---GDPTYLIVEGEDAIGSYGINAICTHLGCVVP
UCRI_SYNPX       LGNAITATGWLSSHPEGDRSLVQGLK---GDPTYLIVEGPDAIGSYGINAICTHLGCVVP
UCRI_SYNS9       LGNVVTATGWLSTHPEGDRSLVQGLK---GDPTYLIVEGADAIGSYGINAICTHLGCVVP
UCRI_PROM3       LGNSVTASGWLANHSDGDRSLVQGLK---GDPTYLIVEGDDAIGSYGINAICTHLGCVVP
UCRI_PROMM       LGNSVTASGWLANHSDGDRSLVQGLK---GDPTYLIVEGDDAIGSYGINAICTHLGCVVP
UCRI_PROM1       LGNNVSASGWLSTHPVGDRSLVQGLK---GDPTYLIVEGEDAITSYGINAICTHLGCVVP
UCRI_PROMT       LGNNVSASGWLSTHPVGDRSLVQGLK---GDPTYLIVEGEDAITSYGINAICTHLGCVVP
UCRI_PROMS       LGNPITKTGWLATHQAGDRSLVQGLK---GDPTYLIVNEGGEIGEFGLNAICTHLGCVVP
UCRI_PROM0       LGNPITKTGWLATHQAGDRSLVQGLK---GDPTYLIVNEVGEIGEFGLNAICTHLGCVVP
UCRI_PROM9       LGNPVTKTGWLATHQAGDRSLVQGLK---GDPTYLIVNEGGEIGEFGLNAICTHLGCVVP
UCRI_PROM5       LGNPVTKTGWLANHQAGDRSLVQGLK---GDPTYLIVNSEGDIGEFGLNAICTHLGCVVP
UCRI_PROMP       LGNPVTKTGWLASHQAGDRSLVQGLK---GDPTYLIVNSEGEIGEFGLNAICTHLGCVVP
UCRI_PROMA       LGNAVTATGWLSNHPAGDRSLVQGLK---GDPTYLIVDGDAAIGNFGINAICTHLGCVVP
UCRIB_NOSS1      IGHPIPASQILAQA-SGTRALIAGLA---GEPTYLTVREDGTLDPMGIVNNCTHLGCTFP
UCRIB_TRIV2      IGHPIPASQILVQA-SGTRALIAGLA---GEPTYLTVREDGTLDPMGIVNNCTHLGCTFP
UCRIC_NOSS1      LGKQIPASQILAEP-PQTRALVAGLA---GEPTYLIVKEDHTLDRIGLVDNCTHLGCTFP
UCRIA_SYNY3      LGNPIPASQILAEA-PGTRALVAGLA---GDPTYLIVKEDGSLDSIGIVDSCTHLGCTFP
                  *: :  :  *         *  *:    *:.**: :     :   *:   ******..*

UCRI_SYNJB       WNVGENLFKCPCHGSQYAANGKVIRGPAPRSLELVSATVD-GDNVRFSPWQGPDFRET--
UCRI_SYNJA       WNAGENLFKCPCHGSQYAANGKVIRGPAPRSLELVSATVD-GDNVRFSPWQGPDFREA--
UCRI_GLOVI       WDNGAKQFKCPCHGSVYNADGGLERGPAPQPLALVKATVS-DDKVLIAPWTEQDFRCTDL
UCRIA_NOSS1      WNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTE-NDKIVLTSWTETDFRTGE-
UCRIA_TRIV2      WNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTE-NDKIVLTPWTETDFRTGE-
UCRI_MASLA       WNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQ-DDNIVLTPWTETDFRTGE-
UCRI_THEEB       WNVSENKFICPCHGSQYDSTGKVVRGPAPLSLALVKATVTEDDKLVFTPWTEIDFRTGK-
UCRIB_SYNY3      WNASENKFMCPCHGSQYNAEGKVVRGPAPLSLALAHATVTDDDKLVLSTWTETDFRTDE-
UCRI_TRIEI       WNGSENKFICPCHGSQYDNTGKVVRGPAPLSLALVHANVS-DDKLVFTQWEETDFRTGE-
UCRI_SYNE7       WNASENKFKCPCHGSQYDATGKVVRGPAPLSLALAHVSVT-DDKVFLSPWTETDFRTGD-
UCRI_SYNP6       WNASENKFKCPCHGSQYDATGKVVRGPAPLSLALAHVSVT-DDKVFLSPWTETDFRTGD-
UCRI_SYNS3       WNSGANKFMCPCHGSQYDATGKVVRGPAPLSLALANVSVD-NDNVFVSQWTETDFRTGE-
UCRI_SYNPW       WNSGANKFMCPCHGSQYDATGKVVRGPAPLSLALANVSVE-NDNVFVSQWTDTDFRTGE-
UCRI_SYNSC       WNSGANKFMCPCHGSQYDSTGKVVRGPAPLSLALANVSVE-NDNVFVSQWTETDFRTGD-
UCRI_SYNPX       WNSGANKFMCPCHGSQYDATGKVVRGPAPLSLALANVSVE-NDNVFVSQWTETDFRTGD-
UCRI_SYNS9       WNSGANKFMCPCHGSQYDATGKVVRGPAPLSLALANVSVE-DDNVFVSEWSETDFRTGD-
UCRI_PROM3       WNSGVNKFVCPCHGSQYNSTGKVVRGPAPLSLALANIAVE-NDNVFVSQWTETDFRTGE-
UCRI_PROMM       WNSGVNKFVCPCHGSQYNSTGKVVRGPAPLSLALANIAVE-NDNVFVSQWTETDFRTGE-
UCRI_PROM1       WNSGANKYMCPCHGSQYDSTGKVVRGPAPLSLAIAHVSIE-DDQVLVSQWTETDFRTGT-
UCRI_PROMT       WNSGANKYMCPCHGSQYDSTGKVVRGPAPLSLAIAHVSIE-DDQVLVSQWTETDFRTGT-
UCRI_PROMS       WDSGANKFICPCHGSQYDTNGKVVRGPAPLSLALAHVDIE-DDAVLVKQWSETDFRTNE-
UCRI_PROM0       WDSGANKFICPCHGSQYDTNGKVVRGPAPLSLALAHVDIE-DDAVLVKQWSETDFRTNE-
UCRI_PROM9       WDSGANKFICPCHGSQYDTNGKVVRGPAPLSLALAHVDIE-DDAVLVKQWSETDFRTNE-
UCRI_PROM5       WDSGANKFICPCHGSQYDTNGKVVRGPAPLSLALAHVDVD-DDAVLVKQWSETDFRTNE-
UCRI_PROMP       WDSGANKFICPCHGSQYDTNGKVVRGPAPLSLALAHVDVD-DDAVLVKQWSETDFRTNE-
UCRI_PROMA       WNSGANKYICPCHGSQYDANGKVVRGPAPLSLALTHIDID-DDNVLVSQWTETDFRTGD-
UCRIB_NOSS1      WNPVDQQFQCPCHGSRYDAQGSVERGPANRPLKLVQVQVK-DDYIWISPWQETDPRTGE-
UCRIB_TRIV2      WNPVDQQFQCPCHGSRYDAQGSVERGPANRPLKLVHVQVK-DDYIWISSWQETDPRTGE-
UCRIC_NOSS1      WNPLDQQFQCPCHGSRYAPDGSVVRGPAPLPLKIVQVAVI-DNSILISPWTETDPRTGK-
UCRIA_SYNY3      WNGNDQEFQCPCHGSRYHPDGSVARGPAPLPLKIVQVAVV-DDQIFISPWTDLDPRTGE-
                 *:   : : ****** *   * : ****  .* :       .: : .  *   * *    

UCRI_SYNJB       ----------
UCRI_SYNJA       ----------
UCRI_GLOVI       WCNKDPYWVK
UCRIA_NOSS1      ----EPWWS-
UCRIA_TRIV2      ----EPWWS-
UCRI_MASLA       ----KPWWV-
UCRI_THEEB       ----EPWWT-
UCRIB_SYNY3      ----DPWWA-
UCRI_TRIEI       ----KPWWV-
UCRI_SYNE7       ----NPWWA-
UCRI_SYNP6       ----NPWWA-
UCRI_SYNS3       ----KPWWS-
UCRI_SYNPW       ----KPWWA-
UCRI_SYNSC       ----KPWWA-
UCRI_SYNPX       ----KPWWA-
UCRI_SYNS9       ----KPWWA-
UCRI_PROM3       ----KPWWT-
UCRI_PROMM       ----KPWWT-
UCRI_PROM1       ----DPWWG-
UCRI_PROMT       ----DPWWG-
UCRI_PROMS       ----NPWWA-
UCRI_PROM0       ----NPWWA-
UCRI_PROM9       ----NPWWA-
UCRI_PROM5       ----NPWWA-
UCRI_PROMP       ----NPWWA-
UCRI_PROMA       ----KPWWA-
UCRIB_NOSS1      ----KPWWV-
UCRIB_TRIV2      ----KPWWV-
UCRIC_NOSS1      ----KPWWV-
UCRIA_SYNY3      ----KPWWV-