CLUSTAL format seed alignment for MF_01338

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RBL_HALHL        -------------------MASKTYTAGVKDY-RETYWEPDYKIKDSDLLAVFKVTPQPG
RBL_METCA        -------------------MAVKTYNAGVKEY-RETYWDPNYTPADTDLLAVFKITPQPG
RBL_ALKEH        -------------------MSSKSYSAGVKDY-RDTYWEPDYQVKDSDFLACFKVVPQAG
RBL1A_RHOPS      --------------------MLKSYQAGVREY-RETYWDPHYTPKDSDILAVFKVIPQAG
RBL1B_BRASB      -------------------MAEKSYQAGVKEY-RKTYWTPDYVPLDTDLLAVFKIVAQAG
RBL1B_BRASO      -------------------MAEKSYQAGVKEY-RKTYWTPEYVPLDTDLLAVFKIVAQAG
RBL1C_NITHX      -------------------MAVKTYQAGVTQY-RQSYWQPDYVPLDTDILACFKITPQPG
RBL1A_NITWN      -------------------MAVKSYQAGVTQY-RQSYWQPDYMPLDTDILACFKITPQPG
RBL_NITEC        -------------------MAIKTYQAGVKEY-RQTYWQPDYVPLDTDILACFKITPQSG
RBL_CUPMC        -------------------MAAKTYNAGVKEY-RQTYWTPEYTPKDTDLLACFKVTPQPG
RBL1_THIDA       -------------------MAVKTYSAGVKEY-RQTYWMPEYTPLDTDILACFKITPQAG
RBL_NITEU        -------------------MSAKTYNAGVKEY-RHTYWEPHYNVQDTDILACFKIVPQPG
RBL1A_HYDCU      --------------------MAKTYNAGVKEY-RETYWMPEYEPKDSDFLACFKVIPQDG
RBL_PROMS        --------------------MSKKYDAGVKEY-RDTYWTPEYVPLDTDLLACFKCTGQEG
RBL_PROM5        --------------------MSKKYDAGVKEY-RDTYWTPEYVPLDTDLLACFKCTGQEG
RBL_PROM9        --------------------MSKKYDAGVKEY-RDTYWTPEYVPLDTDLLACFKCTGQEG
RBL_PROMP        --------------------MSKKYDAGVKEY-RDTYWTPEYVPLDTDLLACFKCTGQEG
RBL_PROM0        --------------------MSKKYDAGVKEY-RDTYWTPEYVPLDTDLLACFKCTGQEG
RBL_PROMA        --------------------MSKKYDAGVKEY-RDTYWTPDYVPLDTDLLACFKCTGQEG
RBL_PROMM        --------------------MSKKYDAGVKEY-RDTYWTPDYVPLDTDLLACFKCTGQEG
RBL_PROM3        --------------------MSKKYDAGVKEY-RDTYWTPDYVPLDTDLLACFKVTGQEG
RBL_PROM1        --------------------MAKKYDAGVKEY-RDTYFTPDYVPLDTDLLACFKCTGQEG
RBL_PROMT        --------------------MAKKYDAGVKEY-RDTYFTPDYVPLDTDLLACFKCTGQEG
RBL_SYNS3        --------------------MSKKYDAGVKEY-RDTYWTPDYVPLDTDLLACFKCTGQEG
RBL_SYNS9        --------------------MSKKYDAGVKEY-RDTYWTPDYVPLDTDLLACFKCTGQEG
RBL_SYNPW        --------------------MSKKYDAGVKEY-RDTYWTPDYVPLDTDLLACFKCTGQEG
RBL_SYNPX        --------------------MSKKYDAGVKEY-RDTYWTPDYVPLDTDLLACFKCTGQEG
RBL_SYNSC        --------------------MSKKYDAGVKEY-RDTYWTPDYVPLDTDLLACFKCTGQEG
RBL1B_HYDCU      -------------------MASKTFDAGVQDY-QLTYWTPDYTPLDTDLLACFKVVPQDG
RBL_DRIGR        ------------MSPKTETKASVGFKAGVKDY-KLTYYTPDYETKDTDILAAFRVTPQPG
RBL_NANDO        ------------MSPQTETKASVGFKAGVKDY-KLNYYTPDYVTKDTDILAAFRVTPQPG
RBL_PELHO        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPDYETKDTDILAAFRVTPQPG
RBL_PLAOC        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPDYETKDTDILAAFRVTPQPG
RBL_EUCGG        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPDYETKDTDILAAFRVTPQPG
RBL_POPTR        ------------MSPQTETKAGVGFKAGVKDY-KLTYYTPDYETKDTDILAAFRVTPQPG
RBL_POPAL        ------------MSPQTETKTGVGFKAGVKEY-KLNYYTPEYETKDTDILAAFRVTPQPG
RBL_DAUCA        ------------MSPQTETKAGVGFKAGVKDY-KLTYYTPDYETKDTDILAAFRVTPQPG
RBL_HELAN        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_LACSA        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_OENEH        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_CAPBU        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_ARATH        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_DRANE        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_LEPVR        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_LOBMA        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_CRUWA        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_ARAHI        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_BARVE        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_AETCO        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_AETGR        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_NASOF        ------------MSPQTETKANVGFKAGVKEY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_OLIPU        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_VITVI        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPEYETKPTDILAAFRVTPQPG
RBL_CALFG        ------------MSPKTETKAGVGFKAGVKDY-KLTYYTPDYETKDTDILAAFRVTPQPG
RBL_LOTJA        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPDYETKDTDILAAFRVTPQPG
RBL_MORIN        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPEYEVKDTDILAAFRVTPQPG
RBL_CUCSA        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_SOYBN        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPDYETKDTDILAAFRVTPQPG
RBL_PHAVU        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPDYETKDTDILAAFRVTPQPG
RBL_PANGI        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPDYDPKDTDILAAFRVTPQPG
RBL_SPIOL        ------------MSPQTETKASVEFKAGVKDY-KLTYYTPEYETLDTDILAAFRVSPQPG
RBL_CITSI        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPDYVTKDTDILAAFRVTPQPG
RBL_ATRBE        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYQTKDTDILAAFRVTPQPG
RBL_NICSY        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYQTKDTDILAAFRVTPQPG
RBL_TOBAC        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYQTKDTDILAAFRVTPQPG
RBL_NICTO        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYQTKDTDILAAFRVTPQPG
RBL_SOLBU        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYQTKDTDILAAFRVTPQPG
RBL_SOLLC        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYQTKDTDILAAFRVTPQPG
RBL_SOLTU        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYQTKDTDILAAFRVTPQPG
RBL_COFAR        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_JASNU        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_LIRTU        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYETKDTDILAAFRVTPQLG
RBL_GOSBA        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYEVKDTDILAAFRVTPQPG
RBL_GOSHI        ------------MSPQTETKASVGFKAGVKEY-KLTYYTPEYEVKDTDILAAFRVTPQPG
RBL_PIPCE        ------------MSPKTETKAYVGFKAGVKDY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_ACOCL        ------------MSPQTETKAGVGFKAGVKDY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_PHAAO        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPDYETKDTDILAAFRVTPQPG
RBL_HORVU        ------------MSPQTETKAGVGFQAGVKDY-KLTYYTPEYETKDTDILAAFRVSPQPG
RBL_WHEAT        ------------MSPQTETKAGVGFKAGVKDY-KLTYYTPEYETKDTDILAAFRVSPQPG
RBL_AGRST        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPEYETKDTDILAAFRVSPQPG
RBL_ORYNI        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_ORYSA        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_ORYSI        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_ORYSJ        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPEYETKDTDILAAFRVTPQPG
RBL_SACHY        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPEYETKDTDILAAFRVTPQLG
RBL_SACOF        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPEYETKDTDILAAFRVTPQLG
RBL_SORBI        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPEYETKDTDILAAFRVTPQLG
RBL_MAIZE        ------------MSPQTETKASVGFKAGVKDY-KLTYYTPEYETKDTDILAAFRVTPQLG
RBL_AMBTC        ------------MSPKTETKASAGFKAGVKDY-RLTYYTPDYETLATDILAAFRVTPQPG
RBL_NYMAL        ------------MSPKTETKASVGFKAGVKDY-RLTYYTPEYETLATDILAAFRVTPQPG
RBL_PINKO        ------------MSPKTETKASVGFKAGVKDY-RLTYYTPEYQTKDTDILAAFRVTPQPG
RBL_PINTH        ------------MSPKTETKASVGFKAGVKDY-RLTYYTPEYQTKDTDILAAFRVTPQPG
RBL_HUPLU        ------------MSPQTETKTSVGFKAGVRDY-RLTYYTPNYKTKDTDILAAFRMTPQPG
RBL_CHAVU        ------------MSPQTETKTSAGFKAGVKDY-RLTYYTPEYKTKDTDILAAFRVTPQPG
RBL_PHYPA        ------------MSPRPEIKAGVGFKAGVKDY-RLTYYTPDYQTKDTDILAAFRMTPQPG
RBL_ANGEV        ------------MSPQTETKTGFGFKAGVKDY-RLNYYTPEYDTKDTDILAAFRMTPQPG
RBL_ADICA        ------------MSPQTETKAGVGFKAGVKDY-RLTYYTPEYKTKDTDILAAFRMTPQPG
RBL_PSINU        ------------MSPQTETKASSGFKAGVKDY-RLTYYTPDYKVSDTDILAAFRMTPQPG
RBL_ANTAG        ------------MSPQTETKAGVGFKAGVKDY-RLTYYTPDYETKDTDILAAFRMTPQPG
RBL_MARPO        ------------MSPQTETKAGVGFKAGVKDY-RLTYYTPDYETKDTDILAAFRMTPQPG
RBL_CHAGL        ------------MSPQTETKTGAGFKAGVKDY-RLTYYTPEYETKDTDILAAFRMTPQAG
RBL_STAPU        ------------MSPQTETKAGAGFKAGVKDY-RLTYYTPDYETKETDVLAAFRMTPQPG
RBL_ZYGCR        ------------MSPQTETKAGVGFKAGVKDY-RLTYYTPDYETKETDILAAFRMTPQAG
RBL_CHLAT        ------------MSPQTETRTGTGFKAGVKDY-RLTYYTPDYVTKETDILAAFRMTPQPG
RBL_TETOB        ------------MVPQTETRAGAGFKAGVKDY-RLTYYTPDYVVKDTDILAAFRMTPQPG
RBL_STIHE        ------------MVPQTETKAGAGFKAGVKDY-RLTYYTPDYMVKDTDILAAFRMTPQPG
RBL_OLTVI        -------------MPTTETKTGAGFKAGVKDY-RLTYYTPDYQVKETDILAAFRMTPQPG
RBL_CHLRE        ------------MVPQTETKAGAGFKAGVKDY-RLTYYTPDYVVRDTDILAAFRMTPQLG
RBL_NEPOL        ------------MAPQTETQAKAGFKAGVKDY-RLTYYTPDYQVKDTDILAAFRMTPQPG
RBL_OSTTA        ------------MAPQTETKTGTGFQAGVKDY-RLTYYTPDYQVKETDILAAFRMTPQPG
RBL_TUPAK        ------------MAPQTETKAGTGFKAGVKDY-RLTYYTPDYQVKDTDILAAFRMTPQPG
RBL_CHLVU        ------------MSPQTETKARVGFKAGVKDY-RLTYYTPDYQPKDTDILAAFRMTPQPG
RBL_EUGLO        ------------MPAQTESKTTTEFKAGVKDY-KITYYTPDYKVSDTDVLAAFRMTPQTG
RBL_EUGGR        ------------MSPQTETKTGAGFKAGVKDY-RLTYYTPDYQVSETDILAAFRMTPQPG
RBL_MESVI        ------------MSPKTETKAGTGFKAGVKDY-KLTYYTPDYVVKDTDILAAFRMTPQPG
RBL_CYAPA        ------------MSSQARTQTRAGFKAGVKDY-RLTYYTPEYTPKETDILAAFRMTPQPG
RBL_BIGNA        -------------MIFAKKTEAAGFKAGVKDY-RLTYYTPDYKVKDTDILAAFRVTPQPG
RBL_TRIEI        -----------MSYAKTQTQSKSGYQAGVKDY-KLTYYTPDYIPKDTDLLAAFRMSPQPG
RBL_SYNY3        -----------------MVQAKAGFKAGVQDY-RLTYYTPDYTPKDTDLLACFRMTPQPG
RBL_SYNJA        -------------MAYSATQTKKGYQAGVKDY-RLTYYTPDYTPKDTDVLACFRVTPQPG
RBL_SYNJB        -------------MAYSATQSKSGYQAGVKDY-RLTYYTPDYTPKDTDVLACFRVTPQPG
RBL_SYNP6        ---------------MPKTQSAAGYKAGVKDY-KLTYYTPDYTPKDTDLLAAFRFSPQPG
RBL_SYNE7        ---------------MPKTQSAAGYKAGVKDY-KLTYYTPDYTPKDTDLLAAFRFSPQPG
RBL_NOSS1        -----------MSYAQTKTQTKSGYKAGVQDY-RLTYYTPDYTPKDTDILAAFRVTPQPG
RBL_TRIV2        -----------MSYAQTKTQTKSGYKAGVQDY-RLTYYTPDYTPKDTDILAAFRVTPQPG
RBL_THEEB        -----------MAYTQSKSQ-KVGYQAGVKDY-RLTYYTPDYTPKDTDILAAFRVTPQPG
RBL_GLOVI        -----------MSYT--KTQAKAGYQAGVKDY-RLTYYTPDYTPKDTDVLAAFRVTPQPG
RBL1C_BRASB      ---------MND--QSITVRGKDRYKSGVMEYKKMGYWEPSYQPKDTDVIALFRVTPQDG
RBL1A_BRASO      ---------MND--QSITVRGKDRYKSGVMEYKKMGYWEPSYQPNDTDVIALFRVTPQDG
RBL_BRADU        ---------MNA--HTGTVRGKERYRSGVMEYKRMGYWEPDYTPKDTDVIALFRVTPQEG
RBL_OLICO        ---------MND--QSMTIRGKDRYKSGVMAYKKMGYWEPDYVPKDTDVIALFRVTPQDG
RBL1A_BRASB      ---------MNEALKSLTVTGKERYKSGVLEYKRMGYWEPDYEPKDTDVIALFRVTPQNG
RBL_RHOP5        ---------MNE---SVTVRGKDRYKSGVMEYKKMGYWEPDYEPKDTDVIALFRVTPQDG
RBL_RHOPB        ---------MNE---SVTIRGKDRYKSGVMEYKKMGYWEPDYEPKDTDIIALFRVTPQDG
RBL_RHOP2        ---------MNE---SVTVRGKDRYKSGVMEYKKMGYWEPDYEPKDTDVIALFRVTPQDG
RBL1B_RHOPS      ---------MND---SITVRGKDRYKSGVMEYKKMGYWEPDYVPKDTDVIALFRVTPQDG
RBL1_RHOPA       ---------MNE---AVTIRGKERYKSGVMEYKKMGYWEPDYEPKDTDVIALFRVTPQDG
RBL1A_NITHX      ------MNVLNE--KSLTVRGKDRYKSGVMSYKKMGYWEPDYTPKDTDIICLFRVTPQDG
RBL1B_NITHX      ------MNVLNE--KSLTVRGKDRYKSGVMSYKKMGYWEPDYTPKDTDIICLFRVTPQDG
RBL1B_NITWN      ------MNVQNE--KSMTVRGKDRYKSGVMSYKKMGYWEPDYTPKDTDVICLFRVTPQDG
RBL_NITMU        ---------MSE----AIT-GAERYKSGVIPYKKMGYWEPDYVPKDTDIIAMFRITPQAG
RBL_NITOC        -------MGKSE----TIAEGKDRYQAGVIPYKKMGYWEPDYQPKDTDIIAMFRITPQPG
RBL_PORPU        ---------MSQSVESRTRIKSERYESGVIPYAKMGYWDADYVIKETDILALFRITPQPG
RBL_PYRYE        ---------MSQSVESRTRIKSERYESGVIPYAKMGYWDADYVIKETDILALFRITPQPG
RBL_GRATL        ---------MSQSVEERTRIKNQRYESGVIPYAKMGYWDPNYVVKETDVLALFRVTPQPG
RBL_EMIHU        ---------MSQAVESRTRIKSERYESGVIPYAKMGYWDPEYVIKDTDILALFRCTPQPG
RBL_CYAM1        ---------MAQSVQERTRLKNKRYESGVIPYAKMGYWNPNYVVKDSDMLALFRVTPQPG
RBL_CYACA        ---------MAQSVQERTRLKNKRYESGVIPYAKMGYWDPNYVVKDTDILALFRVTPQPG
RBL_TRICV        ---------MSQSVSERTRIKSDRYESGVIPYAKMGYWDASYTVQDTDVLALFRITPQPG
RBL_THAPS        ---------MSQSVSERTRIKSDRYESGVIPYAKMGYWDAAYTVKDTDVLALFRITPQPG
RBL_PHATC        ---------MSQSVSERTRIKSDRYESGVIPYAKMGYWDAAYAVKNTDVLALFRITPQPG
RBL1C_CUPNH      --------MNAPESVQAKP--RKRYDAGVMKYKEMGYWDGDYEPKDTDLLALFRITPQDG
RBL1P_CUPNH      --------MNAPESVQAKP--RKRYDAGVMKYKEMGYWDGDYEPKDTDLLALFRITPQDG
RBL1B_METPP      --------MNEPTQITDT---KKRYAAGVLKYAQMGYWNGDYVPKDTDILALFRITPQDG
RBL1A_METPP      --------MNKPMEDAAITDVKKRYSAGVLKYRQMGYWMPDYVPKDTDTICLFRITPQDG
RBL_RHOS1        ----------MDTKTTEIKGKE-RYKAGVLKYAQMGYWDGDYVPKDTDVLALFRITPQEG
RBL_RHOS4        ----------MDTKTTEIKGKE-RYKAGVLKYAQMGYWDGDYVPKDTDVLALFRITPQEG
RBL1_RHIME       ---------MNADAKTEIKGRE-RYKAGVLKYAQMGYWNGDYEPKDTDLIALFRITPQDG
RBL_PARDP        ---------MNEMSKSEITDKKKRYAAGVLKYAQMGYWDGDYQPKDTDILALFRITPQDG
RBL_PARXL        MNDFSQPVIDSIHKPRDAANPRERYAAGVMKYREMGYWQPDYAPKDTDVIALFRITPQPG
                                         : :**  * .  *:   *    :* :. *:   * *

RBL_HALHL        VDREEAAAAVAAESSTGTWTTVWTDLLTDLEHYKGRAYKVEDVPGD------DEAFYAFI
RBL_METCA        VPREEAAAAVAAESSTGTWTTVWTDLLTDLDYYKGRAYRIEDVPGQ------DEQFYAFI
RBL_ALKEH        VPREEAAAAVAAESSTGTWTTVWTDLLTDLDYYKGRAYKIEDVPGD------DEAFYAFI
RBL1A_RHOPS      VPREEAAAAVCAESSTATWTTVWTDLLTDLDYYKGRAYAIEDVPGD------DEAFYAFV
RBL1B_BRASB      VPREEAAAAVAAESSTGTWTTVWTDLLTDLDYYKGRAYRIEPVPGD------DNAFYAFI
RBL1B_BRASO      VPREEAAAAVAAESSTGTWTTVWTDLLTDLDYYKGRAYRIEPVPGD------DNAFYAFI
RBL1C_NITHX      VDREEAAAAVAAESSCGTWTTVWTDLLTDLDYYKGRAYRLEDVPGD------DTCYYAFI
RBL1A_NITWN      VDREEAAAAVAAESSCGTWTTVWTDLLTDLDYYKGRAYRLEDVPGD------DTCYYAFI
RBL_NITEC        VDREEAAAAVAAESSCGTWTTVWTDLLTDLDYYKGRAYRIEDVPGD------DARFYAFV
RBL_CUPMC        VAREEVAAAVAAESSTGTWTTVWTDLLTDLDYYKGRAYRIEDVPGD------DTCFYAFV
RBL1_THIDA       VDREEAAAAVAAESSTGTWTTVWTDLLTDLDYYKGRAYAIEDVPGD------DTCFYAFI
RBL_NITEU        VDREEAAAAVAAESSTGTWTTVWTDLLTDLDYYKGRSYRIEDVPGD------DSSFYAFI
RBL1A_HYDCU      VPREEIAAAVAAESSTGTWTTVWTDLLTDLDYYKGRAYKIEDVPGD------DAAFYAFI
RBL_PROMS        VPREEVAAAVAAESSTGTWSTVWSELLTDLEFYKGRCYRIEDVPGD------PEAFYAFI
RBL_PROM5        VPREEVAAAVAAESSTGTWSTVWSELLTDLEFYKGRCYRIEDVPGD------PEAFYAFI
RBL_PROM9        VPREEVAAAVAAESSTGTWSTVWSELLTDLEFYKGRCYRIEDVPGD------PEAFYAFI
RBL_PROMP        VPREEVAAAVAAESSTGTWSTVWSELLTDLEFYKGRCYRIEDVPGD------PEAFYAFI
RBL_PROM0        VPREEVAAAVAAESSTGTWSTVWSELLTDLEFYKGRCYRIEDVPGD------PEAFYAFI
RBL_PROMA        VPREEVAAAVAAESSTGTWSTVWSELLTDLEFYKGRCYRIEDVPGD------KESFYAFI
RBL_PROMM        VPREEVAAAVAAESSTGTWSTVWSELLTDLEFYKGRCYRIEDVPGD------KESFYAFI
RBL_PROM3        VPREEVAAAVAAESSTGTWSTVWSELLTDLEFYKGRCYRIEDVPGD------KESFYAFI
RBL_PROM1        VPKEEVAAAVAAESSTGTWSTVWSELLVDLEFYKGRCYRIEDVPGD------KDAFYAFI
RBL_PROMT        VPKEEVAAAVAAESSTGTWSTVWSELLVDLEFYKGRCYRIEDVPGD------KDAFYAFI
RBL_SYNS3        VPKEEVAAAVAAESSTGTWSTVWSELLTDLDFYKGRCYRIEDVPGD------KESFYAFI
RBL_SYNS9        VPKEEVAAAVAAESSTGTWSTVWSELLTDLDFYKGRCYRIEDVPGD------KEAFYAFI
RBL_SYNPW        VPKEEVAAAVAAESSTGTWSTVWSELLTDLDFYKGRCYRIEDVPGD------KESFYAFI
RBL_SYNPX        VPKEEVAAAVAAESSTGTWSTVWSELLTDLDFYKGRCYRIEDVPGD------KESFYAFI
RBL_SYNSC        VPKEEVAAAVAAESSTGTWSTVWSELLTDLDFYKGRCYRIEDVPGD------KESFYAFI
RBL1B_HYDCU      VPREEAAAAVAAESSTGTWTTVWTDLLTDMEFYKGRCYRIEDVPGD------KNAFYAFI
RBL_DRIGR        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGE------EDQYIAYV
RBL_NANDO        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGE------DNQYICYV
RBL_PELHO        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGE------ENQYIAYV
RBL_PLAOC        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGE------ENQYIAYV
RBL_EUCGG        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGD------ENQYICYV
RBL_POPTR        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVAGE------ENQFIAYV
RBL_POPAL        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVAGE------ENQFIAYV
RBL_DAUCA        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYGIEPVAGE------ENQFIAYV
RBL_HELAN        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYGLEPVPGE------DNQFIAYV
RBL_LACSA        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYGIEPVPGE------ENQYIAYV
RBL_OENEH        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGE------ENQYICYV
RBL_CAPBU        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGE------ETQFIAYV
RBL_ARATH        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGE------ETQFIAYV
RBL_DRANE        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGE------ETQFIAYV
RBL_LEPVR        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGE------ETQFIAYV
RBL_LOBMA        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGE------ETQFIAYV
RBL_CRUWA        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGE------ETQFIAYV
RBL_ARAHI        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGE------ETQFIAYV
RBL_BARVE        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGE------ETQFIAYV
RBL_AETCO        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGE------ESQFIAYV
RBL_AETGR        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGE------ESQFIAYV
RBL_NASOF        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGE------ETQFIAYV
RBL_OLIPU        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGE------ETQFIAYV
RBL_VITVI        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGE------ESQFIAYV
RBL_CALFG        VPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGE------ESQFIAYV
RBL_LOTJA        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGE------ESQFIAYV
RBL_MORIN        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVAGE------ESQFIAYV
RBL_CUCSA        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYGIEPVAGE------ENQYIAYV
RBL_SOYBN        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYGLEPVAGE------ENQYIAYV
RBL_PHAVU        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGE------ENQFIAYV
RBL_PANGI        VPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYKIEPVAGE------ETQFIAYV
RBL_SPIOL        VPPEEAGAAVAAESSTGTWTTVWTDGLTNLDRYKGRCYHIEPVAGE------ENQYICYV
RBL_CITSI        VPPEEAGAAVAAESSTGTWTAVWTDGLTSLDRYKGRCYNIEPVAGE------ENQYICYV
RBL_ATRBE        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGE------KDQYIAYV
RBL_NICSY        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGE------KDQYIAYV
RBL_TOBAC        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGE------KDQYIAYV
RBL_NICTO        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGE------KDQYIAYV
RBL_SOLBU        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGE------KDQYIAYV
RBL_SOLLC        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGE------KDQYIAYV
RBL_SOLTU        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGE------KDQYIAYV
RBL_COFAR        VPPEEAGAAVAAESSTGTWTAVWTDGLTSLDRYKGRCYHIEPVPGE------ENQYIAYV
RBL_JASNU        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGE------TDQYICYV
RBL_LIRTU        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGE------TDQYIVYV
RBL_GOSBA        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGE------EDQYICYV
RBL_GOSHI        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGE------EDQYICYV
RBL_PIPCE        VPPEEAGAAVAAESSTGTWTSVWTDGLTSLDRYKGRCYDIEPVAGE------ENQYICYV
RBL_ACOCL        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGE------QNQYIAYV
RBL_PHAAO        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEVVVGE------ENQYIAYV
RBL_HORVU        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGE------DSQWICYV
RBL_WHEAT        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGE------DSQWICYV
RBL_AGRST        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGE------DSQWICYV
RBL_ORYNI        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGE------DNQYIAYV
RBL_ORYSA        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGE------DNQYIAYV
RBL_ORYSI        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGE------DNQYIAYV
RBL_ORYSJ        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGE------DNQYIAYV
RBL_SACHY        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGD------PDQYICYV
RBL_SACOF        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGD------PDQYICYV
RBL_SORBI        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGD------PDQYICYV
RBL_MAIZE        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGD------PDQYICYV
RBL_AMBTC        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGE------ENQYIAYV
RBL_NYMAL        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGE------ENQYIAYV
RBL_PINKO        VPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGE------ENQFIAYV
RBL_PINTH        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGE------ETQFIAYV
RBL_HUPLU        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYEIEAVTGE------KNQFIAYV
RBL_CHAVU        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVAGE------ENQFIAYV
RBL_PHYPA        VPAEECGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYAIEPVAGE------ENQYIAYV
RBL_ANGEV        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVAGE------ENQYIAYV
RBL_ADICA        VPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVAGE------ENQYIAYV
RBL_PSINU        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYGIEPVAGE------ENQYIAYV
RBL_ANTAG        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVAGE------ENQYIAYV
RBL_MARPO        VPAEEAGNAVAAESSTGTWTTVWTDGLTNLDRYKGRCYDIDPVPGE------ENQYIAYV
RBL_CHAGL        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVAGE------DNQYIAYV
RBL_STAPU        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGE------ENQYIAYV
RBL_ZYGCR        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGE------ENQYIVYV
RBL_CHLAT        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVAGE------DNQYIAYV
RBL_TETOB        VPPEECGAAVAAESSTGTWTTVWTDGLTTLDRYKGRCYDIEPVPGE------DNQYIAYV
RBL_STIHE        VPPEECGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVAGE------DNQYIAYV
RBL_OLTVI        VPPEECGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDLEPVPGE------ENQYIAYI
RBL_CHLRE        VPPEECGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGE------DNQYIAYV
RBL_NEPOL        VPPEECGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDLEPVAGE------DNQYIAYV
RBL_OSTTA        VPAEECGAAVAAESSTGTWTTVWTDGLTQLDRYKGRCYDLEPVPGE------DNQFIAYV
RBL_TUPAK        VPVEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGE------DNQYIAYI
RBL_CHLVU        VPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGE------ENQYIAYI
RBL_EUGLO        VTPEECGAAVAAESSTGTWTTVWTDGLTQLDRYKGRCYDIEPVYGE------CDQYIAYI
RBL_EUGGR        VPAEECGAAVAAESSTGTWTTVWTDGLTQLDRYKGRCYDLEPVPGE------SNQYIAYV
RBL_MESVI        VPPEECGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDLEPVAGE------ENQYIAYV
RBL_CYAPA        VPPEECAAAVAAESSTGTWTTVWTDGLTSLDRYKGRSYGFEPVPGE------ENQYICYV
RBL_BIGNA        VPPEEAAAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYFIETFEGQK-----DNQFICYI
RBL_TRIEI        VPPEEAGAAVAAESSTGTWTTVWTDLLTDLDRYKGRCYDIESVPGE------DNQYICYV
RBL_SYNY3        VPAEEAAAAVAAESSTGTWTTVWTDNLTDLDRYKGRCYDLEAVPNE------DNQYFAFI
RBL_SYNJA        VPPEEAGAAVAAESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVPGE------ENQYFCFV
RBL_SYNJB        VPPEEAGAAVAAESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVPGE------DNQYFCFV
RBL_SYNP6        VPADEAGAAIAAESSTGTWTTVWTDLLTDMDRYKGKCYHIEPVQGE------ENSYFAFI
RBL_SYNE7        VPADEAGAAIAAESSTGTWTTVWTDLLTDMDRYKGKCYHIEPVQGE------ENSYFAFI
RBL_NOSS1        VPFEEAAAAVAAESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVPGE------DNQFIAYI
RBL_TRIV2        VPFEEAAAAVAAESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVPGE------DNQFIAYI
RBL_THEEB        VPFEEAAAAVAAESSTGTWTTVWTDLLTDLDRYKGCCYDIEPLPGE------DNQFIAYI
RBL_GLOVI        VPIEEAGAAVAAESSTGTWTTVWTDGLTELDRYKGRCYDIEPVPGE------DNQWICYI
RBL1C_BRASB      VDPVEACAAVAGESSTATWTVVWTDRLTAAEKYRAKCYRVEPVPGS------PGSYFAYI
RBL1A_BRASO      VDPVEACAAVAGESSTATWTVVWTDRLTAAEKYRAKCYRVEPVPGS------PGSYFAYI
RBL_BRADU        VDPIEASAAVAGESSTATWTVVWTDRLTAAEKYRAKCHRVDPVPGT------PGSYFAYI
RBL_OLICO        VDPIEAAAAVAGESSTATWTVVWTDRLTAAEKYRAKCYRVDPVPNS------PGQYFAYI
RBL1A_BRASB      VDPIEASAAVAGESSTATWTVVWTDRLTAAEKYRAKCYRVDPVPNT------PGSYFAYI
RBL_RHOP5        VDPIEASAAVAGESSTATWTVVWTDRLTAAEKYRAKCYRVDPVPNS------PGQYFAYI
RBL_RHOPB        VDPTEASAAVAGESSTATWTVVWTDRLTAAEKYRAKCYRVDPVPNS------PGQFFAYI
RBL_RHOP2        VDPIEASAAVAGESSTATWTVVWTDRLTAAEKYRAKCYRVDPVPNS------PGQYFAYI
RBL1B_RHOPS      VDPIEASAAVAGESSTATWTVVWTDRLTAAEKYRAKCYRVDPVPNS------PGQYFAYI
RBL1_RHOPA       VDPIEAAAAVAGESSTATWTVVWTDRLTAAEKYRAKCYRVDPVPNS------LGQYFAYI
RBL1A_NITHX      VDPIEAAAAVAGESSTATWTVVWTDRLTAAEKYRAKCYRVDPVPGA------EGQYFAYI
RBL1B_NITHX      VDPIEAAAAVAGESSTATWTVVWTDRLTAAEKYRAKCYRVDPVPGA------EGQYFAYI
RBL1B_NITWN      VDPIEASAAVAGESSTATWTVVWTDRLTAAEKYRAKCYRVDPVPGA------EGQYFAYI
RBL_NITMU        VEPEEAAAAVAGESSTATWTVVWTDRLTACELYRAKAFRTDPVPNTGEGTKTEQQYFAYI
RBL_NITOC        VDPEEAAAAVAGESSTATWTVVWTDRLTDCELYRAKAYRADLVPNTGEGTKNEAQYFAYI
RBL_PORPU        VDPIEASAAIAGESSTATWTVVWTDLLTACDLYRAKAYRVDPVPNV------ADQYFAYI
RBL_PYRYE        VDPIEASAAIAGESSTATWTVVWTDLLTACDLYRAKAYRVDPVPNV------ADQYFAYI
RBL_GRATL        VDPVEASAAVAGESSTATWTVVWTDLLTACDLYRAKAYKVDAVPNT------TDQYFAFI
RBL_EMIHU        VDPVEAAAALAGESSTATWTVVWTDLLTACDLYRAKAFRVDPVPSA------ADTYFCYI
RBL_CYAM1        VDPIEAAAAVAGESSTATWTVVWTDLLTACDVYRAKAYRVDPVPTA------PDQYFVYI
RBL_CYACA        VDPIEASAAVAGESSTATWTVIWCDLLTACDVYRAKAYRVDQVPNS------PDQYFAYI
RBL_TRICV        VDPVEAAAAVAGESSTATWTVVWTDLLTACERYRAKAYRVDPVPNT------TDQYFAFI
RBL_THAPS        VDPVEAAAAVAGESSTATWTVVWTDLLTACERYRAKAYRVDPVPSA------TDQYFAFI
RBL_PHATC        VDPVEAAAAVAGESSTATWTVVWTDLLTACDRYRAKAYRVDPVPNT------TDQYFAFI
RBL1C_CUPNH      VDPVEAAAAVAGESSTATWTVVWTDRLTACDMYRAKAYRVDPVPNNPE------QFFCYV
RBL1P_CUPNH      VDPVEAAAAVAGESSTATWTVVWTDRLTACDMYRAKAYRVDPVPNNPE------QFFCYV
RBL1B_METPP      VDPIEAAAAVAGESSTATWTVVWTDRLTACDMYRAKAYKVEPVPNNPG------QYFCYV
RBL1A_METPP      VDPVEAAAAVAGESSTATWTVVWTDRLTACDSYRAKAYKVEPVPGIPG------QFFAWV
RBL_RHOS1        VDPVEAAAAVAGESSTATWTVVWTDRLTACDSYRAKAYRVEPVPGTPG------QYFCYV
RBL_RHOS4        VDPVEAAAAVAGESSTATWTVVWTDRLTACDSYRAKAYRVEPVPGTPG------QYFCYV
RBL1_RHIME       VDPIEAAAAVAGESSTATWTVVWTDRLTACDQYRAKAYRVDPVPGTPG------QYFCYV
RBL_PARDP        VDPIEAAAAVAGESSTATWTVVWTDRLTACDQYRAKAYKVEPVPGQEG------QYFCYV
RBL_PARXL        VDPEEAAAAVAGESSTATWTVVWTDRLTACDIYRAKAYRVDPVPASNAA---EPQYFAYI
                 *   *   *:..*** .**: :* : *.  : *:. ..  : .            :  ::

RBL_HALHL        AYPIDLFEEGSIVNVFTSLVGNVFGFKAVRALRLEDVRFPLHFVMTCPGPPNGIQVERDK
RBL_METCA        AYPIDLFEEGSVVNVFTSLVGNVFGFKAVRGLRLEDVRFPLAYVMTCGGPPHGIQVERDI
RBL_ALKEH        AYPIDLFEESSVVNVFTSLVGNVFGFKAVRSLRLEDVRIPLAYVMTCNGPPHGIQVERDK
RBL1A_RHOPS      AYPMGLFEEGSIVNVFTSLVGNVFGFKAVRALRLEDVRFPLWFVTTCDGPPHGIQVERDK
RBL1B_BRASB      AYPIDLFEEGSVVNVLTSLVGNVFGFKAVRSLRLEDIRFPLAYVKTCGGPPNGIQLERDR
RBL1B_BRASO      AYPIDLFEEGSVVNVLTSLVGNVFGFKAVRSLRLEDIRFPLAYVKTCGGPPNGIQLERDR
RBL1C_NITHX      AYPIDLFEEGSVVNVFTSLVGNVFGFKAVRALRLEDLRFPIAYVKTCGGPPHGIQVERDR
RBL1A_NITWN      AYPIDLFEEGSVVNVFTSLVGNVFGFKAVRALRLEDLRFPIAYVKTCGGPPHGIQVERDK
RBL_NITEC        AYPIDLFEEGSVVNVFTSLVGNVFGFKAIRALRLEDVRFPIAYVKTCGGPPSGIQVERDK
RBL_CUPMC        AYPIDLFEEGSIVNVLTSLVGNVFGFKALRALRLEDVRFPIAYVMTCGGPPHGIQVERDI
RBL1_THIDA       AYPIDLFEEGSVVNVFTSLVGNVFGFKAVRALRLEDVRFPIAYVKTCGGPPHGIQVERDV
RBL_NITEU        AYPIDLFEEGSVVNVLTSLTGNVFGFKAVRSLRLEDVRFPIAYVKTCGGPPNGIQVERDI
RBL1A_HYDCU      AYPIDLFEEGSVVSVMTSLVGNVFGFKALRACRLEDIRFPLAYVMTCGGPPHGIQVERDK
RBL_PROMS        AYPLDLFEEGSITNVLTSLVGNVFGFKALRHLRLEDIRFPIAFIKTCGGPPNGIVVERDR
RBL_PROM5        AYPLDLFEEGSITNVLTSLVGNVFGFKALRHLRLEDIRFPIAFIKTCGGPPNGIVVERDR
RBL_PROM9        AYPLDLFEEGSITNVLTSLVGNVFGFKALRHLRLEDIRFPIAFIKTCGGPPNGIVVERDR
RBL_PROMP        AYPLDLFEEGSITNVLTSLVGNVFGFKALRHLRLEDIRFPIAFIKTCGGPPNGIVVERDR
RBL_PROM0        AYPLDLFEEGSITNVLTSLVGNVFGFKALRHLRLEDIRFPIAFIKTCGGPPNGIVVERDR
RBL_PROMA        AYPLDLFEEGSITNVLTSLVGNVFGFKALRHLRLEDIRFPMAFIKTCGGPPQGIVVERDR
RBL_PROMM        AYPLDLFEEGSITNVLTSLVGNVFGFKALRHLRLEDIRFPMAFIKTCGGPPNGIVVERDR
RBL_PROM3        AYPLDLFEEGSITNVLTSLVGNVFGFKALRHLRLEDIRFPMAFIKTCGGPPNGIVVERDR
RBL_PROM1        AYPLDLFEEGSITNVLTSLVGNVFGFKALRHLRLEDIRFPMAFIKTCGGPPSGIVVERDR
RBL_PROMT        AYPLDLFEEGSITNVLTSLVGNVFGFKALRHLRLEDIRFPMAFIKTCGGPPSGIVVERDR
RBL_SYNS3        AYPLDLFEEGSITNVLTSLVGNVFGFKALRHLRLEDIRFPIAFIKCCAGPPNGIAVERDR
RBL_SYNS9        AYPLDLFEEGSITNVLTSLVGNVFGFKALRHLRLEDIRFPIAFIKCCAGPPNGIAVERDR
RBL_SYNPW        AYPLDLFEEGSITNVLTSLVGNVFGFKALRHLRLEDIRFPMAFIKSCYGPPNGIQVERDR
RBL_SYNPX        AYPLDLFEEGSITNVLTSLVGNVFGFKALRHLRLEDIRFPMAFIKSCYGPPNGIQVERDR
RBL_SYNSC        AYPLDLFEEGSITNVLTSLVGNVFGFKALRHLRLEDIRFPMAFIKSCYGPPNGIQVERDR
RBL1B_HYDCU      AYPLDLFEEGSVVNVLTSLVGNVFGFKAVRSLRLEDLRFPIAFIKTCGGPPAGIQVERDK
RBL_DRIGR        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYVKTFQGPPHGIQVERDK
RBL_NANDO        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTSYVKTFQGPPHGIQVERDK
RBL_PELHO        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYVKTFQGPPHGIQVERDK
RBL_PLAOC        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDK
RBL_EUCGG        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPSYTKTFQGPPHGIQVERDK
RBL_POPTR        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDK
RBL_POPAL        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYTKTFQGPPHGIQVERDK
RBL_DAUCA        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDK
RBL_HELAN        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYVKTFDGPPHGIQVERDK
RBL_LACSA        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYVKTFQGPPHGIQVERDK
RBL_OENEH        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYVKTFQGPPHGIQVERDK
RBL_CAPBU        AYPLDLFEEGSVTNMFTSIVGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDK
RBL_ARATH        AYPLDLFEEGSVTNMFTSIVGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDK
RBL_DRANE        AYPLDLFEEGSVTNMFTSIVGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDK
RBL_LEPVR        AYPLDLFEEGSVTNMFTSIVGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDK
RBL_LOBMA        AYPLDLFEEGSVTNMFTSIVGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDK
RBL_CRUWA        AYPLDLFEEGSVTNMFTSIVGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDK
RBL_ARAHI        AYPLDLFEEGSVTNMFTSIVGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDK
RBL_BARVE        AYPLDLFEEGSVTNMFTSIVGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDK
RBL_AETCO        AYPLDLFEEGSVTNMFTSIVGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDK
RBL_AETGR        AYPLDLFEEGSVTNMFTSIVGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDK
RBL_NASOF        AYPLDLFEEGSVTNMFTSIVGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDK
RBL_OLIPU        AYPLDLFEEGSVTNMFTSIVGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDK
RBL_VITVI        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDK
RBL_CALFG        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYTKTFLGPPHGIQVERDK
RBL_LOTJA        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPNAYVKTFQGPPHGIQVERDK
RBL_MORIN        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPNAYIKTFQGPPHGIQVERDK
RBL_CUCSA        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYIKTFQGPPHGIQVERDK
RBL_SOYBN        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYIKTFQGPPHGIQVERDK
RBL_PHAVU        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYIKTFQGPPHGIQVERDK
RBL_PANGI        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDK
RBL_SPIOL        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDK
RBL_CITSI        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYTKTFQGPPHGIQVERDK
RBL_ATRBE        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDK
RBL_NICSY        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDK
RBL_TOBAC        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDK
RBL_NICTO        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDK
RBL_SOLBU        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYVKTFQGPPHGIQVERDK
RBL_SOLLC        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDK
RBL_SOLTU        AYPLDLFEEGSVTNMLTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDK
RBL_COFAR        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRVPPAYIKTFQGPPHGIQVERDK
RBL_JASNU        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYIKTFQGPPHGIQVERDK
RBL_LIRTU        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYIKTFQGPPHGIQVERDK
RBL_GOSBA        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRVPTAYIKTFQGPPHGIQVERDK
RBL_GOSHI        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRVPTAYIKTFQGPPHGIQVERDK
RBL_PIPCE        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDK
RBL_ACOCL        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDK
RBL_PHAAO        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPSYSKTFQGPPHGIQVERDK
RBL_HORVU        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPTYSKTFQGPPHGIQVERDK
RBL_WHEAT        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPTYSKTFQGPPHGIQVERDK
RBL_AGRST        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYTKTFQGPPHGIQVERDK
RBL_ORYNI        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPTYSKTFQGPPHGIQVERDK
RBL_ORYSA        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPTYSKTFQGPPHGIQVERDK
RBL_ORYSI        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPTYSKTFQGPPHGIQVERDK
RBL_ORYSJ        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPTYSKTFQGPPHGIQVERDK
RBL_SACHY        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDK
RBL_SACOF        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDK
RBL_SORBI        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDK
RBL_MAIZE        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDK
RBL_AMBTC        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSKSFQGPPHGIQVERDK
RBL_NYMAL        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDK
RBL_PINKO        AYPLDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDK
RBL_PINTH        AYPLDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPPSYSKTFQGPPHGIQVERDK
RBL_HUPLU        AYPLDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFIGPPHGIQVERDK
RBL_CHAVU        AYPLDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPPAYTKTFQGPPHGIQVERDK
RBL_PHYPA        AYPLDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDK
RBL_ANGEV        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQAERDK
RBL_ADICA        AYPLDLFEEGSVTNMLTSIVGNVFGFKALRALRLEDLRIPPAYSKTFLGPPHGIQVERDK
RBL_PSINU        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFMGPPHGIQVERDK
RBL_ANTAG        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDK
RBL_MARPO        AYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYTKTFQGPPHGIQVERDK
RBL_CHAGL        AYPLDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDK
RBL_STAPU        AYPLDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPAAYAKTFQGPPHGIQVERDK
RBL_ZYGCR        AYPLDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDK
RBL_CHLAT        AYPLDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDK
RBL_TETOB        AYPIDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDK
RBL_STIHE        AYPIDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPPAYAKTFQGPPHGIQVERDK
RBL_OLTVI        AYPIDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQAERDR
RBL_CHLRE        AYPIDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFVGPPHGIQVERDK
RBL_NEPOL        AYPLDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRISVAYCKTFQGAPHGIQVERDK
RBL_OSTTA        AYPLDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPVAYCKTFQGAPHGIQTERDK
RBL_TUPAK        AYPLDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPPAYTKTFQGPPHGIQVERDK
RBL_CHLVU        AYPLDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDK
RBL_EUGLO        AYPIELFEEGSVTNLLTSIVGNVFGFKALRALRLEDLRIPACYLKSFWGPPHGIEVERDK
RBL_EUGGR        AYPIDLFEEGSVTNLLTSIVGNVFGFKALRALRLEDLRIPPAYSKTFWGPPHGIQVERDR
RBL_MESVI        AYPIDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDK
RBL_CYAPA        AYPLDLFEEGSVTNMLTSIVGNVFGFKALRALRLEDLRIPVGYSKTFQGPPHGITVERDK
RBL_BIGNA        AYPLDLFEEGSVTNLFTSIVGNVFGFKALRAIRLEDLRIPVAYVKTFEGPPHGIQVERDK
RBL_TRIEI        AYPLDLFEEGSVTNMLTSIVGNVFGFKALRSLRLEDLRIPVAYLKTFQGPPHGITVERDK
RBL_SYNY3        AYPLDLFEEGSVTNVLTSLVGNVFGFKALRALRLEDIRFPVALIKTFQGPPHGITVERDK
RBL_SYNJA        AYPLDLFEEGSVTNMLTSIVGNVFGFKALKALRLEDVRIPVAYLKTFQGPPHGIQVERDK
RBL_SYNJB        AYPLDLFEEGSVTNMLTSIVGNVFGFKALKALRLEDVRIPVAYLKTFQGPPHGIQVERDK
RBL_SYNP6        AYPLDLFEEGSVTNILTSIVGNVFGFKAIRSLRLEDIRFPVALVKTFQGPPHGIQVERDL
RBL_SYNE7        AYPLDLFEEGSVTNILTSIVGNVFGFKAIRSLRLEDIRFPVALVKTFQGPPHGIQVERDL
RBL_NOSS1        AYPLDLFEEGSITNVLTSIVGNVFGFKALRALRLEDIRFPVAYIKTFQGPPHGIQVERDK
RBL_TRIV2        AYPLDLFEEGSITNVLTSIVGNVFGFKALRALRLEDIRFPVAYIKTFQGPPHGIQVERDK
RBL_THEEB        AYPLDLFEEGSVTNMLTSIVGNVFGFKALKALRLEDLRIPVAYLKTFQGPPHGIQVERDK
RBL_GLOVI        AYPLDLFEEGSVTNVLTSLVGNVFGFKALRALRLEDIRFPIALVKTYQGPPHGIVVERDK
RBL1C_BRASB      AYDLDLFEPGSIANLTASIIGNVFGFKPLKALRLEDMRLPVAYVKTFQGPATGIVVERER
RBL1A_BRASO      AYDLDLFEPGSIANLTASIIGNVFGFKPLKALRLEDMRLPVAYVKTFQGPATGIVVERER
RBL_BRADU        AYDLDLFEPGSIANLSASIIGNVFGFKPLKALRLEDMRFPVAYVKTFQGPATGIVVERER
RBL_OLICO        AYDLDLFEPGSISNLTASIIGNVFGFKPLKGLRLEDMRLPVAYVKTFQGPATGIVVERER
RBL1A_BRASB      AYDLDLFEPGSIANLSASIIGNVFGFKPLKALRLEDMRFPVAYVKTFQGPATGIVVERER
RBL_RHOP5        AYDLDLFENGSIANLSASIIGNVFGFKPLKALRLEDMRLPVAYVKTFQGPATGIVVERER
RBL_RHOPB        AYDLDLFENGSIANLSASIIGNVFGFKPLKALRLEDMRLPVAYVKTFQGPATGIVVERER
RBL_RHOP2        AYDLDLFENGSIANLSASIIGNVFGFKPLKALRLEDMRLPVAYVKTFQGPATGIVVERER
RBL1B_RHOPS      AYDLDLFENGSIANLSASIIGNVFGFKPLKALRLEDMRLPIAYVKTFQGPATGIVVERER
RBL1_RHOPA       AYDLDLFEPGSISNLTASIIGNVFGFKPLKALRLEDMRLPIAYVKTFQGPATGIVVERER
RBL1A_NITHX      AYDLDLFESGSISNLTASVIGNVFGFKPLKALRLEDMRLPVAYVKTFKGPPTGIVVERER
RBL1B_NITHX      AYDLDLFEPGSISNLTASVIGNVFGFKPLKALRLEDMRLPVAYVKTFKGPPTGIVVERER
RBL1B_NITWN      AYDLDLFEPGSISNLTASVIGNVFGFKPLKALRLEDMRLPVAYVKTFKGPPTGIVVERER
RBL_NITMU        AYDLDLFEPGSIANLTASIIGNVFGFKAVKALRLEDMRIPVAYLKTFQGPATGIIVERER
RBL_NITOC        AYDLDLFEPGSIANLTASIIGNVFGFKAVKALRLEDMRIPVAYLKTFQGPATGVVVERER
RBL_PORPU        AYDIDLFEEGSIANLTASIIGNVFGFKAVKALRLEDMRMPVAYLKTFQGPATGLIVERER
RBL_PYRYE        AYDIDLFEEGSIANLTASIIGNVFGFKAVKALRLEDMRMPVAYLKTFQGPATGLIVERER
RBL_GRATL        AYDIDLFEEGSIANLTASIIGNVFGFKAVKALRLEDMRIPVAYLKTFQGPATGLIVERER
RBL_EMIHU        AYDIDLFEEGSLANLTASIIGNIFGFKAVKALRLEDMRFPVALLKTYQGPATGVVVERER
RBL_CYAM1        AYDIDLFEEGSIANLTASIIGNVFGFKAVKALRLEDMRIPFSYLKTFQGPATGVIVERER
RBL_CYACA        AYDLDLFEEGSIANLTASIIGNVFGFKALAALRLEDMRIPIGYLKTFQGPATGVVVERER
RBL_TRICV        AYECDLFEEGSLANLTASIIGNVFGFKAVAALRLEDMRIPYAYLKTFQGPATGIVVERER
RBL_THAPS        AYECDLFEEASLSNLTASIIGNVFGFKAISALRLEDMRIPHSYLKTFQGPATGIVVERER
RBL_PHATC        AYECDLFEEGSLANLTASIIGNVFGFKAVSALRLEDMRIPHSYLKTFQGPATGVIVERER
RBL1C_CUPNH      AYDLSLFEEGSIANLTASIIGNVFSFKPIKAARLEDMRFPVAYVKTFAGPSTGIIVERER
RBL1P_CUPNH      AYDLSLFEEGSIANLTASIIGNVFSFKPIKAARLEDMRFPVAYVKTFAGPSTGIIVERER
RBL1B_METPP      AYDLSLFEEGSIANVTASIIGNVFSFKPLKAARLEDMKFPVSYVKTFAGPPTGIVVERER
RBL1A_METPP      AYDIILFEEGSIANMTASLIGNVFSFKPLKAARLEDIRIPVAYVKTFKGPPTGLVVERER
RBL_RHOS1        AYDLILFEEGSIANLTASIIGNVFSFKPLKAARLEDMRFPVAYVKTYKGPPTGIVGERER
RBL_RHOS4        AYDLILFEEGSIANLTASIIGNVFSFKPLKAARLEDMRFPVAYVKTYKGPPTGIVGERER
RBL1_RHIME       AYDLILFEEGSIANLTASIIGNVFSFKPLKAARLEDMRLPVAYVKTFRGPPTGIVVERER
RBL_PARDP        AYDLILFEEGSIANVTASIIGNVFSFKPLLAARLEDMRFPVAYMKTFAGPPTGIVVERER
RBL_PARXL        AYELDLFEEGSVANLTASIIGNVFGFKPLKALRLEDMRIPVAYLKTFQGPPTGIVVERER
                 **   *** .*: .: :*: **:*.**.:   ****::..        *.. *:  **: 

RBL_HALHL        MNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFEFV
RBL_METCA        MNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRQRFDFV
RBL_ALKEH        MDKYGRGLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFV
RBL1A_RHOPS      LDKYGRPMLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFEFC
RBL1B_BRASB      LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENINSQPFMRWQHRFEFV
RBL1B_BRASO      LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENINSQPFMRWQHRFEFV
RBL1C_NITHX      LNKYGRPMLGCTIKPKLGLSAKNYGRACYEALRGGLDFTKDDENINSQPFMRWRDRFDFV
RBL1A_NITWN      LNKYGRPLLGCTIKPKLGLSAKNYGRACYEALRGGLDFTKDDENINSQPFMRWRDRFDFV
RBL_NITEC        MNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGSLDFTKDDENINSQPFMRWRDRFEFV
RBL_CUPMC        MNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWKQRFDFV
RBL1_THIDA       MNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRQRFDFV
RBL_NITEU        LNKYGRAYLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRQRFDFV
RBL1A_HYDCU      MDKYGRPMLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVTSQPFMRWRDRFLFC
RBL_PROMS        LNKYGRPLLGCTIKPKLGLSGKNYGRVVYECLRGGLDLTKDDENINSQPFQRWRERFEFV
RBL_PROM5        LNKYGRPLLGCTIKPKLGLSGKNYGRVVYECLRGGLDLTKDDENINSQPFQRWRERFEFV
RBL_PROM9        LNKYGRPLLGCTIKPKLGLSGKNYGRVVYECLRGGLDLTKDDENINSQPFQRWRERFEFV
RBL_PROMP        LNKYGRPLLGCTIKPKLGLSGKNYGRVVYECLRGGLDLTKDDENINSQPFQRWRERFEFV
RBL_PROM0        LNKYGRPLLGCTIKPKLGLSGKNYGRVVYECLRGGLDLTKDDENINSQPFQRWRERFEFV
RBL_PROMA        LNKYGRPLLGCTIKPKLGLSGKNYGRVVYECLRGGLDLTKDDENINSQPFQRWRDRFEFV
RBL_PROMM        LNKYGRPLLGCTIKPKLGLSGKNYGRVVYECLRGGLDLTKDDENINSQPFQRWRERFEFV
RBL_PROM3        LNKYGRPLLGCTIKPKLGLSGKNYGRVVYECLRGGLDLTKDDENINSQPFQRWRERFEFV
RBL_PROM1        LNKYGRPLLGCTIKPKLGLSGKNYGRVVYECLRGGLDLTKDDENINSQPFQRWRERFEFV
RBL_PROMT        LNKYGRPLLGCTIKPKLGLSGKNYGRVVYECLRGGLDLTKDDENINSQPFQRWRERFEFV
RBL_SYNS3        MNKYGRPLLGCTIKPKLGLSGKNYGRVVYECLRGGLDFTKDDENINSQPFQRWQNRFEFV
RBL_SYNS9        MNKYGRPLLGCTIKPKLGLSGKNYGRVVYECLRGGLDFTKDDENINSQPFQRWQNRFEFV
RBL_SYNPW        MNKYGRPLLGCTIKPKLGLSGKNYGRVVYECLRGGLDFTKDDENINSQPFQRWQNRFEFV
RBL_SYNPX        MNKYGRPLLGCTIKPKLGLSGKNYGRVVYECLRGGLDFTKDDENINSQPFQRWQNRFEFV
RBL_SYNSC        MNKYGRPLLGCTIKPKLGLSGKNYGRVVYECLRGGLDFTKDDENINSQPFQRWQNRFEFV
RBL1B_HYDCU      LNKYGRPMLGCTIKPKLGLSAKNYGRAVYECLRGGLDLTKDDENINSQPFQRWQNRFEFV
RBL_DRIGR        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_NANDO        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_PELHO        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_PLAOC        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_EUCGG        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_POPTR        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_POPAL        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_DAUCA        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_HELAN        LNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_LACSA        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_OENEH        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_CAPBU        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_ARATH        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_DRANE        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_LEPVR        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_LOBMA        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_CRUWA        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_ARAHI        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_BARVE        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_AETCO        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_AETGR        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_NASOF        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_OLIPU        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_VITVI        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_CALFG        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_LOTJA        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_MORIN        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_CUCSA        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_SOYBN        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_PHAVU        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_PANGI        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_SPIOL        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_CITSI        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_ATRBE        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_NICSY        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_TOBAC        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_NICTO        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_SOLBU        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_SOLLC        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_SOLTU        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_COFAR        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFCFC
RBL_JASNU        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_LIRTU        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_GOSBA        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_GOSHI        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_PIPCE        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_ACOCL        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_PHAAO        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_HORVU        LNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFC
RBL_WHEAT        LNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFC
RBL_AGRST        LNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFC
RBL_ORYNI        LNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFC
RBL_ORYSA        LNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFC
RBL_ORYSI        LNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFC
RBL_ORYSJ        LNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFC
RBL_SACHY        LNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFC
RBL_SACOF        LNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFC
RBL_SORBI        LNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFC
RBL_MAIZE        LNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFC
RBL_AMBTC        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_NYMAL        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_PINKO        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFVFC
RBL_PINTH        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFVFC
RBL_HUPLU        SNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFV
RBL_CHAVU        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFV
RBL_PHYPA        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_ANGEV        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFV
RBL_ADICA        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFV
RBL_PSINU        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFV
RBL_ANTAG        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFV
RBL_MARPO        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFV
RBL_CHAGL        INKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFV
RBL_STAPU        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVTSQPFMRWRDRFLFV
RBL_ZYGCR        INKYGRPLLGCTIKPKLGLSAKNYGRAVYEVLRGGLDFTKDDENVTSQPFMRWRDRFLFC
RBL_CHLAT        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_TETOB        LNKYGRGLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFV
RBL_STIHE        INKYGRGLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFTFV
RBL_OLTVI        LNKYGRGLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFV
RBL_CHLRE        LNKYGRGLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFV
RBL_NEPOL        LNKYGRGLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFC
RBL_OSTTA        LNKYGRGLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFV
RBL_TUPAK        LNKYGRGLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVTSQPFMRWRDRFLFC
RBL_CHLVU        LNKYGRGLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFV
RBL_EUGLO        LCKYGRGLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVTSQAFMRWRDRFLFC
RBL_EUGGR        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQSFMRWRDRFLFC
RBL_MESVI        LNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFLFV
RBL_CYAPA        LNKYGRALLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLYV
RBL_BIGNA        LNKYGRALLGCTIKPKLGLSAKNYGRAVYEGLRGGLDFTKDDENVNSQPFMRWRDRFLFV
RBL_TRIEI        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENINSQPFMRWRDRFLFA
RBL_SYNY3        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENINSQPFMRWRDRFLFV
RBL_SYNJA        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYEALRGGLDFTKDDENINSQPFQRWRDRYLFV
RBL_SYNJB        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYEALRGGLDFTKDDENINSQPFQRWRDRYLFV
RBL_SYNP6        LNKYGRPMLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENINSQPFQRWRDRFLFV
RBL_SYNE7        LNKYGRPMLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENINSQPFQRWRDRFLFV
RBL_NOSS1        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENINSAPFQRWRDRFLFV
RBL_TRIV2        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENINSAPFQRWRDRFLFV
RBL_THEEB        LNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENINSQPFQRWRDRFLFV
RBL_GLOVI        INKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENINSQPFMRWRDRFLFV
RBL1C_BRASB      LDKFGRPLLGATVKPKLGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFLYC
RBL1A_BRASO      LDKFGRPLLGATVKPKLGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFLYC
RBL_BRADU        LDKFGRPLLGATVKPKLGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRDRFLYC
RBL_OLICO        LDKFGRPLLGATVKPKLGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFLYC
RBL1A_BRASB      LDKFGRPLLGATVKPKLGLSGRNYGRVVYEALKGGLDFTKDDENTNSQPFMHWRDRFLYC
RBL_RHOP5        MDKFGRPLLGATVKPKLGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFLYC
RBL_RHOPB        MDKFGRPLLGATVKPKLGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFLYC
RBL_RHOP2        MDKFGRPLLGATVKPKLGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFLYC
RBL1B_RHOPS      MDKFGRPLLGATVKPKLGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFLYC
RBL1_RHOPA       MDKFGRPLLGATVKPKLGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFQYC
RBL1A_NITHX      LDKFGRPLLGATVKPKLGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFLYC
RBL1B_NITHX      LDKFGRPLLGATVKPKLGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFLYC
RBL1B_NITWN      LDKFGRPLLGATVKPKLGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFLYC
RBL_NITMU        LDKFGRPLLGATTKPKLGLSGRNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLYC
RBL_NITOC        LDKFGRPLLGATTKPKLGLSGRNYGRVVYEALKGGLDFVKDDENINSQPFMHWRDRFLYC
RBL_PORPU        MDKFGRPFLGATVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMRWRERFLYS
RBL_PYRYE        MDKFGRPFLGATVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMRWRERFLYS
RBL_GRATL        MDKFGRPFLGATVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMRWKERFLYS
RBL_EMIHU        MDKFGRPLLGATVKPKLGLSGKNYGRVVFEGLKGGLDFLKDDENINSQPFMRYRERFLYS
RBL_CYAM1        LNKFGRPLLGCTVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMRWRDRYLYV
RBL_CYACA        LNMFGKPFLGATVKPKLGLSSKNYGRVVYEGLKGGLNFLKDDENINSQPFMRWRERFLYV
RBL_TRICV        LNKYGAPLLGATVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMRWRERFLYC
RBL_THAPS        LNKYGTPLLGATVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMRWRERFLNC
RBL_PHATC        LNKYGIPLLGATVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMRWRERFLYC
RBL1C_CUPNH      LDKFGRPLLGATTKPKLGLSGRNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLFV
RBL1P_CUPNH      LDKFGRPLLGATTKPKLGLSGRNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLFV
RBL1B_METPP      LDKFGRPLLGATTKPKLGLSGRNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLFV
RBL1A_METPP      LDKFGRPLLGATTKPKLGLSGRNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRYLYV
RBL_RHOS1        LDKFGKPLLGATTKPKLGLSGKNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLYV
RBL_RHOS4        LDKFGKPLLGATTKPKLGLSGKNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLYV
RBL1_RHIME       LDKFGKPLLGATTKPKLGLSGKNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRYLYC
RBL_PARDP        LDKFGRPLLGATTKPKLGLSGKNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLYC
RBL_PARXL        LDKYGRPLLGATVKPKLGLSGKNYGRVVYEGLRGGLDFLKDDENINSQAFMHWRDRFLFA
                    :*   **.* *******.:****. :* *:*.*:: ***** .* .* :::.*:   

RBL_HALHL        MEAIQKAEEETGERKGHYLNVTAPTPEEMYKRAEFAKELGAPIIMHDYITAGFCAHQGLA
RBL_METCA        MEAIEKAEAETGERKGHYLNVTAPTPEEMYKRAEYAKEIGAPIIMHDFITGGFCANTGLA
RBL_ALKEH        QEATEKAQQETGERKGHYLNVTAPSPEEMYERAEFAKEIGAPIIMHDFLTGGFCANTGLA
RBL1A_RHOPS      QEAIEKAEQETGERKGHYLNVTAPNMEEIYRRAEFAKEIGSPIIMSDYLTIGWAAHSSLS
RBL1B_BRASB      MEAVHKATSETGERKGHYLNVTAPTPEEMYKRAEFAKSLGAPIIMHDFLTAGFTANTGLA
RBL1B_BRASO      MEAVHKATSETGERKGHYLNVTAPTPEEMYKRAEFAKSLGAPIIMHDFLTAGFTANTGLA
RBL1C_NITHX      MEAVQKAEQETGERKGHYLNVTAPTPEEMYKRAEHAKEIGAPIIMHDYLAGGLCANAGLA
RBL1A_NITWN      MEAVQKAEQETGERKGHYLNVTAPTPEEMYKRAEYAKEIRAPIIMHDYLAGGLCANAGLA
RBL_NITEC        QEATLKAEAETGERKGHYLNVTAPTPEEMYKRAEFAKEIGAPIIMHDYLAGGLCANAGLA
RBL_CUPMC        QEATEKAQRETGERKGHYLNVTAPTPEEMYKRAEYAKEIGAPIIMHDYLTGGFCANTGLA
RBL1_THIDA       MEAIQKSERETGERKGHYLNVTAPTPEEMYKRAEYAKEIGAPIIMHDYITGGFCANTGLA
RBL_NITEU        MEAIHKAERETGERKGHYLNVTAPTPEEMFKRAEYAKELKAPIIMHDYIAGGFCANTGLA
RBL1A_HYDCU      QDAIEKAQAETGERKGHYLNCTAGTPEEMYERAEFAKEIGTPIIMHDYLTGGFTANTGLA
RBL_PROMS        AEAVKLAQQETGEVKGHYLNCTANTPEELYERAEFAKELDMPIIMHDYITGGFTANTGLA
RBL_PROM5        AEAVKLAQQETGEVKGHYLNCTANTPEELYERAEFAKELDMPIIMHDYITGGFTANTGLA
RBL_PROM9        AEAVKLAQQETGEVKGHYLNCTANTPEELYERAEFAKELDMPIIMHDYITGGFTANTGLA
RBL_PROMP        AEAVKLAQQETGEVKGHYLNCTANTPEELYERAEFAKELDMPIIMHDYITGGFTANTGLA
RBL_PROM0        AEAVKLAQRETGEVKGHYLNCTANTPEELYERAEFAKELDMPIIMHDYITGGFTANTGLA
RBL_PROMA        AEAVKLAQQETGEVKGHYLNCTATTPEEMYERAEFAKELDMPIIMHDYITGGFTANTGLA
RBL_PROMM        AEAVKLAQQETGEVKGHYLNCTATTPEEMYERAEFAKELDMPIIMHDYITGGFTANTGLA
RBL_PROM3        AEAVKLAQQETGEVKGHYLNCTATTPEEMYERAEFAKELDMPIIMHDYITGGFTANTGLA
RBL_PROM1        AEAVKLAQQETGEVKGHYLNCTATTPEEMYKRAEFAKELDMPIIMHDYITGGFTANTGLA
RBL_PROMT        AEAVKLAQQETGEVKGHYLNCTATTPEEMYKRAEFAKELDMPIIMHDYITGGFTANTGLA
RBL_SYNS3        AEAIKLAEQETGERKGHYLNVTANTPEEMYERAEFAKELNQPIIMHDFITGGFTANTGLS
RBL_SYNS9        AEAIKLAEQETGERKGHYLNVTANTPEEMYERAEFAKELNQPIIMHDFITGGFTANTGLS
RBL_SYNPW        AEAIKLSEQETGERKGHYLNVTANTPEEMYERAEFAKELGMPIIMHDFITGGFTANTGLS
RBL_SYNPX        AEAIKLSEQETGERKGHYLNVTANTPEEMYERAEFAKELGMPIIMHDFITGGFTANTGLS
RBL_SYNSC        AEAIKLSEQETGERKGHYLNVTANTPEEMYERAEFAKELGMPIIMHDFITGGFTANTGLS
RBL1B_HYDCU      ADAVDKATAETGERKGHYLNVTAGTVEEMMKRAEFAKELGQPIIMHDFLTAGFTANTTLA
RBL_DRIGR        AEALYKAQAETGEIKGHYLNATAGTCEEMMKRAVFARELGVPIVMHDYLTGGFTANTTLA
RBL_NANDO        AEALFKAQAETGEIKGHYLNATAGTCEEMMKRAVFARELGVPIVMHDYLTGGFTANTTLA
RBL_PELHO        TEALYKAQTETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_PLAOC        AEAIYKAQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_EUCGG        AEAIFKSQAETGEIKGHYLNATAGTCEEMMKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_POPTR        AEALYKAQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_POPAL        AEALYKAQTETGEIKGHYLNATAGTCEEMMKRAIFARELGVPIVMHDYLTGGFTANTSLA
RBL_DAUCA        AEAIYKAQAETGEIKGHYLNATAGTCEEMMKRAIFARELGVPIVMHDYLTGGFTANTSLA
RBL_HELAN        AEAIYKAQAETGEIKGHYLNATAGNCEDMMKRAVFARELGVPIVMHDYLTGGFTANTSLS
RBL_LACSA        AEAIFKSQAETGEIKGHYLNATAGTCEEMMKRAIFARELGVPIVMHDYLTGGFTANTSLA
RBL_OENEH        AEAIYKSQAETGEIKGHYLNATAGTCEEMMKRAIFARELGVPIVMHDYLTGGFTANTSLA
RBL_CAPBU        AEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLS
RBL_ARATH        AEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLS
RBL_DRANE        AEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLS
RBL_LEPVR        AEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_LOBMA        AEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_CRUWA        AEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_ARAHI        AEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_BARVE        AEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVRIVMHDYLTGGFTANTSLA
RBL_AETCO        AEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_AETGR        AEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_NASOF        AEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_OLIPU        AEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLS
RBL_VITVI        AEAIFKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_CALFG        AEAIFKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_LOTJA        AEALFKAQEETGEIKGHYLNATAGTCEEMMKRAVFARELGVPIVMHDYLTGGFTANTTLA
RBL_MORIN        AEAIYKSQAETGEIKGHYLNATAGTCEEMMKRAVFARELGVPIVMHDYLTGGFTANTTLA
RBL_CUCSA        AEAIFKSQAETGEIKGHYLNATAGTCEEMMKRAIFARELGAPIVMHDYLTGGFTANTSLA
RBL_SOYBN        AEAIFKSQAETGEIKGHYLNATAGTCEEMMKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_PHAVU        AEAIYKAQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_PANGI        AEALYKAQAETGEIKGHYLNATAGTCEDMMKRAVFARELGVPIVMHDYITGGFTANTTLA
RBL_SPIOL        AEALYKAQAETGEIKGHYLNATAGTCEDMMKRAVFARELGVPIVMHDYLTGGFTANTTLS
RBL_CITSI        AEALYKAQAETGEIKGHYLNATAGTCEEMLKRAVFARELGVPIVMHDYLTGGFTANTTLA
RBL_ATRBE        AEALYKAQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_NICSY        AEALYKAQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_TOBAC        AEALYKAQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_NICTO        AEALYKAQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_SOLBU        AEALFKAQTETGEIKGHYLNATAGTCEEMMKRAVFARELGVPIVMHDYLTGGFTANTTLA
RBL_SOLLC        AEALFKAQTETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTTLA
RBL_SOLTU        AEALFKAQAETGEIKGHYLNATAGTCEEMMKRAVFARELGTPIVMHDYLTGGFTANTTLA
RBL_COFAR        AEALFKAQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_JASNU        AEAIYKSQAETGEIKGHYLNATAGTSEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_LIRTU        AEALYKAQSETGEIKGHYLNATAGTCEEMMKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_GOSBA        AEAIFKSQAETGEIKGHYLNATAGTCEEMIKRAMCARELGVPIVMHDYLTGGFTANTSLA
RBL_GOSHI        AEAIFKSQAETGEIKGHYLNATAGTCEEMIKRAMCARELGVPIVMHDYLTGGFTANTSLA
RBL_PIPCE        AEALFKAQTETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_ACOCL        AEAIYKAQAETGEIKGHYLNATAGTCEEMMRRAQCARELGVPIVMHDYLTGGFTANTSLA
RBL_PHAAO        AEAIYKAQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_HORVU        AEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTTLA
RBL_WHEAT        AEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTTLA
RBL_AGRST        AEAIYKAQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYITGGFTANTSLA
RBL_ORYNI        AEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_ORYSA        AEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_ORYSI        AEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_ORYSJ        AEAIYKSQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_SACHY        AEAIYKAQAETGEIKGHYLNATAGTCEEMIKRAVFAKELGVPIVMHDYLTGGFTANTTLS
RBL_SACOF        AEAIYKAQAETGEIKGHYLNATAGTCEEMIKRAVFAKELGVPIVMHDYLTGGFTANTTLS
RBL_SORBI        AEAIYKAQAETGEIKGHYLNATAGTCEEMIKRAVFAKELGVPIVMHDYLTGGFTANTTLS
RBL_MAIZE        AEAIYKAQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTTLS
RBL_AMBTC        AEALYKAQAETGEIKGHYLNATAGTCEEMMKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_NYMAL        AEAIYKAQAETGEIKGHYLNATAGTSEEMMKRAVCARELGVPIVMHDYLTGGFTANTSLA
RBL_PINKO        AEAINKAQAETGEIKGHYLNATAGTCEEMMKRAVFARELGVPIVMHDYLTGGFTANTSLA
RBL_PINTH        AEALNKAQAETGEIKGHYLNATAGTCEEMMKRAIFARELGVPIVMHDYLTGGFTANTSLA
RBL_HUPLU        AEALFKAQAETGEIKGHYLNVTAGTYEELLKRAHCARELGVPIVMHDYLTGGFTANTSLA
RBL_CHAVU        AEAIYKSQAETGEIKGHYLNATAGTCEEMLKRAQCARELGMPIVMHDYLTGGFTANTTLA
RBL_PHYPA        AEAIYKSQGETGEIKGHYLNATAGTCEEMIKRAQFARELGMPIVMHDYLTGGFTANTSLA
RBL_ANGEV        AEALFKSQAETGEVKGHYLNATAGTCEEMMKRAIFARELGAPIVMHDYLTGGFTANTSLA
RBL_ADICA        AEALFKSQAETGEIKGHYLNATAGTCEEMMKRAVFARELGAPIVMHDYLTGGFTANTSLA
RBL_PSINU        AEALFKSQAETGEIKGHYLNATAGTCEEMMKRAVFARELGAPIVMHDYLTGGFTANTSLA
RBL_ANTAG        AEAIFKSQAETGEIKGHYLNATAGTCEEMMKRAHFARELGMPIVMHDYLTGGFTANTTLA
RBL_MARPO        AEAIYKSQAETGEIKGHYLNATAGTCEEMLKRAACARELGVPIVMHDYLTGGFTANTSLA
RBL_CHAGL        AEAIFKSQAETGEIKGHYLNATAGTCEEMLKRAAYARELGVPIIMHDYLTGGFTANTSLS
RBL_STAPU        AEATFKAQAETGEIKGHYLNATAGTCEEMMKRAAYARELGVPIIMHDYLTGGFTANTSLS
RBL_ZYGCR        AEAIYKAQAETGEIKGHYLNATAGTCEEMLKRAEYAKELGVPIVMHDYLTGGFTANTSLA
RBL_CHLAT        AEAIYKAQAETGEIKGHYLNATAGTCEEMLKRAEYAKELGVPIVMHDYLTGGFTANTSLS
RBL_TETOB        AEATYKAQSETGEIKGHYLNATAATCEEMLKRAQCAKELGVPIIMHDYLTGGFTANTSLS
RBL_STIHE        AEAIYKSQAETGEIKGHYLNVTAATSEEMMKRAECAKDLGVPIIMHDYLTAGLTANTSLA
RBL_OLTVI        SEAIYKAQAETGEIKGHYLNATAPDCEEMYKRAECAKDFGVPIIMHDYLTGGFTANTSLA
RBL_CHLRE        AEAIYKAQAETGEVKGHYLNATAGTCEEMMKRAVCAKELGVPIIMHDYLTGGFTANTSLA
RBL_NEPOL        AEAIYKAQAETGEIKGHYLNATAGTSEEMLKRAVFAKELGVPIIMHDYLTGGFTANTSLA
RBL_OSTTA        AEAIYKSQAETGEIKGHYLNATAGNVDQMLKRAQVAKELGMPIIMHDYLTAGFTANTTLA
RBL_TUPAK        AEAIYKSQAETGEVKGHYLNSTAGTCESMMDRAQFAKDLGVPIVMHDYLTGGLTANTSLA
RBL_CHLVU        AEAIYKSQAETGEIKGHYLNATAATAEAMMQRAECAKDLGVPIIMHDYLTGGFTANTSLS
RBL_EUGLO        AEAIYKAQKESGEVKGHYLNVTAGNCEEMYKRADYAVKLGVPIIMHDFLTGGFTANTSLS
RBL_EUGGR        AEAIYKAQTETGEVKGHYLNATAGTCEEMYKRASFAAQIGVPIIMHDYLTGGFTANTSLA
RBL_MESVI        AEAIFKSQSETGEIKGHYLNATAATCEEMLKRAAYAKELGVPIIMHDYLTGGFTANTSLA
RBL_CYAPA        MDAIKKSQAETGEIKGHYLNATAPTTEEMIKRAEFAAELDAPIIMHDYITAGFTSNTTLA
RBL_BIGNA        AEAIYKSQSETGEVKGHYLNATAGTSEEVLKRAECAKELGVPIVMHDFLTGGFTTNTSLS
RBL_TRIEI        QEAIEKAQAETGEIKGHYLNVTAPTCEEMLERADFAKEIGTPIIMHDYLTGGFTANTTLA
RBL_SYNY3        QEAIEKAQAETNEMKGHYLNVTAGTCEEMMKRAEFAKEIGTPIIMHDFFTGGFTANTTLA
RBL_SYNJA        MEAVHKAQAETGEIKGHYLNVTAPTCEEMFKRAEFAKEIGAPIIMHDYLTAGFTANTSLA
RBL_SYNJB        MEAVHKAQAETGEIKGHYLNVTAPTCEEMFKRAEFAKELGAPIIMHDYLTAGFTANTSLA
RBL_SYNP6        ADAIHKSQAETGEIKGHYLNVTAPTCEEMMKRAEFAKELGMPIIMHDFLTAGFTANTTLA
RBL_SYNE7        ADAIHKSQAETGEIKGHYLNVTAPTCEEMMKRAEFAKELGMPIIMHDFLTAGFTANTTLA
RBL_NOSS1        ADAITKAQAETGEIKGHYLNVTAPTCEEMLKRAEYAKELKQPIIMHDYLTAGFTANTTLA
RBL_TRIV2        SDAISKAQAETGEIKGHYLNVTAPTCEEMLKRAEYAKELNQPIIMHDYLTAGFTANTTLA
RBL_THEEB        ADAIHKAQAETGEIKGHYLNVTAPTCEEMLKRAEFAKELEMPIIMHDFLTAGFTANTTLS
RBL_GLOVI        QDAIVKSQAETGEIKGHYLNCTAGTCEEMMERAEFAKELKTPIIMHDYLTGGFTANTTLA
RBL1C_BRASB      MEAVNKAQAATGEIKGTYLNVTAATMEDMYERAEFAKELGSTIIMID-LVIGYTAIQSMA
RBL1A_BRASO      MEAVNKAQAATGEIKGTYLNVTAATMEDMYERAEFAKELGSNIIMID-LVIGYTAIQSMA
RBL_BRADU        IEAVNRAQAASGEVKGTYLNITAGTMEDMYERAEFAKELGSCIVMID-LVIGYTAIQSMA
RBL_OLICO        MEAVNRAQAASGEVKGTYLNVTAATMEDMYERAEFAKELGSCIVMID-LVIGYTAIQSMA
RBL1A_BRASB      MEAVNKAQAATGEVKGTYLNVTAATMEDMYERAEFAKELGSVIIMID-LVIGYTAIQSMA
RBL_RHOP5        MEAVNKAQAASGEIKGTYLNVTAGTMEDMYERAEFAKQLGSVIIMID-LVIGYTAIQSMA
RBL_RHOPB        MEAVNKAQAASGEIKGTYLNVTAGTMEEMYERAEFAKQLGSVIIMID-LVIGYTAIQSMA
RBL_RHOP2        MEAVNKAQAASGEIKGTYLNVTAGTMEEMYERAEFAKQLGSVIIMID-LVIGYTAIQSMA
RBL1B_RHOPS      MEAVNKAQAASGEIKGTYLNVTAGTMEEMYERAEFAKQLGSVIIMID-LVIGYTAIQSMA
RBL1_RHOPA       MEAVNKAQAQTGEIKGTYLNVTAATMEDMYERAEYAKELGSIIVMID-LVIGYTAIQSMA
RBL1A_NITHX      MEAVNRAQAATGEVKGSYLNVTAATMEDMYERAEFAKELGSVVVMID-LVIGYTAIQSMS
RBL1B_NITHX      MEAVNRAQAATGEIKGSYLNVTAATMEDMYERAEFAKELGSVVVMID-LVIGYTAIQSMS
RBL1B_NITWN      MEAVNRAQAATGEIKGSYLNVTAATMEDMYERAEFAKELGSVVVMID-LVIGYTAIQSMS
RBL_NITMU        MEAVNKASAATGEVKGHYLNVTAGTMEEMYERAEFAKSLGSVIIMID-LVIGYTAIQSMA
RBL_NITOC        MEAVNKASAATGEVKGHYLNVTAATMEDMYERAEFAKSLGSVIIMID-LVVGYTAIQSMA
RBL_PORPU        MEGVNKASAAAGEIKGHYLNVTAATMEDMYERAEFSKVVGSIICMID-LVIGYTAIQSMA
RBL_PYRYE        MEGVNKASASAGEIKGHYLNVTAATMEDMYERAEFSKEVGSIICMID-LVIGYTAIQSMA
RBL_GRATL        MEAVNRAIAATGETKGHYMNVTAATMEEMYERAEFAKQLGSIIIMID-LVIGYTAIQTMA
RBL_EMIHU        MEGVNHAACLTGEVKGHYLNTTAATMEDMYERANFARDLGSVIVMID-LVIGYTAIQSMG
RBL_CYAM1        MEGVNRAAAASGEVKGSYLNVTAATMEECYKRAEFAKEVGSVIIMID-LVIGYTAIQTMA
RBL_CYACA        MEGVNRASAATGEIKGSYLNVTAATMEEMYNRAACAKEVGSIIIMID-LVIGYTAIQSMA
RBL_TRICV        LEGINRASAATGEVKGSYLNITAATMEEVYKRADYAKQIGSVIVIID-LVMGYTAIQSAA
RBL_THAPS        LEGINRASAATGEVKGSYLNITAATMEEVYKRAEYAKMIGSVIVMID-LVMGYTAIQSIA
RBL_PHATC        MEGINRASAATGETKGSYLNITAGTMEEVYKRAEYAKTVGSIVVMID-LVMGYTAIQSAA
RBL1C_CUPNH      MDAVNKASAATGEVKGSYLNVTAGTMEEMYRRAEFAKSLGSVIIMID-LIVGWTCIQSMS
RBL1P_CUPNH      MDAVNKASAATGEVKGSYLNVTAGTMEEMYRRAEFAKSLGSVVIMID-LIVGWTCIQSMS
RBL1B_METPP      MDAVNKASAATGEVKGSYLNVTAGTMEEMYRRAEFAKELGSVIIMID-LVVGYTAIQSMS
RBL1A_METPP      MDAVNKASAATGEIKGSYLNVTAATMEDMYERAEFAKELGSVIVMID-LVIGYTAIQSMS
RBL_RHOS1        MEAVNLASAQTGEVKGHYLNITAGTMEEMYRRAEFAKSLGSVIVMVD-LIIGYTAIQSIS
RBL_RHOS4        MEAVNLASAQTGEVKGHYLNITAGTMEEMYRRAEFAKSLGSVIVMVD-LIIGYTAIQSIS
RBL1_RHIME       MEAVNHASAVTGEVKGHYLNITAGTMEEMYRRAEFAKELGSVIVMVD-LIVGWTAIQSIS
RBL_PARDP        MEAVNKATAVTGEVKGHYLNITAGTMEEMYRRAELAKELGSVIVMVD-LIVGWTAIQSIS
RBL_PARXL        MEAVNRAQAETGEVKGHYLNVTAGTMEDMYERAEFAKELGSCIVMID-LVIGWTAIQSMA
                  :.   :   :.* ** *:* **   :    **  :  .   : : * :  *       .

RBL_HALHL        NWCRDNGMLLHIHRAMHAVLDRNPNHGIHFRVLTKILRLMGGDQLHTGTVVGKLEGDRQS
RBL_METCA        NWCRNNGMLLHIHRAMHAVMDRNPNHGIHFRVFTKMLRLSGGDHLHTGTVVGKLEGDRQA
RBL_ALKEH        RWCRKNGMLLHIHRAMHAVMDRNPRHGIHFRVLAKALRLSGGDHLHTGTVVGKLEGDRAA
RBL1A_RHOPS      RWCRANGMLLHVHRAMHGVIDRNPRHGINFRVLAKLLRLLGGDHLHSGTVVGKLEGDRAA
RBL1B_BRASB      NWCRENGMLLHIHRAMHAVLDRNPMHGIHFRVLTKCLRLSGGDHLHSGTVVGKLEGDREA
RBL1B_BRASO      NWCRENGMLLHIHRAMHAVLDRNPMHGIHFRVLTKCLRLSGGDHLHSGTVVGKLEGDREA
RBL1C_NITHX      NWCRDNGILLHIHRAMHAVIDRNPHHGIHFRVLTKILRLSGGDHLHTGTVVGKLEGDRAS
RBL1A_NITWN      NWCRNNGMLLHIHRAMHAVIDRNPHHGIHFRVLTKILRLSGGDHLHTGTVVGKLEGDRAS
RBL_NITEC        NWCRNNGMLLHVHRAMHAVLDRNPHHGIHFRVLTKILRLSGGDHLHTGTVVGKLEGDRAS
RBL_CUPMC        NWCRDNGMLLHIHRAMHAVLDRNPHHGIHFRVLTKCLRLSGGDHLHSGTVVGKLEGDRDA
RBL1_THIDA       NWCRDNGMLLHIHRAMHAVLDRNPHHGIHFRVLTKILRLSGGDHLHSGTVVGKLEGDREA
RBL_NITEU        NWCRDNGILLHIHRAMHAVIDRNPHHGIHFRVLAKMLRLSGGDHLHSGTVVGKLEGDREA
RBL1A_HYDCU      NYCRKNGLLLHIHRAMHGVIDRNPHHGIHFRVLTKALRLSGGDHLHSGTVVGKLEGDREA
RBL_PROMS        NWCRKNGMLLHIHRAMHAVIDRHPKHGIHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQT
RBL_PROM5        NWCRKNGMLLHIHRAMHAVIDRHPKHGIHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQT
RBL_PROM9        NWCRKNGMLLHIHRAMHAVIDRHPKHGIHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQT
RBL_PROMP        NWCRKNGMLLHIHRAMHAVIDRHPKHGIHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQT
RBL_PROM0        NWCRKNGMLLHIHRAMHAVIDRHPKHGIHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQT
RBL_PROMA        NWCRKNGMLLHIHRAMHAVIDRHPKHGIHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQT
RBL_PROMM        NWCRKNGMLLHIHRAMHAVIDRHPKHGIHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQT
RBL_PROM3        NWCRKNGMLLHIHRAMHAVIDRHPKHGIHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQT
RBL_PROM1        NWCRENGMLLHIHRAMHAVIDRHPQHGIHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQT
RBL_PROMT        NWCRENGMLLHIHRAMHAVIDRHPQHGIHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQT
RBL_SYNS3        KWCRKNGMLLHIHRAMHAVIDRHPKHGIHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQT
RBL_SYNS9        KWCRANGMLLHIHRAMHAVIDRHPKHGIHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQT
RBL_SYNPW        KWCRKNGMLLHIHRAMHAVIDRHPKHGIHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQT
RBL_SYNPX        KWCRKNGMLLHIHRAMHAVIDRHPKHGIHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQT
RBL_SYNSC        KWCRKNGMLLHIHRAMHAVIDRHPKHGIHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQT
RBL1B_HYDCU      NWCRDNGMLLHIHRAMHAVIDRNPNHGIHFRVLAKCLRLSGGDHLHTGTVVGKLEGDRAS
RBL_DRIGR        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHAGTVVGKLEGERDI
RBL_NANDO        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHAGTVVGKLEGEREI
RBL_PELHO        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGERDI
RBL_PLAOC        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHAGTVVGKLEGEREI
RBL_EUCGG        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHAGTVVGKLEGERDI
RBL_POPTR        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGERDI
RBL_POPAL        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGERDI
RBL_DAUCA        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGERDI
RBL_HELAN        QYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHSGTVVGKLEGEREI
RBL_LACSA        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGEREI
RBL_OENEH        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGERDI
RBL_CAPBU        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGDRES
RBL_ARATH        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGDRES
RBL_DRANE        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGDRES
RBL_LEPVR        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGDRES
RBL_LOBMA        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGDRES
RBL_CRUWA        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGDRES
RBL_ARAHI        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHVHAGTVVGKLEGDRES
RBL_BARVE        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGDRES
RBL_AETCO        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGDRES
RBL_AETGR        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGDRES
RBL_NASOF        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHVHAGTVVGKLEGDRES
RBL_OLIPU        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHVHAGTVVGKLEGDRES
RBL_VITVI        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGEREI
RBL_CALFG        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREI
RBL_LOTJA        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREI
RBL_MORIN        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREI
RBL_CUCSA        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREI
RBL_SOYBN        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHVHAGTVVGKLEGEREI
RBL_PHAVU        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHVHSGTVVGKLEGEREI
RBL_PANGI        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHSGTVVGKLEGERDI
RBL_SPIOL        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHSGTVVGKLEGERDI
RBL_CITSI        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGERDI
RBL_ATRBE        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGERDI
RBL_NICSY        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGERDI
RBL_TOBAC        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGERDI
RBL_NICTO        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGERDI
RBL_SOLBU        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGERDI
RBL_SOLLC        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGERDI
RBL_SOLTU        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHSGTVVGKLEGERDI
RBL_COFAR        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKGLRMSGGDHIHAGTVVGKLEGERDI
RBL_JASNU        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGERDI
RBL_LIRTU        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGERDI
RBL_GOSBA        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGERDI
RBL_GOSHI        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGERDI
RBL_PIPCE        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHVHSGTVVGKLEGERDI
RBL_ACOCL        IYCRNNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREM
RBL_PHAAO        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREM
RBL_HORVU        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHSGTVVGKLEGEREM
RBL_WHEAT        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHSGTVVGKLEGEREM
RBL_AGRST        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREM
RBL_ORYNI        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREM
RBL_ORYSA        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREM
RBL_ORYSI        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREM
RBL_ORYSJ        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREM
RBL_SACHY        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHSGTVVGKLEGEREI
RBL_SACOF        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHSGTVVGKLEGEREI
RBL_SORBI        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHSGTVVGKLEGEREI
RBL_MAIZE        HYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHSGTVVGKLEGEREI
RBL_AMBTC        HYCRDNGLLLHIHRAMHAVIDRQRNHGIHFRVLAKALRMSGGDHIHAGTVVGKLEGERDV
RBL_NYMAL        HYCRDNGLLLHIHRAMHAVIDRQRNHGIHFRVLAKALRMSGGDHIHAGTVVGKLEGERDV
RBL_PINKO        HYCRDNGLLLHIHRAMHAVIDRQRNHGMHFRVLAKALRMSGGDHVHAGTVVGKLEGERDV
RBL_PINTH        HYCRDNGLLLHIHRAMHAVIDRQRNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGERDV
RBL_HUPLU        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHAGTVVGKLEGERDV
RBL_CHAVU        HYCRDNGLLLHIHRAMHAVLDRQKNHGMHFRVLAKALRLSGGDHVHSGTVVGKLEGEREV
RBL_PHYPA        HYCRDNGLLLHIHRAMHAVLDRQKNHGMHFRVLAKALRLSGGDHIHSGTVVGKLEGERQV
RBL_ANGEV        HYCRDNGLLLHIHRAMHAVIDRQRNHGMHFRVLAKALRMSGGDHVHAGTVVGKLEGEREV
RBL_ADICA        FYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHAGTVVGKLEGEREV
RBL_PSINU        FYCRDNGLLLHIHRAMHAVIDRQRNHGMHFRVLAKALRMSGGDHVHAGTVVGKLEGERDV
RBL_ANTAG        RYCRDNGLLLHIHRAMHAVIDRQRNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGEREV
RBL_MARPO        FYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHAGTVVGKLEGDRQV
RBL_CHAGL        FYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGEREV
RBL_STAPU        NYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHTGTVVGKLEGERQV
RBL_ZYGCR        HYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGEREV
RBL_CHLAT        HYCRDNGLLLHIHRAMHAVIDRQRNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGEREV
RBL_TETOB        SYCRDHGLLLHIHRAMHAVIDRQRNHGIHFRVLAKALRLSGGDHLHSGTVVGKLEGEREV
RBL_STIHE        HYCRDTGLLLHIHRAMHAVIDRQRNHGIHFRVLAKALRLSGGDHLHSGTVVGKLEGEREV
RBL_OLTVI        TYCRDNGLLLHIHRAMHAVIDRQRNHGIHFRVLAKALRLSGGDHLHSGTVVGKLEGEREV
RBL_CHLRE        IYCRDNGLLLHIHRAMHAVIDRQRNHGIHFRVLAKALRMSGGDHLHSGTVVGKLEGEREV
RBL_NEPOL        YYCRDNGLLLHIHRAMHAVIDRQRNHGIHFRVLAKALRLSGGDHLHSGTVVGKLEGEREV
RBL_OSTTA        TYCREEGLLLHIHRAMHAVIDRQRNHGIHFRVLAKALRLSGGDHLHSGTVVGKLEGERNV
RBL_TUPAK        IYCRNNGLLLHIHRAMHAVIDRQRNHGIHFRVLAKALRLSGGDHLHSGTVVGKLEGEREI
RBL_CHLVU        HYCRDNGLLLHIHRAMHAVIDRQRNHGITFRVLAKALRLSGGDHLHSGTVVGKLEGEREV
RBL_EUGLO        NYCRNNGLLLHIHRAMHAVIDRQRNHGIHFRVLAKTLRMSGGDHLHSGTVVGKLEGDRAG
RBL_EUGGR        MYCRDNGLLLHIHRAMHAVIDRQRNHGIHFRVLAKTLRMSGGDHLHSGTVVGKLEGEREV
RBL_MESVI        AYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRLSGGDHLHSGTVVGKLEGEREV
RBL_CYAPA        RWCRDNGPLLHIHRAMHAVIDRQKNHGIHFRVLAKTLRMSGGDHLHSGTVVGKLEGDRAG
RBL_BIGNA        KYCRESGLLLHIHRAMHAVVDRQKNHGIHFRVLAKTLRLSGGDHLHSGTVVGKLEGDKDV
RBL_TRIEI        KWCRRNGVLLHIHRAMHAVIDRQKAHGIHFRVLAKCLRMSGGDHLHSGTVVGKLEGEKGI
RBL_SYNY3        RWCRDNGILLHIHRAMHAVVDRQKNHGIHFRVLAKCLRLSGGDHLHSGTVVGKLEGERGI
RBL_SYNJA        KWCRDNGILLHIHRAMHAVIDRQKNHGIHFRVLAKCLRMSGGDHLHAGTVVGKLEGDRAI
RBL_SYNJB        KWCRDNGILLHIHRAMHAVIDRQKNHGIHFRVLAKCLRMSGGDHLHSGTVVGKLEGDRAI
RBL_SYNP6        KWCRDNGVLLHIHRAMHAVIDRQRNHGIHFRVLAKCLRLSGGDHLHSGTVVGKLEGDKAS
RBL_SYNE7        KWCRDNGVLLHIHRAMHAVIDRQRNHGIHFRVLAKCLRLSGGDHLHSGTVVGKLEGDKAS
RBL_NOSS1        RWCRDNGVLLHIHRAMHAVIDRQKNHGIHFRVLAKALRLSGGDHIHTGTVVGKLEGERGI
RBL_TRIV2        RWCRDNGVLLHIHRAMHAVIDRQKNHGIHFRVLAKALRLSGGDHIHTGTVVGKLEGERGI
RBL_THEEB        KWCRDNGMLLHIHRAMHAVMDRQKNHGIHFRVLAKCLRMSGGDHIHTGTVVGKLEGDKAV
RBL_GLOVI        KWCRRNGILLHIHRAMHAVIDRQKNHGIHFRVLAKCLRLSGGDHIHTGTVVGKLEGERAS
RBL1C_BRASB      KWARRNDMILHLHRAGHSTYTRQRAHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPNT
RBL1A_BRASO      KWSRKNDMILHLHRAGHSTYTRQRAHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPNT
RBL_BRADU        KWARRNDMILHLHRAGHSTYTRQKSHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPNT
RBL_OLICO        KWARKNDMILHLHRAGHSTYTRQKNHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPNT
RBL1A_BRASB      KWARRNDMILHLHRAGHGTYTRQKSHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPNT
RBL_RHOP5        KWARKNDMILHLHRAGHSTYTRQRNHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPAT
RBL_RHOPB        KWARRNDMILHLHRAGHSTYTRQRNHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPAT
RBL_RHOP2        KWARKNDMILHLHRAGHSTYTRQRNHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPAT
RBL1B_RHOPS      KWARRNDMILHLHRAGHSTYTRQRNHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPST
RBL1_RHOPA       KWARKNDMILHLHRAGHSTYTRQRNHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPAT
RBL1A_NITHX      NWARKNDMILHLHRAGHSTYTRQRNHGVSFRVISKWMRLAGVDHIHAGTVVGKLEGDPLT
RBL1B_NITHX      NWARKNDMILHLHRAGHSTYTRQRNHGVSFRVISKWMRLAGVDHIHAGTVVGKLEGDPLT
RBL1B_NITWN      NWARKNDMILHLHRAGHSTYTRQRSHGVSFRVISKWMRLAGVDHIHAGTVVGKLEGDPLT
RBL_NITMU        KWARKNDMILHLHRAGNSTYSRQKNHGMNFRVICKWMRMAGVDHIHAGTVVGKLEGDPLM
RBL_NITOC        KWARKNDMILHLHRAGNSTYSRQKNHGMNFRVICKWMRMAGVDHIHAGTVVGKLEGDPLM
RBL_PORPU        IWARKNDMILHLHRAGNSTYSRQKNHGMNFRVICKWMRMAGVDHIHAGTVVGKLEGDPLM
RBL_PYRYE        IWARKHDMILHLHRAGNSTYSRQKNHGMNFRVICKWMRMAGVDHIHAGTVVGKLEGDPLM
RBL_GRATL        IWARKNDMILHLHRAGNSTYSRQKIHGMNFRVICKWMRMSGVDHIHAGTVVGKLEGDPLM
RBL_EMIHU        KWSRDNDVILHLHRAGNSTYSRQKNHGMNFRVICKWMRMSGCDHIHAGTVVGKLEGDPLM
RBL_CYAM1        IWARENNMILHLHRAGNSTYSRQKNHGINFRVISKWMRMAGVDHIHAGTVVGKLEGDPII
RBL_CYACA        IWARENNMILHLHRAGNSTYARQKNHGINFRVICKWMRMAGVDHIHAGTVVGKLEGDPII
RBL_TRICV        IWARDNDMLLHLHRAGNSTYARQKNHGINFRVICKWMRMSGVDHIHAGTVVGKLEGDPLM
RBL_THAPS        YWARENDMLLHLHRAGNSTYARQKNHGINFRVICKWMRMSGVDHIHAGTVVGKLEGDPLM
RBL_PHATC        IWARDNDLILHLHRAGNSTYARQKNHGINFRVICKWMRMCGVDHIHAGTVVGKLEGDPLM
RBL1C_CUPNH      NWCRQNDMILHLHRAGHGTYTRQKNHGVSFRVIAKWLRLAGVDHMHTGTAVGKLEGDPLT
RBL1P_CUPNH      NWCRQNDMILHLHRAGHGTYTRQKNHGVSFRVIAKWLRLAGVDHMHTGTAVGKLEGDPLT
RBL1B_METPP      NWARQNDMVLHMHRAGHGTYTRQKNHGVSFRVIAKWLRMAGVDHLHTGTAVGKLEGDPLT
RBL1A_METPP      NWARRNDVILHLHRAGHGTYTRQKNHGVSFRVIAKWMRLAGVDHIHTGTAVGKLEGDPMT
RBL_RHOS1        EWCRQNDMILHMHRAGHGTYTRQKNHGISFRVIAKWLRLAGVDHLHCGTAVGKLEGDPLT
RBL_RHOS4        EWCRQNDMILHMHRAGHGTYTRQKNHGISFRVIAKWLRLAGVDHLHCGTAVGKLEGDPLT
RBL1_RHIME       EWCRQNDMILHMHRAGHGTYTRQKNHGISFRVIAKWLRLAGVDHLHAGTAVGKLEGDPPT
RBL_PARDP        NWCRQNDMILHMHRAGHGTYTRQKNHGISFRVIAKWLRMAGVDHLHCGTAVGKLEGDPLT
RBL_PARXL        RWARRNDMILHLHRAGHSTYTRQRNHGISFRVIAKWLRMAGVDHAHAGTAVGKLEGDPLS
                  :.*  . :**:*** :..  *:  **: ***: * :*: * *: * **.******:   

RBL_HALHL        TLGWIDLLRKPYIEEDRSRGLFFDQDWGAMPGAFAVASGGIHVWHMPALLSIFGDDAVFQ
RBL_METCA        TLGWIDLLRERSIKEDRSRGIFFDQEWGAMPGVFAVASGGIHVWHMPALLSIFGDDAVFQ
RBL_ALKEH        TEGWIDLLRERFIPEDRARGIFFDQDWGAMPGVFAVASGGIHVWHMPALVSIFGDDAVFQ
RBL1A_RHOPS      TLGWVDLMRERHVKEDRSRGLFFDQPWGHMAPVMPVASGGIHVWHMPALLAIFGDDAVFQ
RBL1B_BRASB      TIGWVDLMREPFVPENRARGIFFDQDWGAMPGVMPVASGGIHVWHMPALTAIFGDDACFQ
RBL1B_BRASO      TIGWVDLMREPFVPENRARGIFFDQDWGAMPGVMPVASGGIHVWHMPALTAIFGDDACFQ
RBL1C_NITHX      TLGWIDLLRESFVPEDRSRGIFFDQDWGSMPGCFAVASGGIHVWHMPALVTIFGDDSVLQ
RBL1A_NITWN      TLGWIDLLRESFVPEDRSRGIFFDQDWGSMPGGFAVASGGIHVWHMPALVTIFGDDSVLQ
RBL_NITEC        TLGWIDLLRESFVPEDRSRGIFFDQDWGSMPGAFAVASGGIHVWHMPALVAIFGDDSVLQ
RBL_CUPMC        TLGWIDIMRDDFIKEDRSRGIMFDQDFGSMPGVMPVASGGIHVWHMPALVTIFGDDSVLQ
RBL1_THIDA       TLGWIDMMRDSFVKEDRSRGIFFDQDWGSMPGVFPVASGGIHVWHMPALVTIFGDDSVLQ
RBL_NITEU        TLGWIDIMRDSFIKEDRSRGIMFDQDWGSMPGVVPVASGGIHVWHMPALVTIFGDDACLQ
RBL1A_HYDCU      TLGWIDLMRDSFIPEDRSRGIMFDQDFGAMPGVMPVASGGIHVWHMPALVSIFGDDSVLQ
RBL_PROMS        TLGYIDNLRESFVPEDRSRGNFFDQDWGSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQ
RBL_PROM5        TLGYIDNLRESFVPEDRSRGNFFDQDWGSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQ
RBL_PROM9        TLGYIDNLRESFVPEDRSRGNFFDQDWGSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQ
RBL_PROMP        TLGYIDNLRESFVPEDRSRGNFFDQDWGSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQ
RBL_PROM0        TLGYIDNLRESFVPEDRSRGNFFDQDWGSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQ
RBL_PROMA        TLGYIDNLRESFVPEDRTRGNFFDQDWGSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQ
RBL_PROMM        TLGYIDNLRESFVPEDRSRGNFFDQDWGSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQ
RBL_PROM3        TLGFIDNLRESFVPEDRNRGNFFDQDWGSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQ
RBL_PROM1        TLGYIDNLRESFVPEDRTRGNFFDQDWGSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQ
RBL_PROMT        TLGYIDNLRESFVPEDRTRGNFFDQDWGSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQ
RBL_SYNS3        TLGYIDQLRESFVPEDRSRGNFFDQDWGSMPGVFAVASGGIHVWHMPALVAIFGDDSVLQ
RBL_SYNS9        TLGYIDQLRESFVPEDRSRGNFFDQDWGSMPGVFAVASGGIHVWHMPALVAIFGDDSVLQ
RBL_SYNPW        TLGYIDQLRESFVPEDRSRGNFFDQDWGSMPGVFAVASGGIHVWHMPALVTIFGDDSVLQ
RBL_SYNPX        TLGYIDQLRESFVPEDRSRGNFFDQDWGSMPGVFAVASGGIHVWHMPALVAIFGDDSVLQ
RBL_SYNSC        TLGYIDQLRESFVPEDRSRGNFFDQDWGSMPGVFAVASGGIHVWHMPALVTIFGDDSVLQ
RBL1B_HYDCU      TLGFVDQLREAFVPEDRSRGVFFDQDWGSMPGVMAVASGGIHVWHMPALVNIFGDDSVLQ
RBL_DRIGR        TLGFVDLLRDDFIQKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_NANDO        TLGFVDLLRDDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_PELHO        TLGFVDLLRDDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_PLAOC        TLGFVDLLRDDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_EUCGG        TLGFVDLLRDDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_POPTR        TLGFVDLLRDDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_POPAL        TLGFVDLLRDDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_DAUCA        TLGFVDLLRDDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_HELAN        TLGFVDLLRDDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_LACSA        TLGFVDLLRDDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_OENEH        TLGFVDLLRDDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_CAPBU        TLGFVDLLRDDYVEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_ARATH        TLGFVDLLRDDYVEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_DRANE        TLGFVDLLRDDYVEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_LEPVR        TLGFVDLLRDDYVEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLH
RBL_LOBMA        TLGFVDLLRDDYIEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_CRUWA        TLGFVDLLRDDYVEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_ARAHI        TLGFVDLLRDDYVEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_BARVE        TLGFVDLLRDDYVEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_AETCO        TLGFVDLLRDDYVEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_AETGR        TLGFVDLLRDDYVEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_NASOF        TLGFVDLLRDDYVEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_OLIPU        TLGFVDLLRDDYIEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_VITVI        TLGFVDLLRDDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_CALFG        TLGFVDLLRDDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_LOTJA        TLGFVDLLRDDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_MORIN        TLGFVDLLRDDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_CUCSA        TLGFVDLLRDDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_SOYBN        TLGFVDLLRDDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_PHAVU        TLGFVDLLRDDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_PANGI        TLGFVDLLRDDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_SPIOL        TLGFVDLLRDDYTEKDRSRGIYFTQSWVSTPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_CITSI        TLGFVDLLRDDFVEKDRSRGIYFTQDWVSIPGVIPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_ATRBE        TLGFVDLLRDDFVEQDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_NICSY        TLGFVDLLRDDFVEQDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_TOBAC        TLGFVDLLRDDFVEQDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_NICTO        TLGFVDLLRDDFVEQDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_SOLBU        TLGFVDLLRDDFIEQDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_SOLLC        TLGFVDLLRDDFVEQDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_SOLTU        TLGFVDLLRDDFIEQDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_COFAR        TLGFVDLLRDDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_JASNU        TLGFVDLLRDDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_LIRTU        TLGFVDLLRDDFIEKDRSRGIYFSQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_GOSBA        TLGFVDLLRDDVIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_GOSHI        TLGFVDLLRDDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_PIPCE        TLGFVDLLRDDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_ACOCL        TLGFVDLLRDDYIEKDRSRGIFFTQDWVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_PHAAO        TLGFVDLLRDDYIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_HORVU        TLGFVDLLRDDFIEKDRARGIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_WHEAT        TLGFVDLLRDDFIEKDRARGIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_AGRST        TLGFVDLLRDDFIEKDRARGIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_ORYNI        TLGFVDLLRDDFIEKDRARGIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_ORYSA        TLGFVDLLRDDFIEKDRARGIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_ORYSI        TLGFVDLLRDDFIEKDRARGIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_ORYSJ        TLGFVDLLRDDFIEKDRARGIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_SACHY        TLGFVDLLRDDFIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_SACOF        TLGFVDLLRDDFIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_SORBI        TLGFVDLLRDDFIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_MAIZE        TLGFVDLLRDDFIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_AMBTC        TLGFVDLLRDDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_NYMAL        TLGFVDLLRDDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_PINKO        TLGFVDLLRDDFIEKDRSRGVYFTQDWVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_PINTH        TLGFVDLLRDDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_HUPLU        TLGFVDLLRDDYIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_CHAVU        TLGFVDLLRDDYIEKDRSRGVYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_PHYPA        TLGFVDLLRDDYIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_ANGEV        TLGFVDSLRDDYIEKDRSRGIYFTQDWVSMPGVFPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_ADICA        TLGFVDLLRDDYIEKDRSRGIYFTQDWVSMPGVFPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_PSINU        TLGFVDLLRDDYIEKDRSRGVYFTQDWVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_ANTAG        TLGFVDLLRDDYIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMSALTEIFGDDSVLQ
RBL_MARPO        TLGFVDLLRDDYIEKDRSRGIYFTQDWVSLPGVFPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_CHAGL        TLGFVDLLRDDYIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_STAPU        TLGFVDLLRDDYIEKDRSRGIYFTQDWVALPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_ZYGCR        TLGFVDLLRDDYIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_CHLAT        TLGFVDLLRDDYIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQ
RBL_TETOB        TLGFVDLMRDDYIEKDRSRGIYFTQDWCSMGGTMPVASGGIHVWHMPALVEIFGDDACLQ
RBL_STIHE        TLGFVDLMRDDYIEKDRSRGIYFTQDWCSLPGVMPVASGGIHVWHMPALVEIFGDDACLQ
RBL_OLTVI        TLGFVDLMRDDYIEKDRSRGIYFTQDWCSLPGTMPVASGGIHVWHMPALVEIFGDDACLQ
RBL_CHLRE        TLGFVDLMRDDYVEKDRSRGIYFTQDWCSMPGVMPVASGGIHVWHMPALVEIFGDDACLQ
RBL_NEPOL        TLGFVDLMRDAYVEKDRSRGIYFTQDWASLPGVMPVASGGIHVWHMPALVEIFGDDACLQ
RBL_OSTTA        TLGFVDLMRDAYVEKDRDRGIYFSQDWASLPGVMPVASGGIHVWHMPALVEIFGDDACLQ
RBL_TUPAK        TLGFVDLMRDDYIEKDRSRGIYFTQDWASLPGTMPVASGGIHVWHMPALVDIFGDDACLQ
RBL_CHLVU        TLGFVDLMRDDYIEKDRSRGIYFTQDWVSLPGTMPVASGGIHVWHMPALVEIFGDDACLQ
RBL_EUGLO        TYGFINLMRQNLIYRDRACGVYFAQDWCGLASLMPVASGGIHVWHMPALLDIFGDDTCFQ
RBL_EUGGR        TLGFVDLMRDAYVEKDRSRGIYFTQDWCGMGGTMPVASGGIHVWHMPALTEIFGDDACLQ
RBL_MESVI        TLGFVDLMRDDYIEKDRSRGVYFTQDWCSMGGVMPVASGGIHVWHMPALTEIFGDDSCLQ
RBL_CYAPA        TLGFVDLMRDDHIEQDRSRGIFFTQDWASMPGVMPVASGGIHIWHMPALVDIFGDDSCLQ
RBL_BIGNA        TLGFVDLMRDDYVELDRSRGIYFTQDWASMGGVIPVASGGIHVWHMPALVDIFGDDACLQ
RBL_TRIEI        TMGFVDLMREDHVEQDRERGIYFTQDWASMPGVMPVASGGIHVWHMPALVEIFGDDSCLQ
RBL_SYNY3        TMGFVDLMREDYVEEDRSRGIFFTQDYASMPGTMPVASGGIHVWHMPALVEIFGDDSCLQ
RBL_SYNJA        TMGFVDLMRENYVEADRSRGIFFTQDWASMPGVMPVASGGIHVWHMPALVEIFGDDAVLQ
RBL_SYNJB        TMGFVDLMRENYVEADRSRGIFFTQDWASMPGVMPVASGGIHVWHMPALVEIFGDDSVLQ
RBL_SYNP6        TLGFVDLMREDHIEADRSRGVFFTQDWASMPGVLPVASGGIHVWHMPALVEIFGDDSVLQ
RBL_SYNE7        TLGFVDLMREDHIEADRSRGVFFTQDWASMPGVLPVASGGIHVWHMPALVEIFGDDSVLQ
RBL_NOSS1        TMGFVDLLRENYVEQDKSRGIYFTQDWASLPGVMAVASGGIHVWHMPALVEIFGDDSVLQ
RBL_TRIV2        TMGFVDLLRENYVEQDKSRGIYFTQDWASLPGVMAVASGGIHVWHMPALVEIFGDDSVLQ
RBL_THEEB        TLGFVDLLRENYIEQDRSRGIYFTQDWASMPGVMAVASGGIHVWHMPALVDIFGDDAVLQ
RBL_GLOVI        TMGFVDLLREEHVERDLSRGIYFTQDWASMPGVMAVASGGIHVWHMPALLDIFGDDAVLQ
RBL1C_BRASB      TRGYYDICREDFNPMRLEHGVFFDQHWASLNKLMPVASGGIHAGQMHQLLDLLGEDVVLQ
RBL1A_BRASO      TRGYYDICREDFNPMRLEHGVFFDQHWASLNKLMPVASGGIHAGQMHQLLDLLGEDVVLQ
RBL_BRADU        TRGYYDVCREDFNPTKLEHGLFFDQSWASLNKMMPVASGGIHAGQMHQLLDLLGEDVVLQ
RBL_OLICO        TRGYYDICREEFNPTKLEHGIFFDQNWASLNKMMPVASGGIHAGQMHQLLDLLGEDVVLQ
RBL1A_BRASB      TRGYYDICREDHNPMALEYGLFFEQHWASLNKLMPVASGGIHAGQMHQLLNYLGEDVVLQ
RBL_RHOP5        TRGYYDICREDHNPMALEHGVFFEQNWASLNKLMPVASGGIHAGQMHQLLDHLGEDVVLQ
RBL_RHOPB        TKGYYDICREDYNPMQLEHGIFFEQNWASLNKLMPVASGGIHAGQMHQLLDHLGEDVVLQ
RBL_RHOP2        TKGYYDICREDYNPANLEHGLFFDQHWASLNKLMPVASGGIHAGQMHQLLDLLGEDVVLQ
RBL1B_RHOPS      TKGYYDICREDYNPANLEHGLFFDQPWASLNKLMPVASGGIHAGQMHQLLDLLGEDVVLQ
RBL1_RHOPA       TKGYYDICREDFNPMTLENGLFFDQHWASLNKLMPVASGGIHAGQMHQLLHLLGEDVVLQ
RBL1A_NITHX      TRGYYDICREEHNPMQLEHGIFFDQNWASLNKMMPVASGGIHAGQMHQLIQHLGEDVVLQ
RBL1B_NITHX      TRGYYDICREEHNPMQLEHGIFFDQNWASLNKMMPVASGGIHAGQMHQLIQHLGEDVVLQ
RBL1B_NITWN      TRGFYDICREEYNPTQLEHGIFFDQNWASLNKVMPVASGGIHAGQMHQLIQHLGEDVVLQ
RBL_NITMU        IKGFYDTLRDRHTPVSLEHGLFFEQDWASLNKVMPVASGGIHAGQMHQLLDYLGEDVILQ
RBL_NITOC        IKGFYDTLLDSHTPTSLEHGLFFDQDWASLNKVMPVASGGIHAGQMHQLIQYLGEDVILQ
RBL_PORPU        IKGFYNTLLAGETEINLPQGLFFAQNWASLRKVVPVASGGIHAGQMHQLLDYLGDDVVLQ
RBL_PYRYE        IKGFYNTLLESDTDINLPQGLFFAQNWASLRKVVPVASGGIHAGQMHQLLDYLGDDVVLQ
RBL_GRATL        IRGFYNTLLQTHLEVNLPQGIFFEQDWASLRKVTPVASGGIHCGQMHQLLDYLGNDVVLQ
RBL_EMIHU        IKGFYNTLLDTKTEVNLPQGLFFAQDWASLRKCVPVASGGIHCGQMHQLINYLGDDVVLQ
RBL_CYAM1        IKGFYNTLLLPKLEVNLPQGLFFEMDWASLRKTLPVASGGIHAGQMHQLLHYLGEDVVLQ
RBL_CYACA        VKGFYNTLLLPKLDVNLPQGLFFEMDWASLRKTVPVASGGIHAGQMHLLLKYLGDDVVLQ
RBL_TRICV        IKGFYDVLRLTTLDVNLPYGIFFDMSWASLRKCMPVASGGIHCGQMHQLIHYLGDDVVLQ
RBL_THAPS        IKGFYDILRLTELEVNLPFGIFFEMDWASLRRCMPVASGGIHCGQMHQLIHYLGDDVVLQ
RBL_PHATC        IKGFYDTLLLTHLNVNLPYGIFFEMTWASLRKCMPVASGGIHCGQMHQLVHYLGDDVVLQ
RBL1C_CUPNH      VQGYYNVCRDAYTHADLSRGLFFDQDWASLRKVMPVASGGIHAGQMHQLISLFGDDVVLQ
RBL1P_CUPNH      VQGYYNVCRDAYTHTDLTRGLFFDQDWASLRKVMPVASGGIHAGQMHQLIHLFGDDVVLQ
RBL1B_METPP      VQGYYNVCRDTHTKVDLPRGIFFDQDWGALKKVMPVASGGIHAGQMHQLIDLFGDDVVLQ
RBL1A_METPP      VQGYYNVCRDSVTKQDLPRGLFFDQDWADLKKVMPVASGGIHAGQMHQLIDLFGDDVVLQ
RBL_RHOS1        VQGYYNVCREPFNTVDLPRGIFFEQDWADLRKVMPVASGGIHAGQMHQLLSLFGDDVVLQ
RBL_RHOS4        VQGYYNVCREPFNTVDLPRGIFFEQDWADLRKVMPVASGGIHAGQMHQLLSLFGDDVVLQ
RBL1_RHIME       VQGYYNVCREMKNEVDLPRGLFFEQDWADLKKVMPVASGGIHAGQMHQLLDLFGDDVVLQ
RBL_PARDP        VQGYYNTCREMVNEVDLPRGIFFEQDWGNLKKVMPVASGGIHAGQMHQLLDLFGDDVVLQ
RBL_PARXL        VQGYYNVCRESHNEVDLSRGIFFDQPWAGLRKVMPVASGGIHAGQMHQLLDLFGDDAILQ
                   *: :             *  *   :       .*******  :*  *   :*:*  ::

RBL_HALHL        FGGGTLGHPWGNAAGAAANRVALEACVKARNEGRELEKE--GKEILTEAAKSSPELKAAM
RBL_METCA        FGGGTLGHPWGNAAGAAANRVALEACVEARNEGRQLEKE--GKEILTEAAKSSPELKAAM
RBL_ALKEH        FGGGTLGHPWGNAAGAAANRVALEACVKARNEGRNLERE--GKEILQAAAQHSPELKIAM
RBL1A_RHOPS      FGGGTLGHPWGNAAGAAANRVALEACVRARNEGRDVERE--GKDILTAAAQSSPELKVAM
RBL1B_BRASB      FGGGTLGHPWGNAAGAHANRVALEACVEARNQGRPVERE--GREILTEAAQHSPELKIAM
RBL1B_BRASO      FGGGTLGHPWGNAAGAHANRVALEACVEARNQGRPVERE--GREILTEAAQHSPELKIAM
RBL1C_NITHX      FGGGTLGHPWGNAAGAHANRVALEACVQARAEGRQLEKE--GKDILTAAAAHSPELKIAM
RBL1A_NITWN      FGGGTLGHPWGNAAGAHANRVALEACVQARGEGRHLEKE--GKDILTAAAAHSPELKIAM
RBL_NITEC        FGGGTLGHPWGNAAGAHANRVALEACVQARNEGRQIEKE--GREILTAAAQHSPELKIAM
RBL_CUPMC        FGGGTLGHPWGNAAGAAANRVALEACVEARNKGVAVEKE--GKSILTEAATHSPELKIAM
RBL1_THIDA       FGGGTLGHPWGNAAGAAANRVALEACVEARNKGVAIEKE--GKTVLTEAAKNSPELKIAM
RBL_NITEU        FGGGTLGHPWGNAAGAAANRVALEACVEARNRGVPIEKE--GKAILTEAAKHSPELKIAM
RBL1A_HYDCU      FGGGTLGHPWGNAAGAAANRVALEACVQARNEGKEVEKE--GKEILTNAAKHSPELKIAM
RBL_PROMS        FGGGTHGHPWGSAAGAAANRVALEACVKARNAGREIEKE--SRDILMEAAKHSPELAIAL
RBL_PROM5        FGGGTHGHPWGSAAGAAANRVALEACVKARNAGREIEKE--SRDILMEAAKHSPELAIAL
RBL_PROM9        FGGGTHGHPWGSAAGAAANRVALEACVKARNAGREIEKE--SRDILMEAAKHSPELAIAL
RBL_PROMP        FGGGTHGHPWGSAAGAAANRVALEACVKARNAGREIEKE--SRDILMEAAKHSPELAIAL
RBL_PROM0        FGGGTHGHPWGSAAGAAANRVALEACVKARNAGREIEKE--SRDILMEAAKHSPELAIAL
RBL_PROMA        FGGGTHGHPWGSAAGAAANRVALEACVKARNAGREIEKE--SRDILMEAAKHSPELAIAL
RBL_PROMM        FGGGTHGHPWGSAAGAAANRVALEACVKARNAGREIEKE--SRDILMEAAKHSPELAIAL
RBL_PROM3        FGGGTHGHPWGSAAGAAANRVALEACVKARNAGREIEKE--SRDILMEAAKHSPELAIAL
RBL_PROM1        FGGGTHGHPWGSAAGAAANRVALEACVKARNAGREIEKE--SRDILLEAAKHSPELAIAL
RBL_PROMT        FGGGTHGHPWGSAAGAAANRVALEACVKARNAGREIEKE--SRDILLEAAKHSPELAIAL
RBL_SYNS3        FGGGTHGHPWGSAAGAAANRVALEACVKARNAGREIEKE--SRDILMEAGKHSPELAIAL
RBL_SYNS9        FGGGTHGHPWGSAAGAAANRVALEACVKARNAGREIEKE--SRDILMEAGKHSPELAIAL
RBL_SYNPW        FGGGTHGHPWGSAAGAAANRVALEACVKARNAGRHLEKE--SRDILMEAGKHSPELAIAL
RBL_SYNPX        FGGGTHGHPWGSAAGAAANRVALEACVKARNAGREIEKE--SRDILMEAGKHSPELAIAL
RBL_SYNSC        FGGGTHGHPWGSAAGAAANRVALEACVKARNAGRHLEKE--SRDILTEAAKHSPELAIAL
RBL1B_HYDCU      FGGGTQGHPGGNAAGAAANRVALEACVKARNEGRDLERE--GGDILRDAARNSKELAVAL
RBL_DRIGR        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIREACKWSPELAAAC
RBL_NANDO        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIRAACKWSPELAAAC
RBL_PELHO        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIRKACKWSRELAAAC
RBL_PLAOC        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIREACKWSPELAAAC
RBL_EUCGG        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIREASKWSPELAAAC
RBL_POPTR        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIREASKWSPELAAAC
RBL_POPAL        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIREASKWSPELAAAC
RBL_DAUCA        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIREATKWSPELAAAC
RBL_HELAN        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLATE--GNEIIREATKWSPELAAAC
RBL_LACSA        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLATE--GNEIIREATKWSPELAAAC
RBL_OENEH        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIREACKWSPELAAAC
RBL_CAPBU        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAVE--GNEIIREACKWSPELAAAC
RBL_ARATH        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAVE--GNEIIREACKWSPELAAAC
RBL_DRANE        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAVE--GNEIIREACKWSPELAAAC
RBL_LEPVR        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAVE--GNEIVREACKWSPELAAAC
RBL_LOBMA        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAVE--GNEIVREACKWSPELAAAC
RBL_CRUWA        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAVE--GNEIIREACKWSPELAAAC
RBL_ARAHI        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAVE--GNEIIREACKWSPELAAAC
RBL_BARVE        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAIE--GNEIIREACKWSPELAAAC
RBL_AETCO        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAVE--GNEIIREACKWSPELAAAC
RBL_AETGR        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAVE--GNEIIREACKWSPELAAAC
RBL_NASOF        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAIE--GNTIIREACKWSPELAAAC
RBL_OLIPU        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAVE--GNEIIREACKWSPELAAAC
RBL_VITVI        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIRAASKWSPELAAAC
RBL_CALFG        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRNLARE--GNEIIREASKWSPELAAAC
RBL_LOTJA        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIREASKWSPELAAAC
RBL_MORIN        FGGGTLGHPWGNAPGAVANRVALEACVKARNEGRDLAVE--GNEIIREASKWSPELAAAC
RBL_CUCSA        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIREASKWSPELAAAC
RBL_SOYBN        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIREASKWSPELAAAC
RBL_PHAVU        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIREASKWSPELAAAC
RBL_PANGI        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIREAAKWSPELAAAC
RBL_SPIOL        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNTIIREATKWSPELAAAC
RBL_CITSI        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIREASKWSPELAAAC
RBL_ATRBE        FGGGTLGHPWGNPPGAVANRVALEACVKARNEGRDLAQE--GNEIIREACKWSPELAAAC
RBL_NICSY        FGGGTLGHPWGNAPGAVANRVALEACVKARNEGRDLAQE--GNEIIREACKWSPELAAAC
RBL_TOBAC        FGGGTLGHPWGNAPGAVANRVALEACVKARNEGRDLAQE--GNEIIREACKWSPELAAAC
RBL_NICTO        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAQE--GNEIIREACKWSPELAAAC
RBL_SOLBU        FGGGTLGHPWGNAPGAVANRVALEACVKARNEGRDLARE--GNEIIREASKWSPELAAAC
RBL_SOLLC        FGGGTLGHPWGNAPGAVANRVALEACVKARNEGRDLARE--GNEIIREACKWSPELAAAC
RBL_SOLTU        FGGGTLGHPWGNAPGAVANRVALEACVKARNEGRDLARE--GNEIIREAAKWSPELAAAC
RBL_COFAR        FGGGTLGHPWGNAPGAVANRVALEACVKARNEGRDLAAE--GNEIIREASKWSPELAAAC
RBL_JASNU        FGGGTLGHPWGNAPGAVANRVALEACVKARNEGRDLASE--GNVIIREAAKWSPELSAAC
RBL_LIRTU        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLASQ--GNEIIREASKWSPELAAAC
RBL_GOSBA        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIREASKWSPELAAAC
RBL_GOSHI        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIREASKWSPELAAAC
RBL_PIPCE        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIREAAKWSPELAAAC
RBL_ACOCL        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--STQIIREACKWSPELAAAC
RBL_PHAAO        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNDIIREASKWSPELAAAC
RBL_HORVU        FGGGTLGHPWGNAPGAAANRVALEACVQARNEGRDLARE--GNEIIRAACKWSPELAAAC
RBL_WHEAT        FGGGTLGHPWGNAPGAAANRVALEACVQARNEGRDLARE--GNEIIRAACKWSPELAAAC
RBL_AGRST        FGGGTLGHPWGNAPGAAANRVALEACVQARNEGRDLARE--GNEIIRAACKWSPELAAAC
RBL_ORYNI        FGGGTLGHPWGNAPGAAANRVALEACVQARNEGRDLARE--GNEIIRSACKWSPELAAAC
RBL_ORYSA        FGGGTLGHPWGNAPGAAANRVALEACVQARNEGRDLARE--GNEIIRSACKWSPELAAAC
RBL_ORYSI        FGGGTLGHPWGNAPGAAANRVALEACVQARNEGRDLARE--GNEIIRSACKWSPELAAAC
RBL_ORYSJ        FGGGTLGHPWGNAPGAAANRVALEACVQARNEGRDLARE--GNEIIRSACKWSPELAAAC
RBL_SACHY        FGGGTLGHPWGNAPGAAANRVALEACVQARNEGRDLARE--GNEIIKAACKWSAELAAAC
RBL_SACOF        FGGGTLGHPWGNAPGAAANRVALEACVQARNEGRDLARE--GNEIIKAACKWSAELAAAC
RBL_SORBI        FGGGTLGHPWGNAPGAAANRVALEACVQARNEGRDLARE--GNEIIKAACKWSAELAAAC
RBL_MAIZE        FGGGTLGHPWGNAPGAAANRVALEACVQARNEGRDLARE--GNEIIKAACKWSAELAAAC
RBL_AMBTC        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEVIREASRWSPELAAAC
RBL_NYMAL        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEVIREASKWSPELAAAC
RBL_PINKO        FGGGTLGHPWGNAPGAAANRVALEACVQARNEGRDLARE--GNEVIREACKWSPELAAAC
RBL_PINTH        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEVIREACKWSPELAAAC
RBL_HUPLU        FGGGTLGHPWGNAPGAVANRVALEACVKARNEGRDLARE--GNEIIREASQWSPESAAAC
RBL_CHAVU        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIREAAKWSPELAAAC
RBL_PHYPA        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIREAAKWSPELAAAC
RBL_ANGEV        FGGGTLGHPWGNAPGAVANRVASEACVQARNEGRDLARE--GNEIIREASKWSPELAAAC
RBL_ADICA        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNEIIREASKWSPELAAAC
RBL_PSINU        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNDIIREASKWSPELAAAC
RBL_ANTAG        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNDIIREASKWSPELAAAC
RBL_MARPO        FGGGTLGHPWGNAPGAVANRVSLEACVQARNEGRDLARE--GNEIIREACKWSPELSAAC
RBL_CHAGL        FGGGTLGHPWGNAPGAAANRVALEACVQARNEGRDLARH--GNDVLREACKWSPELAAAC
RBL_STAPU        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARQ--GNDIIREAAKWSPELAAAC
RBL_ZYGCR        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNDVIREATKWSPELAAAC
RBL_CHLAT        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNNIIREAAKFSPELAAAC
RBL_TETOB        FGGGTLGHPWGNAPGAVANRVALEACTQARNEGRDLARE--GGDVIRSACKWSPELAAAC
RBL_STIHE        FGGGTLGHPWGNAPGAAANRVALEACTQARNAGVDLARK--GGDVIRAACKWSPELAAAC
RBL_OLTVI        FGGGTLGHPWGNAPGAAANRVALEACTQARNEGRDLARE--GGDVIRQACQWSPELAAAC
RBL_CHLRE        FGGGTLGHPWGNAPGAAANRVALEACTQARNEGRDLARE--GGDVIRSACKWSPELAAAC
RBL_NEPOL        FGGGTLGHPWGNAPGAAANRVALEACTQARNEGRDLARE--GGDVIRAACKWSPELAAAC
RBL_OSTTA        FGGGTLGHPWGNAPGASANRVALEACTQARNEGRDLARE--GGDVIRAACKWSPELAAAC
RBL_TUPAK        FGGGTLGHPWGNACGAAANRVALEACTQARNEGRDLARE--GGDVIRAACKWSPELAAAC
RBL_CHLVU        FGGGTLGHPWGNAPGAAANRVALEACTQARNEGRDLARE--GGDVIRAACKWSPELAAAC
RBL_EUGLO        FGGGTLGHPWGNASGAVANRVALEACTQARNEGKSLVKY--GADIIREACKYSRELAAAC
RBL_EUGGR        FGGGTLGHPWGNAPGAAANRVASEACVQARNEGRDLSRE--GGDVIREACKWSPELAAAC
RBL_MESVI        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE--GNDVIRAACKWSPELAAAC
RBL_CYAPA        FGGGTLGHPWGNAPGAVANRVALEACVQARNEGRNLARE--GNEIIREAARFSPELAAAC
RBL_BIGNA        FGGGTLGHPWGNAPGAVANRVALEACIKIRNQGQNVLRE--GGNALREATKWSPELAAAC
RBL_TRIEI        FGGGTLGHPWGNAPGATANRVALEACIQARNEGRNLFRE--GGDVIREAAKWSPDLAVAC
RBL_SYNY3        FGGGTLGHPWGNAPGATANRVALEACVQARNEGRNLARE--GNDVIREACRWSPELAAAC
RBL_SYNJA        FGGGTLGHPWGNAPGATANRVALEACIQARNEGRDLARE--GNEIIREAAKWSPELAAAC
RBL_SYNJB        FGGGTLGHPWGNAPGATANRVALEACIQARNEGRDLARE--GNDIIREAAKWSPELAAAC
RBL_SYNP6        FGGGTLGHPWGNAPGATANRVALEACVQARNEGRDLYRE--GGDILREAGKWSPELAAAL
RBL_SYNE7        FGGGTLGHPWGNAPGATANRVALEACVQARNEGRDLYRE--GGDILREAGKWSPELAAAL
RBL_NOSS1        FGGGTLGHPWGNAPGATANRVALEACVQARNEGRNLARE--GNDVIREAAKWSPELAVAC
RBL_TRIV2        FGGGTLGHPWGNAPGATANRVALEACVQARNEGRNLARE--GNDVIREAAKWSPELAVAC
RBL_THEEB        FGGGTLGHPWGNAPGATANRVALEACIQARNEGRDLMRE--GGDIIREAARWSPELAAAC
RBL_GLOVI        FGGGTLGHPWGNAPGATANRVALEACVKARNEGRDLMRE--AGDIIREAARWSPELAAAC
RBL1C_BRASB      FGGGTIGHPRGIAAGATANRVALEAMILARNEGRDYVHE--GPEILAKAAQTCTPLREAL
RBL1A_BRASO      FGGGTIGHPRGIAAGATANRVALEAMILARNEGRDYVHE--GPEILAKAAMTCTPLREAL
RBL_BRADU        FGGGTIGHPMGIAAGAIANRVALEAMILARNEGRDYVHE--GPEILAKAAQTCTPLKSAL
RBL_OLICO        FGGGTIGHPMGIQAGAIANRVALEAMILARNEGRDYVAE--GPEILAKAAATCTPLKSAL
RBL1A_BRASB      FGGGTIGHPLGIQAGATANRVALEAMILARNEGRDYVHE--GPEILAKAAATCTPLKQAL
RBL_RHOP5        FGGGTIGHPMGIQAGATANRVALEAMILARNEGRDYLHE--GPEILAKAAQTCTPLKAAL
RBL_RHOPB        FGGGTIGHPMGIQAGATANRVALEAMIMARNEGRDYLHE--GEEILAKAALTCTPLKAAL
RBL_RHOP2        FGGGTIGHPMGIAAGATANRVALEAMILARNEGRDYVHE--GPEILAKAAQTCTPLKAAL
RBL1B_RHOPS      FGGGTIGHPMGIAAGATANRVALEAMILARNEGRDYVHE--GPEILAKAAQTCTPLKAAL
RBL1_RHOPA       FGGGTIGHPMGIAAGATANRVALEAMILARNEGRDYLHE--GPEILAKAAQTCTPLKAAL
RBL1A_NITHX      FGGGTIGHPMGIQAGAIANRVALEAMILARNEGRDYVSE--GPDILAKAAASCTPLKQAL
RBL1B_NITHX      FGGGTIGHPMGIQAGATANRVALEAMILARNEGRDYVSE--GPDILAKAAASCTPLKQAL
RBL1B_NITWN      FGGGTIGHPMGIQAGATANRVALEAMILARNEGRDYVSE--GPEILAKAAASCTPLKQAL
RBL_NITMU        FGGGTIGHPQGIQAGAVANRVALEAMIMARNEGRDYVKE--GPQILEEAAKWCTPLKLAL
RBL_NITOC        FGGGTIGHPQGIQAGAVANRVALEAMILARNEGRDYVKE--GPQILQDAAKWCSPLKAAL
RBL_PORPU        FGGGTIGHPDGIQAGATANRVALESMVMARNEGRDFVAE--GPQILRDAAKTCGPLQTAL
RBL_PYRYE        FGGGTIGHPDGIQAGATANRVALESMVMARNEGRNYVAE--GPQILRDAAKTCGPLQTAL
RBL_GRATL        FGGGTIGHPDGIQAGATANRVALEAMVLARNEGRDYVAE--GPQILRDAAKTCGPLQTAL
RBL_EMIHU        FGGGTIGHPDGIQAGATANRVALECMVLARNEGRDYIAE--GPQILRDAAKTCGPLQTAL
RBL_CYAM1        FGGGTIGHPDGIQAGATANRVALEAMVLARNEGRDYFNE--GPQILRDAAKNCGPLQTAL
RBL_CYACA        FGGGTLGHPDGIQAGATANRVALEAIVLARNEGRDYVNE--GPQILKEAARTCGPLQTSL
RBL_TRICV        FGGGTIGHPDGIQAGATANRVALEAMVLARNEGADYFNPQVGPQILREAAKKCGPLQTAL
RBL_THAPS        FGGGTIGHPDGIQAGATANRVALEAMVLARNEGLDYFNQQVGPQILRDAAKTCGPLQTAL
RBL_PHATC        FGGGTIGHPDGIQAGATANRVALEAMILARNEGADYFNSDIGPQILRNAAKTCGPLQTAL
RBL1C_CUPNH      FGGGTIGHPQGIQAGATANRVALEAMVLARNEGRDILNE--GPEILRDAARWCGPLRAAL
RBL1P_CUPNH      FGGGTIGHPQGIQAGATANRVALEAMVLARNEGRDILNE--GPEILRDAARWCGPLRAAL
RBL1B_METPP      FGGGTIGHPQGIQAGATANRVALEAMVLARNEGRDIKNE--GPQILRDAAKSCTPLAAAL
RBL1A_METPP      FGGGTIGHPQGIQAGAVANRVALECMVKARNEGRDIKNE--GPEILRKAAQFCAPLKQAL
RBL_RHOS1        FGGGTIGHPMGIQAGATANRVALEAMVLARNEGRNIDVE--GPEILRAAAKWCKPLEAAL
RBL_RHOS4        FGGGTIGHPMGIQAGATANRVALEAMVLARNEGRNIDVE--GPEILRAAAKWCKPLEAAL
RBL1_RHIME       FGGGTIGHPMGIQAGATANRVALEAMVLARNEGRDIAHE--GPEILRAAAKWCKPLEAAL
RBL_PARDP        FGGGTIGHPMGIQAGATANRVALEAMVLARNEGVDLKTE--GPEVLRRAAKWCKPLEAAL
RBL_PARXL        FGGGTIGHPAGIQAGAVANRVALEAMVKARNEGRDIVHE--GPDILEAAARWCTPLKQAL
                 ***** *** *   ** ****: *.    *  *        .   :  *   .     : 

RBL_HALHL        ETWKEIKFE-FDTVDKLDTAHR------
RBL_METCA        ETWKEIKFE-FDTVDKLDVAHR------
RBL_ALKEH        ETWKEIKFE-FETVDKLDTTHR------
RBL1A_RHOPS      ETWREIKFE-FDVVDKLDAPHR------
RBL1B_BRASB      ETWKEIKFE-FDVVDKLDTGPMLRVVNA
RBL1B_BRASO      ETWKEIKFE-FDVVDKLDTGPMLRVVNA
RBL1C_NITHX      ETWKEIKFE-FEAVDQLAIANK------
RBL1A_NITWN      ETWKEIKFE-FETMDKLAIANK------
RBL_NITEC        ETWKEIKFE-FDTVDKLDIAHK------
RBL_CUPMC        ETWKEIKFE-FDTVDKLDVAHK------
RBL1_THIDA       ETWKEIKFE-FDTVDKLDVAHK------
RBL_NITEU        ETWKEIKFE-FDTVDKLDVAHK------
RBL1A_HYDCU      ETWKEIKFE-FDTVDKLDVKHK------
RBL_PROMS        ETWKEIKFE-FDTVDKLDVQG-------
RBL_PROM5        ETWKEIKFE-FDTVDKLDVQG-------
RBL_PROM9        ETWKEIKFE-FDTVDKLDVQG-------
RBL_PROMP        ETWKEIKFE-FDTVDKLDVQG-------
RBL_PROM0        ETWKEIKFE-FDTVDKLDVQG-------
RBL_PROMA        ETWKEIKFE-FDTVDKLDVQ--------
RBL_PROMM        ETWKEIKFE-FDTVDKLDVQ--------
RBL_PROM3        ETWKEIKFE-FDTVDKLDVQ--------
RBL_PROM1        ETWKEIKFE-FDTVDKLDVQ--------
RBL_PROMT        ETWKEIKFE-FDTVDKLDVQ--------
RBL_SYNS3        ETWKEIKFE-FDTVDKLDVQ--------
RBL_SYNS9        ETWKEIKFE-FDTVDKLDVQ--------
RBL_SYNPW        ETWKEIKFE-FDTVDKLDVQN-------
RBL_SYNPX        ETWKEIKFE-FDTVDKLDVQN-------
RBL_SYNSC        ETWKEIKFE-FDTVDKLDVQN-------
RBL1B_HYDCU      DTWKEIKFE-FDTVDKLDVG--------
RBL_DRIGR        EVWKEIKFE-FKAVDTLDIL--------
RBL_NANDO        EVWKEIKFE-FEAMDTL-----------
RBL_PELHO        EVWKEIKFE-FEAMDTL-----------
RBL_PLAOC        EVWKEIKFE-FEAMDTL-----------
RBL_EUCGG        EVWKEIKFE-FEAMDTL-----------
RBL_POPTR        EVWKEIKFE-FQAMDTL-----------
RBL_POPAL        EVWKEIKFE-FEAMDTL-----------
RBL_DAUCA        EVWKEIKFE-FEAMDTL-----------
RBL_HELAN        EVWKEIKFE-FQAMDTLDTDKDKDKKR-
RBL_LACSA        EVWKEIKFE-FQAMDTLDQ---------
RBL_OENEH        EVWKEIKFE-FQAMDTL-----------
RBL_CAPBU        EVWKEIRFN-FPTIDKLDGQE-------
RBL_ARATH        EVWKEITFN-FPTIDKLDGQE-------
RBL_DRANE        EVWKEIRFN-FPTIDKLDGQA-------
RBL_LEPVR        EVWKEIRFN-FPTIDKLDGQ--------
RBL_LOBMA        EVWKEIRFN-FPTIDKLDGQE-------
RBL_CRUWA        EVWKEIRFN-FPTIDKLDGQE-------
RBL_ARAHI        EVWKEIRFN-FPTVDKLDGQE-------
RBL_BARVE        EVWKEIRFN-FPTIDKLDGQA-------
RBL_AETCO        EVWKEIRFN-FPTIDKLDPSAEKVA---
RBL_AETGR        EVWKEIRFN-FPTIDTIDKLDPSVDKVA
RBL_NASOF        EVWKEIRFN-FPTVDTLDTQE-------
RBL_OLIPU        EVWKEIRFN-FPTVDTLDDQA-------
RBL_VITVI        EVWKEIKFE-FPAMDTL-----------
RBL_CALFG        EVWKEIKFE-FEAMDTL-----------
RBL_LOTJA        EIWKEIKFE-FQAMDTL-----------
RBL_MORIN        EVWKEIKFE-FEAMDTL-----------
RBL_CUCSA        EVWKEIKFE-FEAMDTL-----------
RBL_SOYBN        EVWKEIKFE-FEAMDTL-----------
RBL_PHAVU        EVWKEIKFE-FEAMDTLD----------
RBL_PANGI        EVWKEIKFE-FEAVDILDVV--------
RBL_SPIOL        EVWKEIKFE-FPAMDTV-----------
RBL_CITSI        EVWKSIKFE-FAAMDTL-----------
RBL_ATRBE        EVWKEIVFN-FAAVDVLDK---------
RBL_NICSY        EVWKEIVFN-FAAVDVLDK---------
RBL_TOBAC        EVWKEIVFN-FAAVDVLDK---------
RBL_NICTO        EVWKEIVFN-FAAVDVLDK---------
RBL_SOLBU        EVWKEIVFN-FAAVDVLDK---------
RBL_SOLLC        EVWKEIVFN-FAAVDVLDK---------
RBL_SOLTU        EVWKEIVFN-FAAMDVLDK---------
RBL_COFAR        EVWKEIRFN-FEAMDKLDKEKDL-----
RBL_JASNU        EVWKEIRFD-FKAVDTLDPEK-------
RBL_LIRTU        EVWKEIKFDSFKAMDTL-----------
RBL_GOSBA        EVWKAIKFE-FDAVDKLDKPAS------
RBL_GOSHI        EVWKAIKFE-FEAMDTL-----------
RBL_PIPCE        EVWKEIKFE-FAAMDTL-----------
RBL_ACOCL        EVWKEIKFE-FEPVDKLDVKKN------
RBL_PHAAO        EVWKEITFD-FDPVDKPDIEAK------
RBL_HORVU        EVWKAIKFE-FEPVDTIDKKV-------
RBL_WHEAT        EVWKAIKFE-FEPVDTIDK---------
RBL_AGRST        EVWKAIKFE-FEPVDTIDK---------
RBL_ORYNI        EIWKAIKFE-FEPVDKLDS---------
RBL_ORYSA        EIWKAIKFE-FEPVDKLDS---------
RBL_ORYSI        EIWKAIKFE-FEPVDKLDS---------
RBL_ORYSJ        EIWKAIKFE-FEPVDKLDS---------
RBL_SACHY        EIWKEIKFDTFKAMDTL-----------
RBL_SACOF        EIWKEIKFDTFKAMDTL-----------
RBL_SORBI        EIWKEIKFDTFKAMDTL-----------
RBL_MAIZE        EIWKEIKFDGFKAMDTI-----------
RBL_AMBTC        EVWKEIKFE-FEAMDVL-----------
RBL_NYMAL        EVWKEIKFE-FEAMDVL-----------
RBL_PINKO        EIWKEIKFE-FDVIDRL-----------
RBL_PINTH        EIWKEIKFE-FDVIDRL-----------
RBL_HUPLU        EVWKEIKFE-FEAMDTL-----------
RBL_CHAVU        EVWKEIKFE-FETIDTL-----------
RBL_PHYPA        EVWKEIKFE-FDTVDTL-----------
RBL_ANGEV        EVWKEIKFE-FETIDTL-----------
RBL_ADICA        EIWKAIKFE-FETIDTL-----------
RBL_PSINU        EVWKEIKFV-FDTIDVL-----------
RBL_ANTAG        EVWKEIKFV-FETIDTL-----------
RBL_MARPO        EIWKEIKFE-FDIIDTL-----------
RBL_CHAGL        EVWKEIKFE-FETIDTL-----------
RBL_STAPU        EVWKEIKFE-FDTIDTL-----------
RBL_ZYGCR        EVWKEIKFE-FDTIDTL-----------
RBL_CHLAT        EVWKEIKFE-FETIDTL-----------
RBL_TETOB        EVWKEIKFE-FETIDKL-----------
RBL_STIHE        EVWKEIKFE-FETIDKL-----------
RBL_OLTVI        EVWKEIKFE-FETIDTL-----------
RBL_CHLRE        EVWKEIKFE-FDTIDKL-----------
RBL_NEPOL        EVWKEIKFE-FDTVDTL-----------
RBL_OSTTA        EVWKEIKFE-FDTVDTL-----------
RBL_TUPAK        EVWKEIKFE-FDTVDKL-----------
RBL_CHLVU        EVWKEIKFE-FETIDTL-----------
RBL_EUGLO        DVWKEVTFN-FDTVDKL-----------
RBL_EUGGR        EVWKEIKFE-FETIDKL-----------
RBL_MESVI        EVWKEIKFE-FETIDTL-----------
RBL_CYAPA        EVWKEIKFE-FETIDTI-----------
RBL_BIGNA        EVWKEIKFE-FDTIDTI-----------
RBL_TRIEI        ELWKEIKFE-FEAMDTL-----------
RBL_SYNY3        ELWKEIKFE-FEAMDTL-----------
RBL_SYNJA        ELWKEIKFE-FKPVDTL-----------
RBL_SYNJB        ELWKEIKFE-FKAVDTL-----------
RBL_SYNP6        DLWKEIKFE-FETMDKL-----------
RBL_SYNE7        DLWKEIKFE-FETMDKL-----------
RBL_NOSS1        ELWKEIKFE-FEAMDTV-----------
RBL_TRIV2        ELWKEIKFE-FEAMDTV-----------
RBL_THEEB        ELWKEIKFE-FEAQDTI-----------
RBL_GLOVI        ELWKEIKFE-YEAVDKL-----------
RBL1C_BRASB      EIWKDVTFN-YESTDSPDFVPTVTPAA-
RBL1A_BRASO      EIWKDVTFN-YESTDSPDFVPTVTPAA-
RBL_BRADU        EVWKDVTFN-YQSTDTPDFVPTALETV-
RBL_OLICO        EVWKDVTFN-YESTDAPDFVPTAIAAV-
RBL1A_BRASB      DVWKNVTFN-YDSTDTPDFVPTAAVTA-
RBL_RHOP5        ETWKNVTFN-YESTDMPDYAPTPSVSV-
RBL_RHOPB        ETWKNVTFN-YESTDMPDYAPTPSVSM-
RBL_RHOP2        DTWKNVSFN-YESTDTPDYAPTPSVSV-
RBL1B_RHOPS      DTWKNVSFN-YESTDTPDYAPTPSVSM-
RBL1_RHOPA       DTWKNVTFN-YESTDTPDYAPTPSVSV-
RBL1A_NITHX      EVWKDVTFN-YQSTDAPDYVTTPAVA--
RBL1B_NITHX      EVWKDVTFN-YQSTDAPDYVTTPAVA--
RBL1B_NITWN      EVWKDVTFD-YASTDAPDYVPTAVPAA-
RBL_NITMU        DTWKDITFN-YESTDTADFVPSETASV-
RBL_NITOC        DTWKDVTFN-YESTDTADFVPTATASV-
RBL_PORPU        DLWKDISFN-YTSTDTADFVETPTANV-
RBL_PYRYE        DLWKDISFN-YTSTDTADFVETPTANI-
RBL_GRATL        DLWKDITFN-YTSTDTADFVETPTANV-
RBL_EMIHU        DLWKDITFN-YASTDTADFVETATANV-
RBL_CYAM1        DLWKDIAFN-YTSTDTSDFVETPTANV-
RBL_CYACA        DLWKDISFN-FTSTDTADFVETPTANV-
RBL_TRICV        DLWKDISFN-YTSTDTADFAETPTANV-
RBL_THAPS        DLWKDISFN-YTSTDTADFAETATANR-
RBL_PHATC        DLWKDISFN-YTSTDTSDFSVTPTANV-
RBL1C_CUPNH      DTWGDISFN-YTPTDTSDFAPTASVA--
RBL1P_CUPNH      DTWGDISFN-YTPTDTSDFAPTASVA--
RBL1B_METPP      DTWGDITFN-YTSTDTSDYVPTPSVA--
RBL1A_METPP      DTWGEISFN-YTPTDTSDYAVTPGVA--
RBL_RHOS1        DTWGNITFN-YTSTDTSDFVPTASVAM-
RBL_RHOS4        DTWGNITFN-YTSTDTSDFVPTASVAM-
RBL1_RHIME       DIWGNISFN-YTPTDTSDFVPSVTAA--
RBL_PARDP        DVWGNITFN-YTSTDTSDFVPTASVS--
RBL_PARXL        DTWRDVTFN-YASTDTPDFAATPTAA--
                 : *  : *  :   *