CLUSTAL format seed alignment for MF_01341

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RL15_BART1        ------------------------------------------------------------
RL15_ERYLH        ------------------------------------------------------------
RL15_PHEZH        ------------------------------------------------------------
RL15_METSB        ------------------------------------------------------------
RL15_ACICJ        ------------------------------------------------------------
RL15_EHRRG        ------------------------------------------------------------
RL15_WOLPP        ------------------------------------------------------------
RL15_ORITB        ------------------------------------------------------------
RL15_RICAE        ------------------------------------------------------------
RL15_BORAP        ------------------------------------------------------------
RL15_PELUB        ------------------------------------------------------------
RL15_AMOA5        ------------------------------------------------------------
RL15_CYTH3        ------------------------------------------------------------
RL15_AZOPC        ------------------------------------------------------------
RL15_FLAJ1        ------------------------------------------------------------
RL15_CHLTE        ------------------------------------------------------------
RL15_CHLT3        ------------------------------------------------------------
RL15_LACP7        ------------------------------------------------------------
RL15_RHOBA        ------------------------------------------------------------
RL15_DESOH        ------------------------------------------------------------
RL15_FINM2        ------------------------------------------------------------
RL15_SYNAS        ------------------------------------------------------------
RL15_AQUAE        ------------------------------------------------------------
RL15_SULSY        ------------------------------------------------------------
RL15_HYDS0        ------------------------------------------------------------
RL15_THETH        ------------------------------------------------------------
RL15_BDEBA        ------------------------------------------------------------
RL15_ELUMP        ------------------------------------------------------------
RL15_SALRD        ------------------------------------------------------------
RL15_PETMO        ------------------------------------------------------------
RL15_THEYD        ------------------------------------------------------------
RL15_COPPD        ------------------------------------------------------------
RL15_SYMTH        ------------------------------------------------------------
RL15_OPITP        ------------------------------------------------------------
RL15_HERA2        ------------------------------------------------------------
RL15_ROSCS        ------------------------------------------------------------
RL15_DEHM1        ------------------------------------------------------------
RL15_LEIXX        -------------MADDKSTNEAAAKPVAEKATATALAKKAPAKAAAADKAAPAAKGETV
RL15_SACEN        ------------------------------------------------------------
RL15_TROW8        ------------------------------------------------------------
RL15_GLOVI        ------------------------------------------------------------
RL15_TRIEI        ------------------------------------------------------------
RL15_PROMS        ------------------------------------------------------------
RK15_ARATH        MATPLSISSNPLTSRHCYRLHLSSTSFKGNVSVLGANPSQILSLKLNQTLKTRNQQQFAR
RL15_RUBXD        ------------------------------------------------------------
RL15_DESMR        ------------------------------------------------------------
RL15_LAWIP        ------------------------------------------------------------
RL15_ACIC5        ------------------------------------------------------------
RL15_SOLUE        ------------------------------------------------------------
RL15_LEPBJ        ---------------------------------------------------------MKK
RL15_METI4        ------------------------------------------------------------
RL15_CHLMU        ------------------------------------------------------------
RL15_PARUW        ------------------------------------------------------------
RL15_AKKM8        ------------------------------------------------------------
RL15_TREDE        ------------------------------------------------------------
RL15_TREPA        ------------------------------------------------------------
RL15_FUSNN        ------------------------------------------------------------
RL15_BORA1        ------------------------------------------------------------
RL15_XANOR        ------------------------------------------------------------
RL15_HAHCH        ------------------------------------------------------------
RL15_PSYWF        ------------------------------------------------------------
RL15_FRAP2        ------------------------------------------------------------
RL15_HALHL        ------------------------------------------------------------
RL15_METCA        ------------------------------------------------------------
RL15_LEGPC        ------------------------------------------------------------
RL15_ACIF2        ------------------------------------------------------------
RL15_BLOFL        ------------------------------------------------------------
RL15_WIGBR        ------------------------------------------------------------
RL15_BUCBP        ------------------------------------------------------------
RL15_NITEU        ------------------------------------------------------------
RL15_ANAD2        ------------------------------------------------------------
RL15_MYXXD        ------------------------------------------------------------
RL15_DESPS        ------------------------------------------------------------
RL15_GEOLS        ------------------------------------------------------------
RL15_MAGMM        ------------------------------------------------------------
RL15_DEIRA        ------------------------------------------------------------
RL15_LACF3        ------------------------------------------------------------
RL15_OENOB        ------------------------------------------------------------
RL15_LACLM        ------------------------------------------------------------
RL15_MESFL        ------------------------------------------------------------
RL15_PHYMT        ------------------------------------------------------------
RL15_MYCH2        ------------------------------------------------------------
RL15_MYCS5        ------------------------------------------------------------
RL15_MYCMO        ------------------------------------------------------------
RL15_CAMC1        ------------------------------------------------------------
RL15_HELPH        ------------------------------------------------------------
RL15_MYCGA        ------------------------------------------------------------
RL15_MYCPN        ------------------------------------------------------------
RL15_MYCPE        ------------------------------------------------------------
RL15_UREPA        ------------------------------------------------------------
RM10_SCHPO        ------------------------------MFNILSRVCRSSSFHGFLRSSGYPRFGA--
RM10_YEAST        ----------------------MKAERQTGLRNSFTTVIGRKLINTFVPSMMLTSVAGND
RL15_AERPE        ------------------------------------------------------------
RL15_DESA1        ------------------------------------------------------------
A8ABZ8_IGNH4      ------------------------------------------------------------
L0ACL8_CALLD      ------------------------------------------------------------
RL15_PYRAE        ------------------------------------------------------------
RL15_THEPD        ------------------------------------------------------------
A8MCN4_CALMQ      ------------------------------------------------------------
RL15_SULAC        ------------------------------------------------------------
Q975K2_SULTO      ------------------------------------------------------------
F4B8F3_ACIHW      ------------------------------------------------------------
A9A598_NITMS      ------------------------------------------------------------
A0RUE5_CENSY      ------------------------------------------------------------
K0IC83_NITGG      ------------------------------------------------------------
RL15_ARCFU        ------------------------------------------------------------
F2KSS9_ARCVS      ------------------------------------------------------------
L0HPG7_ACIS0      ------------------------------------------------------------
D3TB26_ACIB4      ------------------------------------------------------------
RL15_METTH        ------------------------------------------------------------
RL15_METS3        ------------------------------------------------------------
RL15_METJA        ------------------------------------------------------------
RL15_METKA        ------------------------------------------------------------
RL15_THEKO        ------------------------------------------------------------
RL15_THEVO        ------------------------------------------------------------
Q6L1A5_PICTO      ------------------------------------------------------------
RL27A_DICDI       ------------------------------------------------------------
RL28A_SCHPO       ------------------------------------------------------------
RL27A_DROME       ------------------------------------------------------------
RL27A_TETTH       ------------------------------------------------------------
R27A1_ENTHI       ------------------------------------------------------------
RL27A_TRYBB       ------------------------------------------------------------
RL27A_ENCCU       ------------------------------------------------------------
RL15_HALMA        ------------------------------------------------------------
RL15_HALLT        ------------------------------------------------------------
RL15_METAC        ------------------------------------------------------------
G7WMQ5_METH6      ------------------------------------------------------------
A3CT19_METMJ      ------------------------------------------------------------
I7J9G7_METBM      ------------------------------------------------------------
E1RKL9_METP4      ------------------------------------------------------------
A2SPM4_METLZ      ------------------------------------------------------------
L0HHW8_METFS      ------------------------------------------------------------
A7I5R1_METB6      ------------------------------------------------------------
B8GKF5_METPE      ------------------------------------------------------------
Q2FSG7_METHJ      ------------------------------------------------------------
A0B9U8_METTP      ------------------------------------------------------------
F4BZU1_METSG      ------------------------------------------------------------
RM15_BOVIN        ------------------------------------------------------------
Q74MA5_NANEQ      ------------------------------------------------------------
                                                                              

RL15_BART1        --------------------MKLNELRDCEGATK-NRKRIGRGIGSGTG-KTGGRGVKGQ
RL15_ERYLH        --------------------MKLNDLRDNEGARK-GRIRVGRGIGSGKG-KTGGRGQKGQ
RL15_PHEZH        -------------------MTKLNELAPREGSTK-NRMRVGRGPGSGKG-KTAGRGVKGQ
RL15_METSB        --------------------MKLNEIQDNPGSSK-SRMRVGRGIGSGKG-KTCGRGVKGQ
RL15_ACICJ        --------------------MKLNELRDNPGARP-KSKRLGRGIGSGKG-KTSGKGVKGQ
RL15_EHRRG        ----------------MDVVMKLNNIFSGLPKKK-KSKVLGRGIGCGKG-KTSGRGHKGQ
RL15_WOLPP        ----------------MNDAVKLNSIFTKLSKKK-KPKLLGRGIGCGKG-KTSGRGHKGQ
RL15_ORITB        --------------------MKLNTLFNLNGAKK-CSKRIGRGIGSGKG-KTCGRGAKGQ
RL15_RICAE        --------------------MKLNELYNNIGAKK-NKKRIARGIGSGKG-KTGGRGIKGQ
RL15_BORAP        ---------------------MFSLLKP-KGAAK-RRKIVGRGPGSGLG-KTSGRGQKGQ
RL15_PELUB        ---------------------MTTLNTTGKVLYK-KKMRVGRGIGSGKG-KTSGRGVKGQ
RL15_AMOA5        --------------------MELNTLKPAKNSVK-QNTRYGRGQGSGKG-GTSTRGHKGA
RL15_CYTH3        --------------------MKLHTLRPAKGSVK-TSKRIGRGTGSGRG-GTSTKGHKGA
RL15_AZOPC        --------------------MNLSSLKPVKGSTK-TCKRVGRGQGSGCG-GTSTRGHKGQ
RL15_FLAJ1        --------------------MNLSNLQPAEGSTHNQNKRVGRGEGSGKG-GTAARGHKGA
RL15_CHLTE        --------------------MDLSSLRPAKGAVK-ARKRVGRGPGSGNG-TTAGKGNKGQ
RL15_CHLT3        --------------------MNLSTLQPAKGAIK-SGRRIGRGQGSGSG-TTAGRGNKGH
RL15_LACP7        --------------------MNLTDLRPADGSKQSGNFRRGRGHGSGNG-KTAGKGHKGQ
RL15_RHOBA        --------------------MQLNDVHRGI-TKHRPRKRIGRGPGSGTG-KTSGRGHKGH
RL15_DESOH        --------------------MDLSNLSPAPGS-TKARKRLGRGPGSGNG-TTAGRGNKGH
RL15_FINM2        --------------------MKLHNLRPAKGGEVKARKRVGRGYGSGLG-HNAGRGRDGQ
RL15_SYNAS        --------------------MDLSQLRPPEGS-RKKRKRIGRGSGSGHG-GTSCKGHKGQ
RL15_AQUAE        -------------------MVELHDLQPHWGATK-EKKRVGRGIGSGHG-KTAGRGHKGQ
RL15_SULSY        --------------------MRLHELKPNEGATH-KKKRVGRGIGSGHG-KTSTKGQKGQ
RL15_HYDS0        --------------------MNLHELKPNESAVK-DKKRIGRGLGSGKG-KTAGRGYKGQ
RL15_THETH        --------------------MKLSDLRPNPGANK-RRKRVGRGPGSGHG-KTATRGHKGQ
RL15_BDEBA        -------------------MSLLKTLAPKAGSKH-APKRIGRGIGSGMG-GTATKGHKGQ
RL15_ELUMP        -------------------MVKLNELFPKHGSRK-AKRRIGLGVGSGLG-RSATKGMKGQ
RL15_SALRD        --------------------MDLSNLKPAEGATQ-AGQRLGRGEGSGRGGHSSTRGTKGQ
RL15_PETMO        ------------------MPLKIEDLKPTPGSRK-PKKRLGRGIGSGLG-KTAGKGHKGE
RL15_THEYD        --------------------MKINDLKPAPGSKK-KAKRIGRGLGSGHG-RYATKGLKGQ
RL15_COPPD        --------------------MRLHTLQPAPGAKS-TRKRVGRGTSSGHG-KTSGFGHKGQ
RL15_SYMTH        --------------------MKLHELAPNPGARH-ERKRVGRGIGSGLG-KTSGRGHKGQ
RL15_OPITP        --------------------MKLHELKNVKGAVH-RKKRVGCGEGGGHG-KTSGRGGKGQ
RL15_HERA2        --------------------MKLHDLKPAPGSTR-KSKRVGRGHGSGKG-KTSGKGMMGQ
RL15_ROSCS        --------------------MKLHDLKPALGAHR-KRKRIGRGIGSGKG-KTGGKGMMGQ
RL15_DEHM1        --------------------MRLNELSPAPGSKK-DRKRVGRGD-AGRG-NYSGRGMKGQ
RL15_LEIXX        AAKPAKASAKKDVAAPREQVLKVHHLRPAAGAKK-EKTRVGRGE-GSKG-KTAGRGTKGT
RL15_SACEN        ------------------MVIKIHDLRPAPGSKR-DKIRVGRGE-GSKG-KTAGRGTKGT
RL15_TROW8        -----------------MRLIKLHHLRPAPGSRR-ARIRVGRGE-GSKG-KTAGRGTKGT
RL15_GLOVI        -----------------MKSLRLEDAVPQSGSRH-RKLRVGRGHSAGQG-KTSGRGMRGQ
RL15_TRIEI        --------------------MRLKDAIPKKGSQQ-RGRRVGRGISAGQG-ASCGKGMRGQ
RL15_PROMS        ------------------MTSTLNTLKSNSGSRK-KKLRKGRGIAAGQG-ASCGFGMRGQ
RK15_ARATH        PLVVVSQTAATSSAVVAPERFRLDNLGPQPGSRK-KQKRKGRGISAGQG-ASCGFGMRGQ
RL15_RUBXD        --------------------MRLNELSPPPGSRR-ARKRVGRGEGSGYG-KTSGRGQKGA
RL15_DESMR        --------------------MKLHELYPFPEERA-SRKRVGRGRATGWG-CTSGRGNKGQ
RL15_LAWIP        --------------------MNLTTLYPFLEERK-LRKRVGRGSASGLG-CTSGKGNKGQ
RL15_ACIC5        --------------------MNLSNLRA-PKKANRNRKRVGRGMGSGHG-KTSTRGHKGQ
RL15_SOLUE        --------------------MNLSGIKP-PKGQVKTKKRIGRGMGSGHG-KTATRGSKGQ
RL15_LEPBJ        ERLEQAAAFGKERAKKKKNTDTTSNLVPVPKGAKKEKKRVGRGPGSKVG-KTAGRGSKGQ
RL15_METI4        --------------------MMLNDVRP-AIGAKKRKKRVGCGESSGHG-KTSGRGHKGQ
RL15_CHLMU        -------------------MIKLEYLQD-PSPRKRRTKLLGRGPSSGHG-KTSGRGHKGD
RL15_PARUW        -------------------MITLNTLKD-STRKRKPRKRVGRGIGSKHG-KTCGRGEKGA
RL15_AKKM8        -------------------MLQLHTIKP-NPGAKHRKKRLGNGESSGLG-KTCGKGNKGQ
RL15_TREDE        -------------------MFEFNLTVP-AGATHKK-KIVGRGSSSGWG-KTSGKGHKGQ
RL15_TREPA        -------------------MADFHLIAP-KGANRAR-RIVGRGSSSGRG-TTSGRGTKGQ
RL15_FUSNN        --------------------MKLNELSP-SVPKKNR-KRIGRGNSSGWG-KTAGKGSNGQ
RL15_BORA1        -------------MSD----IQLNSLKPAEGAKH-AKRRVGRGIGSGLG-KTAGRGHKGQ
RL15_XANOR        -------------MRSNPMTLRLNDLKPADGART-QRTRVGRGIGSGLG-KTAGRGHKGS
RL15_HAHCH        --------------------MKMNTLKPAEGSKQ-SPKRLGRGIGSGLG-KTGGRGHKGQ
RL15_PSYWF        ------------------MGLKLNELSPGVGAKK-TAHRKGRGIGSGLG-KTGGRGVKGQ
RL15_FRAP2        --------------------MKLNTIAPAAGSKS-APKRLGRGIGSGLG-KTSGKGHKGQ
RL15_HALHL        --------------------MRLNQLSPSAGSRP-DAKRAGRGAGSGLG-KTAGRGHKGQ
RL15_METCA        --------------------MFLNTIGARDGSRP-EKKRVGRGIGSTLG-KTCGRGHKGQ
RL15_LEGPC        --------------------MNLNTLSPDPGSRP-SRRRVGRGIGSGLG-KTCGKGHKGQ
RL15_ACIF2        --------------------MKLNTIAPAEGSKK-DRRRVGRGIGSGFG-KTAGRGHKGQ
RL15_BLOFL        -------------------MFSLNTIAPALGAKR-VGKRVARGIGSGFG-KTAGRGHKGQ
RL15_WIGBR        --------------------MYLNTISPMKKSNH-SSKRKGRGIGSGKG-KTSGRGHKGQ
RL15_BUCBP        --------------------MYLNTLSPNSKSHK-KSKRVGRGIGSGFG-KTSGRGHKGQ
RL15_NITEU        --------------------MKLNTIKPGIGSAK-PKRRVGRGIGSGLG-KTCGRGHKGQ
RL15_ANAD2        --------------------MSLNQLKAPRGANR-AKKRVGRGQGSGLG-KTAGRGGKGQ
RL15_MYXXD        -------------------MSTLNKLQRPARSWH-RKKRVGRGQGSGLG-KTAGRGGKGQ
RL15_DESPS        -------------------MLTLGNLSPQEGSTK-QRKRLGRGPGSGHG-KTAGRGHKGF
RL15_GEOLS        --------------------MELNSLRPALGSTK-NRKRIGRGIGSGHG-KTATKGHKGQ
RL15_MAGMM        --------------------MKLNEIPAVPGNQQ-SRNRVGRGPGSGNG-KTAGRGHKGQ
RL15_DEIRA        --------------------MKLHDLKPTPGSRK-DRKRVGRGPG-GTD-KTAGRGHKGQ
RL15_LACF3        --------------------MQLNELKPVAGSRF-KRLRKGRGLSSGHG-FTSGRGTKGQ
RL15_OENOB        --------------------MDLSTLKPVAGSRK-SSTRKARGFSAGKG-KTAGRGQKGQ
RL15_LACLM        --------------------MELHSLKAAEGSRK-VRNRVGRGTSSGNG-KTSGRGQKGQ
RL15_MESFL        --------------------MKLHELKYTEGSKK-DVTRVGRGMASGKG-KTSTRGHKGQ
RL15_PHYMT        ---------------------MLHQIKPFKGARK-TVKRLGRGCGSGTG-KTSGKGHKGQ
RL15_MYCH2        ------------------MSIRLENLSYTPGARK-EKHRKGRGHAAGKG-KQAGRGQSGQ
RL15_MYCS5        ------------------MSLKLHNLKPTPNSRP-EKHRKGRGHAAGKG-KQAGKGQSGQ
RL15_MYCMO        --------------------MNLHELKYNEGARK-EKHRVGRGHAAGKG-KQAGKGQSGQ
RL15_CAMC1        --------------------MALEKLTPAAGST-HATKRIGRGQGSGNG-KTAGKGNKGQ
RL15_HELPH        ------------------MIMGLENLKPAKGSV-KKIKRVGRGQGSGMG-KTATRGGKGQ
RL15_MYCGA        --------------------MKLHELKSAPKSRNHKAKVVGRGHGSGLG-KTSGRGQKGQ
RL15_MYCPN        --------------------MELNQLKSVPKARNHKTKTLGRGHGSGLG-KTSGRGQKGQ
RL15_MYCPE        --------------------MKLENLKSKEGSR-HKTKRVGRGFGSGIG-KTSTRGSKGQ
RL15_UREPA        --------------------MQLHNLEYKKGSRNHKEKRVGRGHGSGLG-KTSGRGQDGQ
RM10_SCHPO        ---------------SFRGISMLNDLNNS-ANYQ-SKKRVGRGPASGLG-KTSGRGHKGS
RM10_YEAST        IFFRGLFKSPVLAFQSYRYVSILGQLKPSDGSTK-SFKRLGRGPSSGLG-KTSGRGQKG-
RL15_AERPE        ---------------------MVVRRRKKSRKLRGRTRTMSWGRIGQHR-KSGSKGGYGA
RL15_DESA1        ---------------------MVVRKGKKSRKLQGRTRTMGWGRVGQHR-KSGSRGGFGA
A8ABZ8_IGNH4      ---------------------MVVRRRRKSRKLRGRTRTMGWGRIGQHR-RSGARGGFGR
L0ACL8_CALLD      -------------------MALTSRSRKKSRKLRGRTRSMGWGRVGQHR-KSGSKGGTGG
RL15_PYRAE        ----------------------MVRRFKRGTKYRRGSRTHGWGRVGQHR-KSGGSGGKGM
RL15_THEPD        -----------------------MRREKKSRAYR-GSRTHGWGRVGQHR-KSGSRGGRGL
A8MCN4_CALMQ      ----------------------MRRREKKSRKLR-GWRTHSWGRVGQHR-SRGQRGGGGK
RL15_SULAC        ---------------------MVVRKEKKSRKYR-GYRTHGWGTKGQHR-DRGAQGGR-Q
Q975K2_SULTO      ---------------------MTVRKEKKSRKYR-GYRTHGWGTKGQHR-DRGAQGSR-Q
F4B8F3_ACIHW      ---------------------MVVRKEKKSRKMR-GYRTMGWGSKGQHR-NRGARGGR-Q
A9A598_NITMS      ----------------------MATRLRKTRRLR-GGRHMGWGQVGQHR-ASGHKGGLGV
A0RUE5_CENSY      ----------------------MATRNRKTRKLR-GSRTHGWGQVGQHR-ASGHKGGVGV
K0IC83_NITGG      ----------------------MATRFRKSRRQR-GSRYCGWGQIGQHR-QAGSRGGIGG
RL15_ARCFU        -------------------MILMPKKKVK---KFRGSRTFGWGSHKNRR-GRGNRGGAGN
F2KSS9_ARCVS      ----------------------MPKKKVK---KFRGSRTCGGGSHKNNRSGRGSRGGAGN
L0HPG7_ACIS0      ----------------------MARKKSR---KMRGSNTYGHG-RKGRR-GAGRKGGRGY
D3TB26_ACIB4      ----------------------MARKKSR---KMRGSNTYGHG-IKGRR-GAGRKGGRGY
RL15_METTH        ----------------------MIRKRRK-ITRMRGSRTVGGGCSKKRR-GAGHRGGRGQ
RL15_METS3        ----------------------MIRSKRK-INKLRGSRSNGGGCTKKRR-GAGNKGGRGN
RL15_METJA        ----------------------MIRKKKK-VKKIRGSRTCGGGSHKKRR-GAGNKGGRGM
RL15_METKA        ---------------------MVVRRKKKSPKKYRGSRTHGGGSHKNRR-GAGNRGGRGM
RL15_THEKO        ----------------------MIRRRKK-VRKLRGSHTHGWGCKKKHR-GGGSKGGRGM
RL15_THEVO        ----------------------MVRERTK----KLRGGHYGRGMKAGRG--KGKKGGRGN
Q6L1A5_PICTO      ----------------------MVRTRTK----KLRGGHYGRGMKAGRG--KGKKGGNGM
RL27A_DICDI       ----------------------MPTRFSKHRKSR-GDVCAGYGRVGKHR-K--HPGGRGN
RL28A_SCHPO       ----------------------MPTHVSKTRKLR-GHVSAGHGRIGKHR-K--HPGGRGK
RL27A_DROME       ---------------------MSNIKRKKTRKLR-GHVSHGHGRIGKHR-K--HPGGRGN
RL27A_TETTH       ----------------------MVSHLKKTRKLR-GHVSHGHGRVGKHR-KGGCRGGRGK
R27A1_ENTHI       ----------------------MATRFRQTRRRR-GHVSMGYGRIGKHR-K--QRGGRGN
RL27A_TRYBB       ----------------------MPTRFKKTRHQR-GSTFCGYGRVGKHR-K--HPSGRGN
RL27A_ENCCU       ----------------------MTDRVKKTRKLR-GHVSHGYGRVGKHR-K--HSGGRGL
RL15_HALMA        -----------------------MTSKKK---RQRGSRTHGGGSHKNRR-GAGHRGGRGD
RL15_HALLT        -----------------------MTNKKR---RQRGSRTHGGGTHKNRR-GAGHRGGRGA
RL15_METAC        -------------------------MDTK---KFRGSRTCGGGTHKNRR-GAGNRGGRGK
G7WMQ5_METH6      ----------------------MPKSKVK---KFRGSRTCGGGTHKNRR-GAGSRGGTGN
A3CT19_METMJ      ----------------------MPVNKRS---KYRGSRTCGGGTHKNRR-GAGNRGGRGR
I7J9G7_METBM      ----------------------MPVNKRS---KYRGSRTCGGGTHKNRR-GAGNRGGRGR
E1RKL9_METP4      ----------------------MPVNKRS---KYRGSRTCGGGTHKNRR-GAGNRGGKGR
A2SPM4_METLZ      ----------------------MPVNKRS---KFRGTRTCGGGTHKNRR-GAGNRGGRGA
L0HHW8_METFS      ----------------------MPTNKRS---KFRGSRTCGGGTHKNRR-GAGNRGGRGR
A7I5R1_METB6      ----------------------MPTNKRS---KYRGSRTCGGGTHKNRR-GAGNRGGRGR
B8GKF5_METPE      ----------------------MPVNKRS---KYRGSRTCGGGTHKNRR-GAGNRGGRGR
Q2FSG7_METHJ      ----------------------MPVNKRS---KYRGSRTCGGGTHKNRR-GAGNRGGRGR
A0B9U8_METTP      ----------------------MVREHTK---KKRGHRTYHG-KHKNQR-GGGSRGGRGN
F4BZU1_METSG      ----------------------MVRPKTK---EKRGHRTYHG-KHKNMR-GGGTRGGRGD
RM15_BOVIN        ---MAGPVRGAAGPWALDLLRALPRVSLANLRPNPGSRKPERRRRGQRRGRKCGRGHKGE
Q74MA5_NANEQ      ----------------------MVVRRRKKYHKYKGERHARRGYNDRNR-NAGIRGGRGK
                                                                         .    

RL15_BART1        KSR----SGVSLNGFEGGQMPIYRRLPK-RGFKN--FFSK--------------------
RL15_ERYLH        KSR----SGVAIKGFEGGQMPLHMRLPK-RGFNN--PFGK--------------------
RL15_PHEZH        KAR----TGVSIAGFEGGQMPLHMRMPK-RGFNS--RNRK--------------------
RL15_METSB        KAR----TGVAIKGFEGGQMPLHRRLPK-RGFYN--PFGL--------------------
RL15_ACICJ        KAR----EGVSLNGFEGGQLPIYRRLPK-RGFNN--VNRK--------------------
RL15_EHRRG        KAR----SGVSINGFEGGQQSIFTRLPK-RGFNS--LPKN--------------------
RL15_WOLPP        KAR----SGVSINGFEGGQQSIYTRLPK-RGFKP--IRKN--------------------
RL15_ORITB        KSR----AKVA-RGFEGGQTPLIKRLPK-RGFKS--MNKR--------------------
RL15_RICAE        KSR----SGVAIKGFEGGQTPIIKRLPK-RGFNC--ISTK--------------------
RL15_BORAP        KAR----NTSPRLGFEGGQTPLYRRLPR-KGFSN-NDYKL--------------------
RL15_PELUB        KSR----SGVAIKAFEGGQMPLYRRLPK-RGFNAIKRYQA--------------------
RL15_AMOA5        KSR-SG-YKSKPG-FEGGQLPLQRRLPM-YGFKNPNRV----------------------
RL15_CYTH3        KSR-SG-YSSKIG-FEGGQMPLQRRLPK-FGFKPLNKI----------------------
RL15_AZOPC        KSR-SG-YSKKIG-FEGGQMPIQRRLPK-FGFKSINRV----------------------
RL15_FLAJ1        KSR-SG-YSKKIG-FEGGQMPLQRRVPK-FGFKNINRK----------------------
RL15_CHLTE        QSR-SG-YQRPV--IEGGQMPIYRRLPK-FGFTPPNQK----------------------
RL15_CHLT3        KAR-SG-YTSKN--FEGGQMPLHRRLPK-FGFSVPNPV----------------------
RL15_LACP7        KAR-SG-APRV-G-FEGGQMPLYRRLPK-RGFKNRNTK----------------------
RL15_RHOBA        KSR-SG-YSRKPN-FQGGAMPMFRRVPK-RGFNNRWAL----------------------
RL15_DESOH        NSR-SG-GGVRPG-FEGGQMPLHRRLPK-RGFVNIFAK----------------------
RL15_FINM2        NSR-SG-GGVRPG-FEGGQMPLFRRLPK-RGFKNHFAK----------------------
RL15_SYNAS        NAR-SG-GGVRDG-FEGGQMPLSRRLPK-RGFRSRILK----------------------
RL15_AQUAE        KSR-SG-DRKMPPYFEGGQTPLYMRIPK-RGFKNPT------------------------
RL15_SULSY        TSR-SG-DSKLPARFEGGQTPFIMRIPK-RGFKNPS------------------------
RL15_HYDS0        KSR-SG-DNRVAPYFEGGQTPLHMRVPK-VGFRSPF------------------------
RL15_THETH        KSR-SG-GLKDPRRFEGGRSTTLMRLPK-RGMQGQVPGEI--------------------
RL15_BDEBA        LAR-TG--GTVRRGFEGGQTPLHRRLPK-FGFSNVA------------------------
RL15_ELUMP        SSR-SG--NTKKESKEGGQMPLYRRVPK-SGFSNAT------------------------
RL15_SALRD        SSR-SG-SGTRPIWFEGGQTPLFQRVPK-HGFNNAP------------------------
RL15_PETMO        KAR-GR--GKIGRTFEGGQTNIIRRTPK-FGFSNAP------------------------
RL15_THEYD        KSR-SG--GAKGAGFEGGQMPLQRRVPK-RGFSNAP------------------------
RL15_COPPD        KAR-SG-RVGKRG-FEGGQTPLYKKLPKIMRFKNYPFK----------------------
RL15_SYMTH        KAR-SG-GGVRPG-FEGGQMPLTRRLPK-RGFSNAPFK----------------------
RL15_OPITP        TAR-SG-SSIRPG-FEGGQMPLYRKLPH-RGFNQYNFR----------------------
RL15_HERA2        KAR-SG-PNPYPH-FEGGQNPLVRRMPYKRGFTNRFRV----------------------
RL15_ROSCS        KAR-SG-PNPSPS-FEGGQMRITRKMPKLRGFKNRWRI----------------------
RL15_DEHM1        KAR-SG-GATRPG-FEGGQLPIYLRLPRKRGFFNPFRI----------------------
RL15_LEIXX        KAR-Y---QVRPG-FQGGQLPFHMRTPKLRGFKNPFRV----------------------
RL15_SACEN        KAR-K---NVSPR-FEGGQMPIHMRLPKLRGFKNRFRT----------------------
RL15_TROW8        KAR-A---PVRPG-FAGGQIPLHMSIPKLKGFKNHKKV----------------------
RL15_GLOVI        KCR-SG-GGVRPG-FEGGQIPLYMRLPKLKGFELVNPS----------------------
RL15_TRIEI        KSR-SG-GSTRPG-FEGGQNPLYRRLPKLKGFPMVNRK----------------------
RL15_PROMS        KSR-SG-RPTRPG-FEGGQMPLYRRVPKLKHFEIINQK----------------------
RK15_ARATH        KSR-SG-PGIMRG-FEGGQTALYRRLPKLRGIAGGMRSGL--------------------
RL15_RUBXD        KAR-SG-TKAYTT-YEGGQMPLQRRLPRLKGEARGRHTPA--------------------
RL15_DESMR        NSR-AG-AKHRAW-FEGGQMPIARRLPK-RGFKNYPFK----------------------
RL15_LAWIP        NAR-SG-GGVRPG-FEGGQMPLQRRLPK-HGFKNAFFK----------------------
RL15_ACIC5        RSR-SG-SRSMRG-FEGGQMPLHRRLPK-RGFTNI-------------------------
RL15_SOLUE        HAG-TG-FSQKRG-FEGGQMPLHRRLPK-RGFKNI-------------------------
RL15_LEPBJ        YAR-N---TVRRG-FEGGQMPIHRRLPK-RGFTAK-------------------------
RL15_METI4        KAR-AG-GSIRIG-FEGGQMPLIRRIPK-RGFNNKL------------------------
RL15_CHLMU        GSR-SG-YKRRFG-YEGGGVPLYRRVPT-RGFSHKRFD----------------------
RL15_PARUW        GAR-SG-YKRRLG-KEGGQMPLFMKLPL-RGFSNAQFR----------------------
RL15_AKKM8        KAR-SG-GTIRPG-FEGGQMPLHRRLPK-KGFNNTRFQ----------------------
RL15_TREDE        QAR-SG-GKVYAG-FEGGQMPLYRRVAK-KGFSNYPFK----------------------
RL15_TREPA        QAR-AG-HKAYVG-FEGGQMPLYRRVPR-RGFSNCAFK----------------------
RL15_FUSNN        NSR-AG-GGVKPY-FEGGQMPIYRRVPK-RGFSNAIFK----------------------
RL15_BORA1        KSR-SG-GFHKVG-FEGGQMPLQRRLPK-RGF-TPLGQH---------------------
RL15_XANOR        FARKGG-GKIKAG-FEGGQTPMQRRLPK-IGF-RSKMAR---------------------
RL15_HAHCH        TSR-SG-GTIRPG-FEGGQQPLQRRLPK-FGF-TSRVGR---------------------
RL15_PSYWF        KSR-SG-SGVRRG-FEGGQMPLFRRVPK-FGF-TSQMAL---------------------
RL15_FRAP2        KAR-SG-GYHKVG-FEGGQMPIQRRLPK-FGF-TSASKR---------------------
RL15_HALHL        HSR-SG-GFHKVG-FEGGQMPLQRRVPK-YGF-SSQKGL---------------------
RL15_METCA        KAR-AG-GFHKVG-FEGGQMPLQRRLPK-VGF-RSAKKR---------------------
RL15_LEGPC        KSR-AG-GYHKIN-FEGGQMPIQRRLPK-MGF-KSREGR---------------------
RL15_ACIF2        HAR-SG-GYHKVG-FEGGQMPLQRRIPK-RGF-RNTLGV---------------------
RL15_BLOFL        KSR-SG-CKIKVS-FEGGQTPLHRRLPK-FGF-KSRKSI---------------------
RL15_WIGBR        RSR-SG-GKVRRG-FEGGQMPLYRRLPK-FGHNKSKKSF---------------------
RL15_BUCBP        KSR-SG-CKIRRG-FEGGQMPLYRRIPK-FGF-VSLKKE---------------------
RL15_NITEU        KSR-AG-GFHKVG-FEGGQMPLQRRLPK-RGFTVYGKK----------------------
RL15_ANAD2        KAR-SG-NMHFEG-FEGGQMPLQRRLPK-FGF-HNIFRR---------------------
RL15_MYXXD        KAR-TG-NMRFEG-FEGGQSPLQRRLPK-FGF-TPPNRT---------------------
RL15_DESPS        KSR-SG-SGIKPG-FEGGQMPLQRRLPK-RGF-TNIFKK---------------------
RL15_GEOLS        KAR-SG-GSIKPG-FEGGQMPLQRRLPK-RGF-RPLDRN---------------------
RL15_MAGMM        KAR-SG-GFHKSG-FEGGQMPLQRRLPK-RGF-KNFTRK---------------------
RL15_DEIRA        KSR-SG-AGKGAF-FEGGRSRLIARLPK-RGF-NNV-GT---------------------
RL15_LACF3        KAH-G---KTRLG-FEGGQMPLYRQKPK-RGF-TSMDHK---------------------
RL15_OENOB        KAR-EG-KKLRLS-FEGGQMPLMRRMPK-RGF-NNISRK---------------------
RL15_LACLM        KSR-SG-GGVRPG-FEGGQTELFRRMPK-RGF-LNVNRK---------------------
RL15_MESFL        NSR-SG-GGVRVG-FEGGQTPLYRRLPK-IGF-TSPNQK---------------------
RL15_PHYMT        LAR-SG-GGVRPG-FEGGQIPFFQRIPK-RGF-HNINQK---------------------
RL15_MYCH2        KKR-S---TVRLG-FEGGQNPWFRRVPK-RGF-RNFNKK---------------------
RL15_MYCS5        NKR-K---GHRLG-FEGGQTPWFRRIGK-RGF-KNVNHV---------------------
RL15_MYCMO        LKR-T---GSKPG-FEGGQNPWYRRVPK-RGF-NNVNHI---------------------
RL15_CAMC1        RAR-KG-YNEKRG-FEGGQQPLQRRLPK-VGFASKFEKPY--------------------
RL15_HELPH        TAR-TG-YKAKRG-FEGGQQPLQRRLPK-IGFRTKDSHIY--------------------
RL15_MYCGA        KAR-KS-GRTRPG-FEGGQTPLYRRLPK-FGFQTVGFKKQ--------------------
RL15_MYCPN        KAR-KS-GLTRPG-FEGGQTPLYRRLPK-FGNARKGFLKQ--------------------
RL15_MYCPE        KSR-KS-GHTRPG-FEGGQTTLYRRIPK-IGFNNKNFANN--------------------
RL15_UREPA        KAR-KS-GMVRLA-FEGGQTPLYRRVPK-VGFNNDRFANK--------------------
RM10_SCHPO        GQR--R-GRRIKPGFEGGQTPITKLFPK-VGHSTGHLKKP--------------------
RM10_YEAST        -QK--A-RGKVKSWFEGGQTPIYKLFPK-IGFTNVGAKPL--------------------
RL15_AERPE        AGLGK---HEWTWTIKYAPT-----WYGKKGFNPPRI-----------------------
RL15_DESA1        VGFHK---HKYIWIIKHAPN-----WYGKHGFRP-RS-----------------------
A8ABZ8_IGNH4      AGMHK---HFWTWVTAKSPG-----YFGKYGFHL-PP-----------------------
L0ACL8_CALLD      SGMNK---HRKTWMLKYYPN-----WFGAKGFVPIRN-----------------------
RL15_PYRAE        VGFHK---HKWSLVMKYGESGTGWPFYGKHGFKQ-PP-----------------------
RL15_THEPD        VGYHK---HKWSWTVKYAPD-----WYGKHGFTR-HP-----------------------
A8MCN4_CALMQ      IGLLK---HKKSLLLKITNGEL-YPLIGKHGFYR-PS-----------------------
RL15_SULAC        IGMHK---EKWSWTVKFGEG-----WYGKHGFRN--------------------------
Q975K2_SULTO      IGMHK---EKWSWLVKYGEG-----WYGKHGFVN--------------------------
F4B8F3_ACIHW      VGMHK---HKWSWLVKYGKD-----WYGKHGFVN--------------------------
A9A598_NITMS      TGMMK---HHWSTTLKDEPD-----HYGHDSTKP--P-----------------------
A0RUE5_CENSY      SGQLK---HHFSSMLKEDPG-----HFGHDSTHP--P-----------------------
K0IC83_NITGG      AGKHK---HFWIRTVIEEPD-----HFGHDPFNS--F-----------------------
RL15_ARCFU        AGVHK---HKYIKFVKLAKKG--EYLFGKHGFTRPKILRKDYLNVQAVKETLRWLKEEGK
F2KSS9_ARCVS      AGMFK---HKYLRAIKIG------YEIGKYGFTRPKTVRADYRMAQAVKERLRELKDEGK
L0HPG7_ACIS0      AGLGK---HHWSFALKHP-----EFLWGNHGFTSHHP------------------KEE--
D3TB26_ACIB4      AGLGK---HHWSFALKHP-----EYLWGAHGFTSHHP------------------KEE--
RL15_METTH        AGGHK---HHWTWIVKYD-----PKHFGKYGFKRPQK-----------------LIKR--
RL15_METS3        AGASK---QHWTWTAKFD-----PDHYGKHGFKRPQK-----------------MIKK--
RL15_METJA        AGGHK---HKWTWIIKYC-----PDYFGKYGFKRHPS-----------------LVKR--
RL15_METKA        AGSHK---HKWFHVIKYM-----PDHFGKRGFNRPPK-----------------VVRE--
RL15_THEKO        AGTGKRKDQKWTWTIKYA-----PDRLGKRGFHRPKA-----------------VQYI--
RL15_THEVO        AGMGK---HKWIWMVKYDPL-----HFGGKGFTSHHL-----------------------
Q6L1A5_PICTO      AGLGK---HRWVWLLKYDRD-----HFGVHGFKSHS------------------------
RL27A_DICDI       AGGLT---HHRINFDKYHPG-----YFGKLGMRHFHLL----------------------
RL28A_SCHPO       AGGLQ---HLRSHFDKYHPG-----YFGKVGMRRFHLM----------------------
RL27A_DROME       AGGMH---HHRINFDKYHPG-----YFGKVGMRNFHLR----------------------
RL27A_TETTH       AGGMH---HHRILMEKWHPG-----YYGKLGMRTFHLK----------------------
R27A1_ENTHI       AGGQH---HRKTWFTTFHPD-----YFGKHGMRVFHLK----------------------
RL27A_TRYBB       AGGEH---HHRINFRKYHPG-----YFGKCGMNHYHKK----------------------
RL27A_ENCCU       AGGFS---HMKTFFTRFHPD-----YHGKRGMRVYHRK----------------------
RL15_HALMA        AGRDK---HEFHNHEPL----------GKSGFKRPQKV----------------------
RL15_HALLT        AGRAK---HEFHNYGPL----------GKYGFKRPESA----------------------
RL15_METAC        AGGCK---HHFVRAMMR--GY----SYGKHGFKRPDEV----------------------
G7WMQ5_METH6      AGGCK---HHFVRDMML--GR----VMGKHGFFKHN------------------------
A3CT19_METMJ      AGQRD---HRFSHFYLK-GEI----ANGKHGF--VSKT----------------------
I7J9G7_METBM      AGQRD---HRFSHFYLK-GEI----SNGKHGF--VSKV----------------------
E1RKL9_METP4      AGHRD---HRFTHFLLA-DEV----HNGKHGF--FQQN----------------------
A2SPM4_METLZ      AGWRD---HNFTRWYLL-GKT-----EGKHGF--VSKI----------------------
L0HHW8_METFS      AGINA---HHFVKWYKEMGGP----VFGKDGF--CNQT----------------------
A7I5R1_METB6      AGINA---HHFVKWYVEMGGP----VFGKDGF--FHNP----------------------
B8GKF5_METPE      AGLNA---HRFAKFYLEDGGP----VYGKNGF--NHSP----------------------
Q2FSG7_METHJ      GGSRD---HKFVRGVVH-ANW----TYGTCGFKHHHRT----------------------
A0B9U8_METTP      AGTCK---HHWVRSIIR--GE----PMGKHGFVR--PN----------------------
F4BZU1_METSG      SGKCK---HHFMRSILL--GT----EMGKHGFVRL-PL----------------------
RM15_BOVIN        RQR----GTRPRLGFEGGQTPFYLRIPK-YGFNEGHSFRR--------------------
Q74MA5_NANEQ      AGYGKMKDHKKSI------------YIPAKGFNNPTTK----------------------
                                                                              

RL15_BART1        -------I---YNEVSLGRIQLAVDTGKLNIEK---PVDMIALKEAGIIRREK----DGV
RL15_ERYLH        -------D---FAEVNIGMVQKFIDAKKLDGKK---DITEEALREAGLVRGGK----DGV
RL15_PHEZH        -------D---FAEVNLWRIEQAIAAGKLDAKA---AIDAEALLKAGVIRRAK----DGV
RL15_METSB        -------D---YNEINLGRLQEAVDAGRIDVAA---VVTNESLIASGLISKPR----DGV
RL15_ACICJ        -------D---YAPLNVGTLAALIESGKIDAGQ---KITEATLRAAGVYAGSKL---AGV
RL15_EHRRG        -------K---YSIINVSLIQRLIDSGKIDNVS---AITKEVLYNLGVISSVK----QKI
RL15_WOLPP        -------L---YSIFNVGDVQCLMEAKKIVKDS---IIDKELLHKLGFIRSVK----SKI
RL15_ORITB        -------N---YNIINIITILRLVKANKIEYGA---VIDKLLLLKLKMLKKSI----NKI
RL15_RICAE        -------K---YNIINIYNIEEALADGRLSADD---NITKEKLVEARVVNNKN----NK-
RL15_BORAP        -------E---YAIVNLGDI-----DKKFNDGQ---VVNYDTLLENKLIRKKN----KKI
RL15_PELUB        -------V---IAIMNLEKIQTFITEKTINSGD---VINMALLKKLKLINKNS----QKL
RL15_AMOA5        ----------SYKPINLDTIQQLAEKA--QLT----VINPEVLHQHGLVS--KR---DKC
RL15_CYTH3        ----------EFKPINLDELLELIEKT--GAS----VIDTALMNQNGLIG--KN---DKV
RL15_AZOPC        ----------EYKAVNLSVIQSLIDTR--CLA----KIGIDDLVDAGIVS--AN---RLV
RL15_FLAJ1        ----------EYEGVNLDTLQLLVDNG--VITD---SVSMTDFVANRLAS--KN---EIV
RL15_CHLTE        ----------AVACVNVAQIQMWIEKG--LVGE---EISVLDLKHLCNAS--NQ---EYF
RL15_CHLT3        ----------KIRTVNVADLEKYVEKG--LLEK---EITLESFKSIGIIG--KK---DRL
RL15_LACP7        ----------EIISVNVSMLN-RFEDG--ADV------TLESLREIGIIS--NPK--DGV
RL15_RHOBA        ----------TIFAVNVGKLNDAFNEG--ETV------TLEALAAKNLAK--GNF--DEL
RL15_DESOH        ----------DIAVVNIRDLARFESGS--VVD-------GEALKAKGLVK--GRV--DGI
RL15_FINM2        ----------QYAEINIRDLNCFEDGE--EIT-------PEILANAGFFKPAKAK--DGV
RL15_SYNAS        ----------DIVTLNVEKLNGFQTGV--EID-------EHRLKESGMVK--SSA--EKI
RL15_AQUAE        --------RKEYTPVNVGVIDK-----LFEDGM---EITPEVLASKGLCD-EKD----RV
RL15_SULSY        --------KIEYEIVNLKALEN-----KFNENE---EVNPQTLKEKGLVK-KGE----CV
RL15_HYDS0        --------KKEYSVINLSMLEK-----HFNDGD---EITKETLLAKSLIK-KGK----PV
RL15_THETH        -------KRPRYQGVNLKDLAR-----FEG------EVTPELLVRAGLLK-KGY----RL
RL15_BDEBA        -------FANNFEIVNVGQL--------AKFSG---EVTPESLHAAGLI--SKG----AV
RL15_ELUMP        -------FAKRFDYVNIGSLEK-----ACKAGE---EVTPETMKTLGLVK-CAK----RV
RL15_SALRD        -------FRTDYAIANVKRLQRLLDEEVLDEDE---PVTPEVLADLGVVR-TAN----RV
RL15_PETMO        -------FKKVYSVVNVETLEK-----YFSENE---EVTPDILLEKKLIKKLND----GV
RL15_THEYD        -------FKKEYAIVNLEDLNK-----IIDEVD---IITPETLLQKGIVKDLKD----GL
RL15_COPPD        ---------IEYEVVNVEKLNRF-----DSG-T---VVDIGTLVDTGLVSSLSA----KV
RL15_SYMTH        ---------VRYEVVNVADLERF-----EAG-T---VVTPELLDETRVCKNATK----GV
RL15_OPITP        ---------TELPVVNVGDLASL-----DASIT---EVTAEVLAAQGLIRAGET----SV
RL15_HERA2        ----------EYTVVNVGDLIE------WNNG----DVTPEALREVGLIKNLKQ----PI
RL15_ROSCS        ----------EYQIINTGQLNN------VPDGT---ELTINAMIEQGWVQPAK-----PV
RL15_DEHM1        ----------EYTVVNIEQLNI------FEAGT---EVTPETMLAAGLIRNFVK----PV
RL15_LEIXX        ----------EYQVVNLEKLAEL-----YPAGG---DVTVAALVAKGAVRKNE-----KV
RL15_SACEN        ----------EFHGVNVGKLAAA-----FPQGG---TVGIDELISAGLANKGE-----LV
RL15_TROW8        ----------EYSVISIKRLCEA-----YPSGG---VVTRDNVMSVIGKKRG------FV
RL15_GLOVI        ----------SYTIVNLKQLRD------LPADS---EVNIETLLDAGILTAT----SGPL
RL15_TRIEI        ----------KYTIINVSKLSS------LPANT---EVTLASLIKVGIITTD----DGPL
RL15_PROMS        ----------NFSIINLEKLND------FKDND---TVNIDSLVKKGLIFKP----KFPL
RK15_ARATH        ---------PKYLPVNIKDIETAG----FQEGD---EVSLETLKQKGLINPSGRERKLPL
RL15_RUBXD        -------HPKVYDPVNVGELAA-------VEGD---TIGLDELRAAGLIRKKA---DTLV
RL15_DESMR        ---------VVFQPINLDRLLAS-----FDGKD---AITLDDIYDRGLAPAGA-----LV
RL15_LAWIP        ---------VEYAIFNLDWLTTF-----FKGKN---EILLEDIYSHKLCSVGT-----PV
RL15_ACIC5        -------FRTEYTVLNLSRLAEL------NET----ELTIDAFIAKGLLDKRNG----LL
RL15_SOLUE        -------FKKQFAIVNLGRLEKL------EGN----SFTIDTMLQLGLINKVYD----GV
RL15_LEPBJ        -------FHKEFYPVNLRDIEKS------GLTG---NIDAKIMVQSKILDKETT----LF
RL15_METI4        -------FHVFYAPVNLSALQGI------QQE----VIDESLLRQIGVVKGKWD----GI
RL15_CHLMU        ---------KCVEEITTQRLNGI-----FENGE---EVSLETLKQRKVIHRETS----RV
RL15_PARUW        ---------RQFDVINLDQIEAV-----FKDGE---TVDELSLRERGFISGRTH----GI
RL15_AKKM8        ---------DKILIVNLSQLERV-----FEAGA---TVDENTLRAAKLVQGPCD----AV
RL15_TREDE        ---------KEFYVVNLAMLETK-----YSDGE---TVNKESLMQKGLLRKGSL----YV
RL15_TREPA        ---------KEYAVVNVGALEFV-----YAPGE---TVNRQTLIEKGLVKGRVP----FI
RL15_FUSNN        ---------KEYTVISLAFLNEN-----FEDGE---EVSLETLFNKCLIKKGRD----GV
RL15_BORA1        ----------LYAEVRLSDLQR------LDVE----EIDVQALKAAGVVGQGV---RY-A
RL15_XANOR        ----------DTAEVLSYQLDK------LDAG----DVDFVALRAANLVPSRA---KK-A
RL15_HAHCH        ----------FSEEVRLSEIDS------LGTD----IIDLAALKAANIVDQQA---KQ-V
RL15_PSYWF        ----------TTAEVRLSELNK------IDGD----VVSVETLKAANIIRHDM---KR-A
RL15_FRAP2        ----------YVAEIRLHELNG------LALE----EVTVDTLKDSGLIRKDI---KS-V
RL15_HALHL        ----------RTAEVRLHEIAR------VDGD----TVDLAALHKAGVVRKNM---RY-V
RL15_METCA        ----------FVAEVTLTQISK------VGGG----VIGLAELKEAGLVPTEA---KR-V
RL15_LEGPC        ----------TIDEVSLGELAK------LNDE----VIDLVALRKAGLINNSI---KD-V
RL15_ACIF2        ----------RVVEVALSQLES------AAIDG---VVDLEGLLLRRIVRGSP---DA-V
RL15_BLOFL        ----------VTQEITLFDLSR------IPEN----VIDLNVLKKYDIVSRKI---RF-V
RL15_WIGBR        ----------FKKEIKLSEFMK------IKDS----FIDLIVLKKNKIINSKI---KI-V
RL15_BUCBP        ----------KVAEVRLEDLKN------FSNC----IINLQFLKKTGLIKKNI---KY-V
RL15_NITEU        ----------QVREIKLSTLQL------IDLS----EFNPSVLYDHGLIKNIN---DP-V
RL15_ANAD2        ----------ELEEVKVGDLQ--------GLSG---VVDPAALKSAGLVRGNR---DG-V
RL15_MYXXD        ----------VYAVVNLSDLEQH-----FDAGA---TADVETLRKVGLVKGRY---HG-V
RL15_DESPS        ----------EFSLVALSQLDKF------EAGV---VVSPAELVEAGMV-KKG---TL-I
RL15_GEOLS        ----------EYVLINLQQLDVF------EAGS---CVDRDAMNAKGLL-KKS---DLPI
RL15_MAGMM        ----------EYTIVQVEDLEKF-----FDAGS---EVNAEALNDLGLLGKKQ---KSGI
RL15_DEIRA        ----------TYEVVKLSQLQDL-------EDT---TFDRDTLEAYRLVRRKN---RP-V
RL15_LACF3        ----------DFALVSLTTL-NQ-----FEDGA---EVTPEVLVANGVIKNV----KSGV
RL15_OENOB        ----------EYAIVNLDQL-NK-----FDDGT---TVSASSLKEAGIIKKE----LSGV
RL15_LACLM        ----------EYAIVNLETL-NR-----LEDGA---TVSAETLVAAKIVKDV----KSGV
RL15_MESFL        ----------EYVILNLSDL-ER-----L-NLA---LIDHKVLVEQKIIKNE----KQLV
RL15_PHYMT        ----------KYSIVNLGAL-EI-----LENNT---LVNQELLLEKKIIKSIL---PNGV
RL15_MYCH2        ----------EYEIFNLSDLESR-----YQDGD---TVSLESLYLKKVLKKRN----LKA
RL15_MYCS5        ----------EYQVVNLSSLEER-----YSNNE---TVTLESLFERNLIRRSVE--LRPV
RL15_MYCMO        ----------EYQVISIETLDAA-----FPDKA---EINPEVLHEKRIARNKN----LPI
RL15_CAMC1        -------VINVEKIAAIKELAEI-------------SIATIASVHKISKSVT------KI
RL15_HELPH        -------SINVEKNEAIKNLEEI-------------TFSSLRALHHFPLYIE------GV
RL15_MYCGA        -------TLSV-SLDIIAKLNET-------------TIDRELLVKHGIISSKTNE---PI
RL15_MYCPN        -------EWVVLNLNKIAKLKLD-------------KINRASLIEKQVISAKSQL---PI
RL15_MYCPE        -------YNVV-TLNNIVKLNLA-------------NVDKKVLVEKGLIEDN-KL---PI
RL15_UREPA        -------YNVV-TLISLVKYETK-------------ELTVEFMYANKIAKNE-DL---PI
RM10_SCHPO        -------LRLGLGRVQEWIDRG-----RLDASK---TITMKDLLDSRCCRG----IKHGV
RM10_YEAST        -------KELNLKRIQWFHDKNRL---HLQPGE---VLDMNKMRKLGLVTGP---IKYGV
RL15_AERPE        ------RAGLEVTTINVGQLDEIAALLEAQGKA--EKEDGKIVVNLEKLG--------IH
RL15_DESA1        ------RIH-ENVTINVGELDELAWRLASNGKA--IIEDGLIVLNTVEMG--------FD
A8ABZ8_IGNH4      ------EDRVEIKEINVGELDELARKLNTN------------VIDLAAMG--------YN
L0ACL8_CALLD      ------RLLHKKNTITLRELDQIAFKLRNTNVE-----GDKVVLNLNEMG--------YD
RL15_PYRAE        ------PISIEWRPINVGTLAELVKELKAEGKV--REEGGKYVINLLELG--------FN
RL15_THEPD        ------SLVVEYRTINVGQLDAEVEEFFRKGLA--SREGDAYVVDLTQLG--------FN
A8MCN4_CALMQ      ------P---EVNVINVGDLNGLIDSLQRRNLI--KMEGDKYIIDLTQLG--------YG
RL15_SULAC        ------PTSKLVNAIGLRKLQEYIDNDKIKIEE----ENGKKVVDLAKYG--------YD
Q975K2_SULTO      ------PTSKVYNVITMRKLQELIEKGEIKIKD----ENGKKVVDLTEYR--------YD
F4B8F3_ACIHW      ------PTSVKISAISLRDLQTSIENGSIKIDE----KDGKKIVDLTKYG--------FD
A9A598_NITMS      ------HPNITKKWASVRDLDDLFTKFGKE-------EGGKKVVDLENAG--------YE
A0RUE5_CENSY      ------HSNAAKKWASVRDLDDFHTRFGTE-------EGGKKVIDLAASG--------YD
K0IC83_NITGG      ------NRNLVQRWINVRDLDAVFAKHGKAD------ESGKVVLDLTSLG--------YD
RL15_ARCFU        LDDYTYRYLYSRPELNAGDLDEIIDRLASLGLA--EKEGDVYRIDLAELG--------YS
F2KSS9_ARCVS      LDDYTYKFLASRPELNVGDLDIILDRLVELGIA--AKEGETYSIDLSELG--------YT
L0HPG7_ACIS0      -----------IETINIGVLNENLDALVKQGIA--KLNEDVYEVDLSALG--------IK
D3TB26_ACIB4      -----------INTINIGVLNENIDALVENGFA--KLDGDIYEVDLSKMG--------IN
RL15_METTH        -----------LETVNLAYLDEMIPELLERGVA--SEEDGMVVLDVRDLG--------FE
RL15_METS3        -----------VNPVNLSYLEEQADNLIESGKA--SKDGDSIVIDVTELG--------YD
RL15_METJA        -----------LETINVGELEEIVLKNPDK--F--EKEDDKFVVDVIELG--------YE
RL15_METKA        -----------PNTINVGELDALADKLLEDGIA--EKDGDKIVIDVTDERLKPYG-GPFD
RL15_THEKO        -----------PKVINLNDIDENFELFKDAGII--YEEDGKLVFDATALG--------VD
RL15_THEVO        --------STPDVPINLGELENIFENLKADGFV--REENGETVVDLKAAG--------YD
Q6L1A5_PICTO      --------KKYENPITLEELANIYDKLKENGFV--HDD----VIDLEGAG--------YT
RL27A_DICDI       ------RNQYHCPTVSLEKIWTLVPESVRKSLA-AKNDGTAPVVDVTQKG--------FF
RL28A_SCHPO       ------KNPLWRPTVNLDRLWTLLPNEARDKYL-GKNTEVAPVINVLQSG--------YG
RL27A_DROME       ------RQHKFRPEINLDKLWSLVGAEKFAELE-KEKSTKAPVIDLVKFG--------YY
RL27A_TETTH       ------KNPLHCPVVNIDKLWSLVSDATRQKYA-EDKK-KVPVIDVTKAG--------FF
R27A1_ENTHI       ------ANKYYCPSINVDSLWSLVGKDIQAQYKNAKVGEEVPVIDCVKHG--------YF
RL27A_TRYBB       ------KNTTWKPTINLDNLTKLMAKDEAMKAK---KGEVLPVIDLLANG--------YS
RL27A_ENCCU       ------ENSDYARPISSARLWGMIPKEQRYDFL--DNPEKVPVIDVREFG--------YH
RL15_HALMA        --------QEEAATIDVREIDENVTLLAADDVA--EVEDGGFRVDVRDVVEEADD-ADYV
RL15_HALLT        --------QTEVLEVTVQKLDEDAALYAADDLA--EEDGDAYVIDARDVVEDGYE-ADVV
RL15_METAC        --------SRDVSIVNVGELDELASYLVEEGLA--EVKDGAYHINLENLGIE--------
G7WMQ5_METH6      --------AREVDVINVGDLDSMAT---EEGR--------------IDLGKM--------
A3CT19_METMJ      --------SEPVSALDVGEIDQMAEALLREGLA--TQEGDLIALDAAELGID--------
I7J9G7_METBM      --------SAPVSALDVGAIDQMAEALLQEGLA--AQEGDLIVLDTTELGID--------
E1RKL9_METP4      --------ASKVKAIDVGKLDQMADDLVACGAA--TLEGDSITIDAEQIGID--------
A2SPM4_METLZ      --------SVTYEVLDIGDLDQMIPDLVARGIA--TQNGDVITLDAAQIGVE--------
L0HHW8_METFS      --------SVDVTTIDVGALDQIVPSLLAQGIA--KKEGDAIVINTADLGIE--------
A7I5R1_METB6      --------ATSVSAMDVGIIDQIVPSLLAQGIA--KQEGDAVAINAADIGIE--------
B8GKF5_METPE      --------RVPVRALDIGTINQMVDELIANSVA--TKDGDTITLDTALIDVD--------
Q2FSG7_METHJ      --------SMTGNVLDIGQIDQILPSLLEQGTA--TRDGDAIVLNAADIGIE--------
A0B9U8_METTP      --------SFDIETINVGVLNEMVG---PEGR--------------IELHGV--------
F4BZU1_METSG      --------AEEVDVVNVDELDQLAG---QDGK--------------VEINEL--------
RM15_BOVIN        ----------QYQPLSLNRLQYLIDLGRVDPTQ---PIDLTQLVNGRGVTIQPSKRDYGV
Q74MA5_NANEQ      ----------EIKAINIRTIVENLDNLYKKGLV--TKEGDKYIIDLEKLG--------YN
                                                                              

RL15_BART1        RLLSDG-------DLKAK---------ITFHVSGASQAARVKVEKVGGQVISPEVVG---
RL15_ERYLH        RLLGKG-------ELKAK---------VKFIVAGASKGAVEAVEKAGGSVEVIPAAQPEH
RL15_PHEZH        KLLGKG-------ELKSK---------LNLTVYSATASARAAVEKAGGKLTTTKPEAAQD
RL15_METSB        KILGVG-------ELKAK---------LSFQVAAASKSAVAAIEAAGGSIELLKRAPEAP
RL15_ACICJ        RLLGRG-------EISQK---------VEIEVSGASASAIAAIEQAGGSVTTTVARAEPA
RL15_EHRRG        KILGDG-------KLNTT---------VCIEYDFISKSAKSQVTLLNSLSDSESK-----
RL15_WOLPP        KLLNKG-------KLREK---------FVFHVDFASEAAKRSVASVGGSVEILS------
RL15_ORITB        KLLWANP---SSLVLSSEDISLLTKLDLQFNLDEYSISARKNIIKLGMKVINN-------
RL15_RICAE        KLVKL-------LSICSDDFAA----PLSLKLDAYSSKAKDLIEKAGGKLL---------
RL15_BORAP        KILSNG-------KLTKK---------VSLEVSKISKTAESLVMKIGGTIKLV-------
RL15_PELUB        KILGTG-------EIKDK---------VNIEADLISKSAVEKLEKAGGTIQLKK------
RL15_AMOA5        KILGNG-------LLKT---------KLEVTAHAFSASASAAIEKLGGKANILNIYA---
RL15_CYTH3        KVLARG-------EVKSI--------KAEIIAHAFSASASEAITNAGGKVTLIG------
RL15_AZOPC        KILAGG-------IITS---------VVEVTAHAFSEKAEKAILKVGGTVIRTLKQ----
RL15_FLAJ1        KILGRG-------ELKA---------KLKVTAHKFTATAKAAIEAAGGEAVTI-------
RL15_CHLTE        KVLGNG-------ELTS---------TVTITAHFFSKSAEEKIAKAGGKIVKAYRTLEEA
RL15_CHLT3        KVLGTG-------EVSS---------ALTVTAHYFSESAKEKIEKAGGKTVVVFRTIEEA
RL15_LACP7        KILGNG-------ELTK---------KLNVKVSAFSESAIEKIKALGGNAEVI-------
RL15_RHOBA        KVLGDG-------ELTK---------KLTIQAHRFSKSAEEKISAAGGTAEKLAPKRTPD
RL15_DESOH        KLLGKG-------DIAY---------PLTVKVSHVSRSAREKIEAAGGAIEVIS------
RL15_FINM2        KILGDG-------EITK---------KLTIKANKFTKSAEEKITKAGGKVEVI-------
RL15_SYNAS        KILGKG-------EIDH---------PLTVKIKMISQGAKAKIEAAGGSVIEVV------
RL15_AQUAE        KILGDG-------EL-TK--------KFVIKAHAFSKSAKEKIEKAGGKWEIIS------
RL15_SULSY        KILGDG-------QL-TK--------KLTVKAHAFSASAEEKIKSVGGIAEKITAETT--
RL15_HYDS0        KILGMG-------EV-TK--------KFKVKVDAISSSAKQKIEAAGGSVEILEAAGE--
RL15_THETH        KILGEG-------E--AK--------PLKVVAHAFSKSALEKLKAAGGEPVLLEA-----
RL15_BDEBA        KILGNG-------EL-KT--------ALTVKAHKFSESAKKAIEAAGGKVEVIK------
RL15_ELUMP        KVLANG-------EL-KK--------GLKVSAHGFSATAKAAIEKAGGSVTVIEKK----
RL15_SALRD        KILGDG-------DL-FD--------ALEVKAHAFSESARQKIKQAGGSVTVVDQ-----
RL15_PETMO        KILGKG-------EI-SK--------PLVVKANIFSQTAREKIEAVGGKIEVIE------
RL15_THEYD        KILGNG-------EI-KK--------SITVKTNAISKSALQKIQSVGGKVEVI-------
RL15_COPPD        KILGQG-------EI-TK--------ALQVKVHAISKSAKEKIEAAGGSVEVVD------
RL15_SYMTH        KVLGTG-------EL-TK--------ALTVRAHAVSESARQKIEAAGGKVEVIGEATEEV
RL15_OPITP        KILGDG-------EL-SR--------ALKVTAVKFSESAKAKIEKAGGQAITA-------
RL15_HERA2        KVLGDG-------DL-NV--------ALKVRVHKVSASARQKIEAAGGS-------VELI
RL15_ROSCS        KILGDG-------EL-ER--------KLTIHAHKFSASARARIEAAGGAAIETPWIVERR
RL15_DEHM1        KILAAG-------HI-DR--------ALEVSAHKFSQAAKAQIEAAGGK-------VQEI
RL15_LEIXX        KVLGNG-------DI-AV--------KLNVAVDKVSGSAEQKIVAAGGS-------VNR-
RL15_SACEN        KILGDG-------DLEGV--------KLEVTAHAFTGSAQEKITAAGGS-------VTKL
RL15_TROW8        KLLSDG-------EV-TV--------KFDITVDKASAAAVEKITSAAGT-------VTQA
RL15_GLOVI        RVLGDG-------EA-HV--------ALQITAAYFTASAREKIEAAGGTCTVEA------
RL15_TRIEI        KILGDG-------DL-NI--------PLKVYAAAFTASARSKIEAAGGSCEEIGPAQAVS
RL15_PROMS        KILGNG-------KI-NV--------KLKVQAHSFTKVAKQKIEDAGGSCELINNK----
RK15_ARATH        KILGTG-------EL-SM--------KLTFKARAFSTQAKEKLEASGCTLTVLPGRKKWV
RL15_RUBXD        KILGDG-------EI-DR--------PVTVRAHAFSRAAREKIEAAGGRAEVL-------
RL15_DESMR        KILSVG-------EV-AA--------AVTVEAHKFSAKAAEKITAAGGKVIALGTPEALT
RL15_LAWIP        KILGSG-------SI-SN--------IVTIEAHKFSRSALKKLHEVGGQAKIIEK-----
RL15_ACIC5        KILGNG-------EL-TT--------AITVHAHKFSKSAQEKIEKVGGKAILVA------
RL15_SOLUE        KVLGTG-------VL-TR--------KITVEAHHFSKSALEKIQQAGGTAQMIGAETK--
RL15_LEPBJ        KILGTG-------EI-KK--------AIHVIADGFSQSAKEKIEKAGGSIKLRAEIELAA
RL15_METI4        KILGKG-------EI-TQ--------AYTFKVHAVSASAKEKIEKAGGKIELIKSTP---
RL15_CHLMU        KVILKG-------AL-DK--------KLVWKDAAIVLSEGVKSLIETV------------
RL15_PARUW        KLLGNG-------DL-TK--------KVKIHVHAISESAREKLTQAKVSFEIVK------
RL15_AKKM8        KLLGNG-------TL-TK--------NLNVVVDFVSASAREKVTQAGGTVTVLSEA----
RL15_TREDE        KVLGTG-------DI-TK--------KLTVDVDRISASAKEKIEKAGGTIVQSEA-----
RL15_TREPA        KILADG-------EL-TK--------SIVVRVDRVSARAQEKIQQAGGSVECIEAQER--
RL15_FUSNN        KVLGNG-------EL-NK--------KLTVKVHKISKSAKAAVEAKGGTVELVEVKGFER
RL15_BORA1        KVIKSG-------ELSRK--------V-VLRGITATAGARAAVEAAGG----SLA-----
RL15_XANOR        KIVLKG-------ELSKK--------F-VLKGVAATAGAKAAIEAAGG----SVEE----
RL15_HAHCH        KVILSG-------EITRA--------V-TVKGLKVTKGAQEAIQAAGG----KVEE----
RL15_PSYWF        RIILSG-------EITKA--------Y-TFKGVKVTKGAKAAIEAAGG----TVEVTEGT
RL15_FRAP2        KIIASG-------EIQKA--------V-SLKGIACTKGAKEAIEKAGG----KVE-----
RL15_HALHL        KVIASG-------TIDRA--------V-SVRGVKVTQGARKAIEAAGG----QVVEEG--
RL15_METCA        KIIATG-------SVGGV--------V-TVRGVGVTRGARAAIEAAGG----KVES----
RL15_LEGPC        KVILSG-------ELTAA--------I-KLKGLRVTKGARSAIESLGG----SIEE----
RL15_ACIF2        KVILTG-------EITQG--------L-TVRGLRVSAGARAAIEKAGG----KVED----
RL15_BLOFL        KIIMSG-------TFDKP--------V-IIRNLRISKGARDLIKSVGG----RIEEGE--
RL15_WIGBR        KIIFSK-------NFNKK--------I-NIKNLKVSKNAKKEIEFFGG----TIN-----
RL15_BUCBP        KIISSG-------SIITN--------ILIIRNLFVSKSVRNIIESSGG----KIEENN--
RL15_NITEU        KIILGN-------QLIKR--------AIKIKDLIISRGAKEAVEQMGG----LVELTVKD
RL15_ANAD2        VVLAGG-------ELSSA--------L-TVKVHRVTAGARATIEKAGG----KVELIPAP
RL15_MYXXD        KLLARG-------ELTKK--------V-TVVVHKASEAAKAAIQKAGG----AVEEIPLV
RL15_DESPS        KILANG-------EITKA--------V-TVKVDKISSQAKAQIEAAGG----TVVLTEVT
RL15_GEOLS        KVLANG-------DLTKA--------L-TIKADKFSKSAIDKIQAAGG----KI--EGIS
RL15_MAGMM        KLLANG-------DITKA--------I-TVYVDKASAAAVAKMEAAGG----KVVLAVVA
RL15_DEIRA        KLLASG-------EISRA--------V-TVHVDAASAAAIKAVEAAGG----RVVLPEVQ
RL15_LACF3        KVLATG-------KLE-K--------KLTVKANKFSASAVKAIEAAGG----TTEVI---
RL15_OENOB        KVLASG-------KLN-K--------KITIHAAKASQAAQDSIKEAGSKIILTTETADSE
RL15_LACLM        KVLANG-------ELTAK--------NLTVKVAKVSAAAKAAIEAAGG----SVEEA---
RL15_MESFL        KVLGKG-------SIT-S--------AINVKLNKVSKSAQAEIEKLGG----KVEVI---
RL15_PHYMT        KILSKG-------KLT-K--------KLNFKVSKYSKKAQENIKLVGG----NIEVN---
RL15_MYCH2        KLLANG-------DLT-K--------KLTVTTNAFSIAAQKKIEEKGG----KIEVR---
RL15_MYCS5        KVLAKG-------KLT-K--------KLTLQVHSVSQAAREAVEKAGG----KVEEL---
RL15_MYCMO        KLLANG-------ATK-K--------KFTIKLNAASKKAIELIEKAGG----KVEVI---
RL15_CAMC1        KLIGAS-------AKALA--------S-KIKDENVSVSGTK-------------------
RL15_HELPH        KLIGKD-------AKNLA--------S-KIKDERIKTSGQK-------------------
RL15_MYCGA        KVIGN--------KIDKK--------I-HLKINKISEGAKKAIQSAGGSIELI-------
RL15_MYCPN        KLIGHT-------KLEKP--------L-HFEVHKVSKQALKAVENANGSVKLLEK-----
RL15_MYCPE        KVIGTA-------TISKP--------I-SVSAHKFSKGSVATLEKSKSKFVVIK------
RL15_UREPA        KVIGNA-------VLPSG--------T-VVSAHKFSKGALESISNSKAKAQILE------
RM10_SCHPO        ELTADEPGLLKT--------------AISIEVSKATVQAIQQIKNAGGSITTVYFSPLAL
RM10_YEAST        KILASGKFHYNL--------------PIALEASRASAKAIAAIEKAGGKFTARYYTPLGL
RL15_AERPE        KLLGEG-------RVARP---------LKVITPLASELAIKKIEEAGGEVIVTRATREEA
RL15_DESA1        KVLGSG-------KVTRG---------LKVIAREITEEAKRKIEEAGGKVILLEELEAGS
A8ABZ8_IGNH4      KLLGFG-------KVKGS---------YTVIVAFASKKAIQKVKAAGGKVVTPDGEELEV
L0ACL8_CALLD      KLVANG-------KIYEK---------VKVIVKEATKKAIERVKEAGGEVIVEKIEEEEQ
RL15_PYRAE        KLLGGG-------TIDLP---------VIVYTPIASRTAVEKIEKAGGEVRIIHVIHR--
RL15_THEPD        KLTGSG-------QVRNK---------IIVKVPVATKRAISKIEAQGGRVEVAKTQEAGE
A8MCN4_CALMQ      KLLGEG-------KIQKP---------VVVKVRAASAKAIKAIKEAGGEVLIVQ------
RL15_SULAC        KLLGGG-------NLRLP---------LVIKVAKATEKAKERVKEIGGEIILTSSE----
Q975K2_SULTO      KLIGSS-------GLKIP---------LVIKVNMASKKAIEKVKELGGQIILTTSE----
F4B8F3_ACIHW      KLLGSG-------NLNISG--------LSIIVRHATEKAKQKLEKIGGEVILTPNS----
A9A598_NITMS      KLLGGG-------KVSNA---------YSVKVTQYTASAEEKLKAVGGEVISAAKEKSDG
A0RUE5_CENSY      KLLGGG-------TVSGA---------YSVKISRLTASAEEKIKRAGGEVLS--------
K0IC83_NITGG      KLLGGG-------SISGA---------YAIKVAKVSESAKSKIEAAGGEVIINEQYDDK-
RL15_ARCFU        KLLGSG-------KVTRK---------MEVKVFEATPKAVEKIEAAGGKVVAE-------
F2KSS9_ARCVS      KLLGAG-------KITKQ---------VKVIVDYATPKAAEKIQQVGGSVEA--------
L0HPG7_ACIS0      KLLGSG-------KVTKK---------IRVKVKYASSNAVEKIEDVGGEVIYE-------
D3TB26_ACIB4      KLLGKG-------KVTKK---------MRVKVKYASSNAVEKIEDVGGEVVYV-------
RL15_METTH        KVLGSG-------RITRP---------VHLKAYEFSRSATEKIEEAGGKAEVIE------
RL15_METS3        KVLAKG-------KITKS---------FIISAPQFSASAIEKIEEMGGEAIEL-------
RL15_METJA        KVLGKG-------KVTIP---------MIVKAVEVSEKAREKIEAVGGEVVEL-------
RL15_METKA        KVLGGG-------HVKRP---------LVVVAPEFTERAVEKLEEAGGEAREA-------
RL15_THEKO        KILGTG-------KLTRA---------LVVKAYYVTPKAEEKIKAAGGEVLLA-------
RL15_THEVO        KLLGSG-------NFSVK---------SRIIIDKATEKAISKLSAIGSKIENVGNTAE--
Q6L1A5_PICTO      KLLGTG-------DFDIK---------SRIKIERATEKAINKLSVHGITIENDE------
RL27A_DICDI       KVLGHG-------ILPTQP--------IIVKARYFSKVAEKKIKAVGGACILVA------
RL28A_SCHPO       KVLGKG-------RLPETP--------VIVQTRYVSRRAEEKIKQAGGVVELIA------
RL27A_DROME       KLLGRG-------HLPARP--------VIVKAKYFSKKAEDKIKKAGGVCLLSA------
RL27A_TETTH       KVLGKG-------RLPNQP--------VVVKAKYFSKTAERRIVAVGGACVLTA------
R27A1_ENTHI       KVLGKG-------FLPKQP--------VIVRARYFSEKAQQKIKAVGGACELTA------
RL27A_TRYBB       KLLGNG-------HL-QAP--------CIVKARWVSKLADKKIRKAGGAVVLQA------
RL27A_ENCCU       VVVGGK-------LSLERP--------IVVKARYFTPSAKEEITKVGGKWIITY------
RL15_HALMA        KVLGAG-------QVRHE---------LTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
RL15_HALLT        KVLGGG-------QVRRE---------LRVTADAFTAGAVELIEEAGGEATLSERAEEAA
RL15_METAC        KVLGSG-------RVTKN---------LVVTSEEFSASAREKIENAGGSCIDAE------
G7WMQ5_METH6      KVLGKG-------SISRP---------VTVTAKAFSAAARAKIEEVGGEVVVS-------
A3CT19_METMJ      KVLGGG-------RVTHK---------MSISAREFSERARMKIEEMGGQATTV-------
I7J9G7_METBM      KVLGSG-------KVTHK---------LSISARAFSERARAKIEEMGGQVKTV-------
E1RKL9_METP4      KILGGG-------KITHK---------LIITAKEFSESARSKIEESGGQALTA-------
A2SPM4_METLZ      KILGGG-------KVTHK---------LAITAENFSGRAVAKIEELGGTTQTSE------
L0HHW8_METFS      KVLGSG-------RVTQK---------INVSATAFSEIAKAKIEKMGGKAQVVE------
A7I5R1_METB6      KVLGSG-------RVIRK---------LNISAAAFSAQAKAKIEKTGGKAQVI-------
B8GKF5_METPE      KVLGSG-------RVTAR---------FNITAKAFSEQAKAKIEAMGGQALIV-------
Q2FSG7_METHJ      KVLGGG-------QVTSK---------MNITAEAFSQSAIQKIEAKGGHALLS-------
A0B9U8_METTP      KVLGKG-------KVTRR---------LTVAAAAFSSSARSKIEAAGGEAVIV-------
F4BZU1_METSG      KVLGRG-------RVTRK---------LEVKALGFTAAAKSKIEAAGGQAVVV-------
RM15_BOVIN        QLVEEGAD-----TFKAK---------VNIEVQLASELAIAAIEKNGGVVTTAFYDPRSL
Q74MA5_NANEQ      KLIGRL-------TKPYP---------IVVKAKYIAETTKENLQSLGIEIE---------
                   :                                                          

RL15_BART1        ------------------------------------------------------------
RL15_ERYLH        EKKAARSEANKKAKAKAE------------------------------------------
RL15_PHEZH        ASAEA-------------------------------------------------------
RL15_METSB        TASAEA------------------------------------------------------
RL15_ACICJ        SA----------------------------------------------------------
RL15_EHRRG        ------------------------------------------------------------
RL15_WOLPP        ------------------------------------------------------------
RL15_ORITB        ------------------------------------------------------------
RL15_RICAE        ------------------------------------------------------------
RL15_BORAP        ------------------------------------------------------------
RL15_PELUB        ------------------------------------------------------------
RL15_AMOA5        ------------------------------------------------------------
RL15_CYTH3        ------------------------------------------------------------
RL15_AZOPC        ------------------------------------------------------------
RL15_FLAJ1        ------------------------------------------------------------
RL15_CHLTE        AKVNGLPFEEALLTPKAKVVKVKKEKKSVKS-----------------------------
RL15_CHLT3        QKMKKELFEEALLTPKVSVDEKKKAAKKLKA-----------------------------
RL15_LACP7        ------------------------------------------------------------
RL15_RHOBA        ERVEALKSEK--------------------------------------------------
RL15_DESOH        ------------------------------------------------------------
RL15_FINM2        ------------------------------------------------------------
RL15_SYNAS        ------------------------------------------------------------
RL15_AQUAE        ------------------------------------------------------------
RL15_SULSY        ------------------------------------------------------------
RL15_HYDS0        ------------------------------------------------------------
RL15_THETH        ------------------------------------------------------------
RL15_BDEBA        ------------------------------------------------------------
RL15_ELUMP        ------------------------------------------------------------
RL15_SALRD        ------------------------------------------------------------
RL15_PETMO        ------------------------------------------------------------
RL15_THEYD        ------------------------------------------------------------
RL15_COPPD        ------------------------------------------------------------
RL15_SYMTH        K-----------------------------------------------------------
RL15_OPITP        ------------------------------------------------------------
RL15_HERA2        DAAA--------------------------------------------------------
RL15_ROSCS        SRSRGPNPPRHHRKAEATPGA---------------------------------------
RL15_DEHM1        DYAAEIE-----------------------------------------------------
RL15_LEIXX        ------------------------------------------------------------
RL15_SACEN        DR----------------------------------------------------------
RL15_TROW8        R-----------------------------------------------------------
RL15_GLOVI        ------------------------------------------------------------
RL15_TRIEI        NEDSTKE-----------------------------------------------------
RL15_PROMS        ------------------------------------------------------------
RK15_ARATH        KPSVAKNQARADEYFAKKRAAAAEAATSEPAASA--------------------------
RL15_RUBXD        ------------------------------------------------------------
RL15_DESMR        ETPTE-------------------------------------------------------
RL15_LAWIP        ------------------------------------------------------------
RL15_ACIC5        ------------------------------------------------------------
RL15_SOLUE        ------------------------------------------------------------
RL15_LEPBJ        SETKK-------------------------------------------------------
RL15_METI4        ------------------------------------------------------------
RL15_CHLMU        ------------------------------------------------------------
RL15_PARUW        ------------------------------------------------------------
RL15_AKKM8        ------------------------------------------------------------
RL15_TREDE        ------------------------------------------------------------
RL15_TREPA        ------------------------------------------------------------
RL15_FUSNN        AETNK-------------------------------------------------------
RL15_BORA1        ------------------------------------------------------------
RL15_XANOR        ------------------------------------------------------------
RL15_HAHCH        ------------------------------------------------------------
RL15_PSYWF        EE----------------------------------------------------------
RL15_FRAP2        ------------------------------------------------------------
RL15_HALHL        ------------------------------------------------------------
RL15_METCA        ------------------------------------------------------------
RL15_LEGPC        ------------------------------------------------------------
RL15_ACIF2        ------------------------------------------------------------
RL15_BLOFL        ------------------------------------------------------------
RL15_WIGBR        ------------------------------------------------------------
RL15_BUCBP        ------------------------------------------------------------
RL15_NITEU        VNGV--------------------------------------------------------
RL15_ANAD2        QTMHQ---KAKAAK--KAAAQAK-------------------------------------
RL15_MYXXD        AHKPESAAKAHAGKGVKAPRQPKA------------------------------------
RL15_DESPS        AAE---------------------------------------------------------
RL15_GEOLS        AC----------------------------------------------------------
RL15_MAGMM        DPEGDA------------------------------------------------------
RL15_DEIRA        TQQDDAQKAE--------------------------------------------------
RL15_LACF3        ------------------------------------------------------------
RL15_OENOB        N-----------------------------------------------------------
RL15_LACLM        ------------------------------------------------------------
RL15_MESFL        ------------------------------------------------------------
RL15_PHYMT        ------------------------------------------------------------
RL15_MYCH2        ------------------------------------------------------------
RL15_MYCS5        ------------------------------------------------------------
RL15_MYCMO        ------------------------------------------------------------
RL15_CAMC1        ------------------------------------------------------------
RL15_HELPH        ------------------------------------------------------------
RL15_MYCGA        ------------------------------------------------------------
RL15_MYCPN        ------------------------------------------------------------
RL15_MYCPE        ------------------------------------------------------------
RL15_UREPA        ------------------------------------------------------------
RM10_SCHPO        RAHLHPSSFRTP----PRPPLPVSKKDIRYYTNPHFAGYLAN-----VKNIRELYYGDQR
RM10_YEAST        RAHLNPQWFLEKRGRVPLQARPTKRRDIDFYSKEEKRGYLVMEKDKLLQDIKEAQNKGSR
RL15_AERPE        EES---------------------------------------------------------
RL15_DESA1        AT----------------------------------------------------------
A8ABZ8_IGNH4      EAAS--------------------------------------------------------
L0ACL8_CALLD      S-----------------------------------------------------------
RL15_PYRAE        ------------------------------------------------------------
RL15_THEPD        ------------------------------------------------------------
A8MCN4_CALMQ      ------------------------------------------------------------
RL15_SULAC        ------------------------------------------------------------
Q975K2_SULTO      ------------------------------------------------------------
F4B8F3_ACIHW      ------------------------------------------------------------
A9A598_NITMS      EEVVTEDG----------------------------------------------------
A0RUE5_CENSY      ------------------------------------------------------------
K0IC83_NITGG      ------------------------------------------------------------
RL15_ARCFU        ------------------------------------------------------------
F2KSS9_ARCVS      ------------------------------------------------------------
L0HPG7_ACIS0      ------------------------------------------------------------
D3TB26_ACIB4      ------------------------------------------------------------
RL15_METTH        ------------------------------------------------------------
RL15_METS3        ------------------------------------------------------------
RL15_METJA        ------------------------------------------------------------
RL15_METKA        ------------------------------------------------------------
RL15_THEKO        ------------------------------------------------------------
RL15_THEVO        ------------------------------------------------------------
Q6L1A5_PICTO      ------------------------------------------------------------
RL27A_DICDI       ------------------------------------------------------------
RL28A_SCHPO       ------------------------------------------------------------
RL27A_DROME       ------------------------------------------------------------
RL27A_TETTH       ------------------------------------------------------------
R27A1_ENTHI       ------------------------------------------------------------
RL27A_TRYBB       ------------------------------------------------------------
RL27A_ENCCU       ------------------------------------------------------------
RL15_HALMA        AEAEETEDADADEE----------------------------------------------
RL15_HALLT        DESENTSDDEDDEA----------------------------------------------
RL15_METAC        ------------------------------------------------------------
G7WMQ5_METH6      ------------------------------------------------------------
A3CT19_METMJ      ------------------------------------------------------------
I7J9G7_METBM      ------------------------------------------------------------
E1RKL9_METP4      ------------------------------------------------------------
A2SPM4_METLZ      ------------------------------------------------------------
L0HHW8_METFS      ------------------------------------------------------------
A7I5R1_METB6      ------------------------------------------------------------
B8GKF5_METPE      ------------------------------------------------------------
Q2FSG7_METHJ      ------------------------------------------------------------
A0B9U8_METTP      ------------------------------------------------------------
F4BZU1_METSG      ------------------------------------------------------------
RM15_BOVIN        EILCKPIPFFLRGQPIPKRMLPPEALVPYYTDARNRGYLADPARFPEARLELAKKYGYIL
Q74MA5_NANEQ      ------------------------------------------------------------
                                                                              

RL15_BART1        ----------------------------------------------------
RL15_ERYLH        ----------------------------------------------------
RL15_PHEZH        ----------------------------------------------------
RL15_METSB        ----------------------------------------------------
RL15_ACICJ        ----------------------------------------------------
RL15_EHRRG        ----------------------------------------------------
RL15_WOLPP        ----------------------------------------------------
RL15_ORITB        ----------------------------------------------------
RL15_RICAE        ----------------------------------------------------
RL15_BORAP        ----------------------------------------------------
RL15_PELUB        ----------------------------------------------------
RL15_AMOA5        ----------------------------------------------------
RL15_CYTH3        ----------------------------------------------------
RL15_AZOPC        ----------------------------------------------------
RL15_FLAJ1        ----------------------------------------------------
RL15_CHLTE        ----------------------------------------------------
RL15_CHLT3        ----------------------------------------------------
RL15_LACP7        ----------------------------------------------------
RL15_RHOBA        ----------------------------------------------------
RL15_DESOH        ----------------------------------------------------
RL15_FINM2        ----------------------------------------------------
RL15_SYNAS        ----------------------------------------------------
RL15_AQUAE        ----------------------------------------------------
RL15_SULSY        ----------------------------------------------------
RL15_HYDS0        ----------------------------------------------------
RL15_THETH        ----------------------------------------------------
RL15_BDEBA        ----------------------------------------------------
RL15_ELUMP        ----------------------------------------------------
RL15_SALRD        ----------------------------------------------------
RL15_PETMO        ----------------------------------------------------
RL15_THEYD        ----------------------------------------------------
RL15_COPPD        ----------------------------------------------------
RL15_SYMTH        ----------------------------------------------------
RL15_OPITP        ----------------------------------------------------
RL15_HERA2        ----------------------------------------------------
RL15_ROSCS        ----------------------------------------------------
RL15_DEHM1        ----------------------------------------------------
RL15_LEIXX        ----------------------------------------------------
RL15_SACEN        ----------------------------------------------------
RL15_TROW8        ----------------------------------------------------
RL15_GLOVI        ----------------------------------------------------
RL15_TRIEI        ----------------------------------------------------
RL15_PROMS        ----------------------------------------------------
RK15_ARATH        ----------------------------------------------------
RL15_RUBXD        ----------------------------------------------------
RL15_DESMR        ----------------------------------------------------
RL15_LAWIP        ----------------------------------------------------
RL15_ACIC5        ----------------------------------------------------
RL15_SOLUE        ----------------------------------------------------
RL15_LEPBJ        ----------------------------------------------------
RL15_METI4        ----------------------------------------------------
RL15_CHLMU        ----------------------------------------------------
RL15_PARUW        ----------------------------------------------------
RL15_AKKM8        ----------------------------------------------------
RL15_TREDE        ----------------------------------------------------
RL15_TREPA        ----------------------------------------------------
RL15_FUSNN        ----------------------------------------------------
RL15_BORA1        ----------------------------------------------------
RL15_XANOR        ----------------------------------------------------
RL15_HAHCH        ----------------------------------------------------
RL15_PSYWF        ----------------------------------------------------
RL15_FRAP2        ----------------------------------------------------
RL15_HALHL        ----------------------------------------------------
RL15_METCA        ----------------------------------------------------
RL15_LEGPC        ----------------------------------------------------
RL15_ACIF2        ----------------------------------------------------
RL15_BLOFL        ----------------------------------------------------
RL15_WIGBR        ----------------------------------------------------
RL15_BUCBP        ----------------------------------------------------
RL15_NITEU        ----------------------------------------------------
RL15_ANAD2        ----------------------------------------------------
RL15_MYXXD        ----------------------------------------------------
RL15_DESPS        ----------------------------------------------------
RL15_GEOLS        ----------------------------------------------------
RL15_MAGMM        ----------------------------------------------------
RL15_DEIRA        ----------------------------------------------------
RL15_LACF3        ----------------------------------------------------
RL15_OENOB        ----------------------------------------------------
RL15_LACLM        ----------------------------------------------------
RL15_MESFL        ----------------------------------------------------
RL15_PHYMT        ----------------------------------------------------
RL15_MYCH2        ----------------------------------------------------
RL15_MYCS5        ----------------------------------------------------
RL15_MYCMO        ----------------------------------------------------
RL15_CAMC1        ----------------------------------------------------
RL15_HELPH        ----------------------------------------------------
RL15_MYCGA        ----------------------------------------------------
RL15_MYCPN        ----------------------------------------------------
RL15_MYCPE        ----------------------------------------------------
RL15_UREPA        ----------------------------------------------------
RM10_SCHPO        FPYEPIVKDK------------------------------------------
RM10_YEAST        HFLKQNVKKSSLEIELEELSPEKDWVPVVSNSKVMNIKALDH----------
RL15_AERPE        ----------------------------------------------------
RL15_DESA1        ----------------------------------------------------
A8ABZ8_IGNH4      ----------------------------------------------------
L0ACL8_CALLD      ----------------------------------------------------
RL15_PYRAE        ----------------------------------------------------
RL15_THEPD        ----------------------------------------------------
A8MCN4_CALMQ      ----------------------------------------------------
RL15_SULAC        ----------------------------------------------------
Q975K2_SULTO      ----------------------------------------------------
F4B8F3_ACIHW      ----------------------------------------------------
A9A598_NITMS      ----------------------------------------------------
A0RUE5_CENSY      ----------------------------------------------------
K0IC83_NITGG      ----------------------------------------------------
RL15_ARCFU        ----------------------------------------------------
F2KSS9_ARCVS      ----------------------------------------------------
L0HPG7_ACIS0      ----------------------------------------------------
D3TB26_ACIB4      ----------------------------------------------------
RL15_METTH        ----------------------------------------------------
RL15_METS3        ----------------------------------------------------
RL15_METJA        ----------------------------------------------------
RL15_METKA        ----------------------------------------------------
RL15_THEKO        ----------------------------------------------------
RL15_THEVO        ----------------------------------------------------
Q6L1A5_PICTO      ----------------------------------------------------
RL27A_DICDI       ----------------------------------------------------
RL28A_SCHPO       ----------------------------------------------------
RL27A_DROME       ----------------------------------------------------
RL27A_TETTH       ----------------------------------------------------
R27A1_ENTHI       ----------------------------------------------------
RL27A_TRYBB       ----------------------------------------------------
RL27A_ENCCU       ----------------------------------------------------
RL15_HALMA        ----------------------------------------------------
RL15_HALLT        ----------------------------------------------------
RL15_METAC        ----------------------------------------------------
G7WMQ5_METH6      ----------------------------------------------------
A3CT19_METMJ      ----------------------------------------------------
I7J9G7_METBM      ----------------------------------------------------
E1RKL9_METP4      ----------------------------------------------------
A2SPM4_METLZ      ----------------------------------------------------
L0HHW8_METFS      ----------------------------------------------------
A7I5R1_METB6      ----------------------------------------------------
B8GKF5_METPE      ----------------------------------------------------
Q2FSG7_METHJ      ----------------------------------------------------
A0B9U8_METTP      ----------------------------------------------------
F4BZU1_METSG      ----------------------------------------------------
RM15_BOVIN        PDITKDELFKMLSSRKDPRQIFFGLAPGWVVNMADKKILKPTDEKLLEYYSS
Q74MA5_NANEQ      ----------------------------------------------------